BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1222

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               278   2e-86   Sesamum indicum [beniseed]
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               278   4e-86   Nicotiana tomentosiformis
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               277   2e-85   Nicotiana sylvestris
emb|CDO97075.1|  unnamed protein product                                275   1e-84   Coffea canephora [robusta coffee]
gb|ABK29439.1|  sugar transport protein                                 274   1e-84   Coffea canephora [robusta coffee]
gb|EYU42629.1|  hypothetical protein MIMGU_mgv1a0059092mg               264   8e-84   Erythranthe guttata [common monkey flower]
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               271   2e-83   Sesamum indicum [beniseed]
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               270   3e-83   Nicotiana tomentosiformis
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               270   5e-83   Nicotiana sylvestris
ref|XP_002313809.1|  putative sorbitol transporter family protein       270   5e-83   Populus trichocarpa [western balsam poplar]
gb|ACB56939.1|  mannitol transporter                                    268   2e-82   Artemisia annua [sweet Annie]
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               266   2e-81   Populus euphratica
ref|XP_009785575.1|  PREDICTED: polyol transporter 5-like isoform X2    260   2e-81   Nicotiana sylvestris
ref|XP_009785574.1|  PREDICTED: polyol transporter 5-like isoform X1    260   3e-81   Nicotiana sylvestris
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                263   2e-80   
gb|AAZ80876.1|  putative sorbitol transporter                           256   3e-80   Nicotiana langsdorffii x Nicotiana sanderae
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                261   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               261   2e-79   Nicotiana tomentosiformis
gb|EPS69995.1|  sugar transport protein                                 260   4e-79   Genlisea aurea
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    259   6e-79   Populus euphratica
gb|AFI61955.1|  polyol transporter                                      259   1e-78   Camellia sinensis [black tea]
ref|XP_002519083.1|  sugar transporter, putative                        259   1e-78   Ricinus communis
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               259   1e-78   Solanum tuberosum [potatoes]
ref|XP_012069670.1|  PREDICTED: polyol transporter 5-like               258   2e-78   Jatropha curcas
ref|XP_008368693.1|  PREDICTED: polyol transporter 5-like               253   3e-78   
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             258   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010096202.1|  Polyol transporter 5                               257   5e-78   Morus notabilis
gb|KJB32189.1|  hypothetical protein B456_005G228500                    257   5e-78   Gossypium raimondii
ref|XP_012069657.1|  PREDICTED: putative polyol transporter 1           256   2e-77   Jatropha curcas
gb|KHG20989.1|  Polyol transporter 5 -like protein                      256   3e-77   Gossypium arboreum [tree cotton]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               254   7e-77   Malus domestica [apple tree]
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               253   8e-77   
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           254   9e-77   Pyrus x bretschneideri [bai li]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           253   2e-76   Pyrus x bretschneideri [bai li]
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                252   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           253   2e-76   Pyrus x bretschneideri [bai li]
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           253   2e-76   Pyrus x bretschneideri [bai li]
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    253   3e-76   Sesamum indicum [beniseed]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           252   3e-76   Pyrus x bretschneideri [bai li]
ref|XP_008246181.1|  PREDICTED: polyol transporter 5-like               248   3e-76   Prunus mume [ume]
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    252   3e-76   Sesamum indicum [beniseed]
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               252   4e-76   
ref|NP_001287655.1|  polyol transporter 5-like                          251   1e-75   Solanum lycopersicum
ref|XP_012069681.1|  PREDICTED: putative polyol transporter 1           251   2e-75   Jatropha curcas
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           249   6e-75   
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           249   7e-75   
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               248   9e-75   Eucalyptus grandis [rose gum]
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               247   1e-74   Solanum tuberosum [potatoes]
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      248   1e-74   
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     248   2e-74   Eucalyptus grandis [rose gum]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           248   2e-74   Prunus mume [ume]
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           247   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           247   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           247   3e-74   Pyrus x bretschneideri [bai li]
gb|KEH30427.1|  polyol/monosaccharide transporter 1                     241   6e-74   Medicago truncatula
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             246   7e-74   Prunus persica
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             246   7e-74   Prunus persica
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    246   7e-74   
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             246   9e-74   
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               246   1e-73   Fragaria vesca subsp. vesca
ref|NP_001281033.1|  polyol transporter 5-like                          246   1e-73   Malus domestica [apple tree]
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               245   2e-73   Eucalyptus grandis [rose gum]
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           245   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               245   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    245   3e-73   
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               245   3e-73   Eucalyptus grandis [rose gum]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               244   3e-73   Solanum tuberosum [potatoes]
gb|AGY96955.1|  polyol transporter 1                                    244   4e-73   Vitis vinifera
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               244   5e-73   Solanum tuberosum [potatoes]
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    244   5e-73   Vitis vinifera
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           244   5e-73   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                    244   5e-73   Pyrus pyrifolia [sha li]
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             244   5e-73   
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               243   2e-72   Sesamum indicum [beniseed]
gb|KHN25361.1|  Polyol transporter 5                                    242   2e-72   Glycine soja [wild soybean]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               242   3e-72   
ref|XP_008466959.1|  PREDICTED: polyol transporter 5-like               234   3e-72   Cucumis melo [Oriental melon]
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           242   3e-72   Prunus mume [ume]
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               241   3e-72   Prunus mume [ume]
gb|AAY88181.2|  mannitol transporter 1                                  240   5e-72   Olea europaea
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           241   5e-72   Prunus mume [ume]
ref|NP_001280902.1|  putative polyol transporter 1                      241   5e-72   Malus domestica [apple tree]
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           241   8e-72   Pyrus x bretschneideri [bai li]
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     239   8e-72   Medicago truncatula
dbj|BAM66295.1|  sorbitol transporter                                   239   8e-72   Pyrus pyrifolia [sha li]
gb|AAL85876.2|AF480069_1  mannitol transporter                          241   9e-72   Apium graveolens Dulce Group [celery]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               241   1e-71   Fragaria vesca subsp. vesca
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             241   1e-71   Prunus persica
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           241   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           240   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           240   1e-71   
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     240   2e-71   Medicago truncatula
gb|AAM44082.1|  putative sorbitol transporter                           240   2e-71   Prunus cerasus [pie cherry]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           240   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           240   2e-71   Malus domestica [apple tree]
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             239   2e-71   
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           239   3e-71   Pyrus x bretschneideri [bai li]
gb|ACD68477.1|  plasma membrane mannitol transporter                    236   4e-71   Arachis hypogaea [goober]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               239   4e-71   Citrus sinensis [apfelsine]
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           239   4e-71   Pyrus x bretschneideri [bai li]
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           239   7e-71   Malus domestica [apple tree]
dbj|BAM66296.1|  sorbitol transporter                                   236   7e-71   Pyrus pyrifolia [sha li]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             238   8e-71   Citrus clementina [clementine]
ref|NP_001281038.1|  polyol transporter 5-like                          237   9e-71   Malus domestica [apple tree]
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           238   1e-70   
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               238   2e-70   Prunus mume [ume]
ref|NP_001289249.1|  polyol transporter 5-like                          237   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               237   3e-70   Cicer arietinum [garbanzo]
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               236   3e-70   Prunus mume [ume]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           236   8e-70   
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           235   1e-69   Elaeis guineensis
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           235   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAJ29291.1|  putative polyol transporter protein 4                  234   2e-69   Lotus japonicus
gb|AAN07021.1|  putative mannitol transporter                           234   2e-69   Phelipanche ramosa
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             234   3e-69   Citrus clementina [clementine]
gb|ACB86853.1|  mannitol transporter                                    234   4e-69   Citrus sinensis [apfelsine]
emb|CAP58707.1|  putative polyol transported protein 2                  234   6e-69   Hevea brasiliensis [jebe]
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             233   8e-69   Phaseolus vulgaris [French bean]
gb|KJB12317.1|  hypothetical protein B456_002G011600                    231   1e-68   Gossypium raimondii
gb|AAL38359.1|  sugar transporter protein                               224   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    232   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               231   4e-68   Camelina sativa [gold-of-pleasure]
dbj|BAC83310.1|  putative sorbitol transporter                          230   5e-68   Oryza sativa Japonica Group [Japonica rice]
gb|KHN39768.1|  Polyol transporter 5                                    230   7e-68   Glycine soja [wild soybean]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          230   8e-68   Oryza sativa Indica Group [Indian rice]
emb|CAP58706.1|  putative polyol transporter protein 1                  230   9e-68   Hevea brasiliensis [jebe]
ref|NP_001236592.1|  sorbitol-like transporter                          230   9e-68   
gb|KJB12315.1|  hypothetical protein B456_002G011400                    230   1e-67   Gossypium raimondii
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          229   1e-67   Sorghum bicolor [broomcorn]
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               230   2e-67   Cucumis sativus [cucumbers]
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               230   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               229   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               229   2e-67   Tarenaya hassleriana [spider flower]
ref|NP_001060108.1|  Os07g0582400                                       230   2e-67   
gb|KJB12316.1|  hypothetical protein B456_002G011500                    229   3e-67   Gossypium raimondii
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               229   4e-67   Citrus sinensis [apfelsine]
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               227   9e-67   Pyrus x bretschneideri [bai li]
gb|AGG19156.1|  sorbitol transporter                                    227   9e-67   Pyrus pyrifolia [sha li]
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               227   1e-66   Oryza brachyantha
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               226   1e-66   Pyrus x bretschneideri [bai li]
ref|XP_003607077.1|  Sorbitol-like transporter                          227   2e-66   Medicago truncatula
gb|AAO39267.1|AF482011_1  sorbitol transporter                          226   3e-66   Prunus cerasus [pie cherry]
ref|NP_001281036.1|  polyol transporter 5-like                          225   4e-66   Malus domestica [apple tree]
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           225   6e-66   Phoenix dactylifera
gb|AAO88964.1|  sorbitol transporter                                    224   8e-66   Malus domestica [apple tree]
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               224   9e-66   Zea mays [maize]
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         225   9e-66   
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               224   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               224   1e-65   Glycine max [soybeans]
gb|KJB12318.1|  hypothetical protein B456_002G011700                    224   2e-65   Gossypium raimondii
emb|CDX95491.1|  BnaC01g33830D                                          224   2e-65   
gb|AAT06053.2|  sorbitol transporter                                    224   2e-65   Malus domestica [apple tree]
ref|XP_002885281.1|  ATPLT5                                             224   2e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         224   2e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               223   3e-65   Setaria italica
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               223   3e-65   Prunus mume [ume]
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    224   3e-65   Arabis alpina [alpine rockcress]
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           224   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188513.1|  polyol transporter 5                                  224   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    223   5e-65   Brassica rapa
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             222   6e-65   Prunus persica
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    223   8e-65   Brassica rapa
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          223   1e-64   Sorghum bicolor [broomcorn]
ref|XP_004148312.2|  PREDICTED: polyol transporter 5-like               222   1e-64   Cucumis sativus [cucumbers]
emb|CAD58709.1|  polyol transporter                                     222   1e-64   Plantago major [cart-track plant]
gb|AIU41385.1|  sorbitol transporter 1                                  221   2e-64   Prunus salicina [Japanese plum]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             221   2e-64   Phaseolus vulgaris [French bean]
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               221   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_003603886.1|  Mannitol transporter                               221   3e-64   Medicago truncatula
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             219   1e-63   Phaseolus vulgaris [French bean]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    218   2e-63   Cucumis melo [Oriental melon]
ref|XP_010908358.1|  PREDICTED: probable polyol transporter 6           219   2e-63   
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               217   1e-62   Cicer arietinum [garbanzo]
emb|CDY61985.1|  BnaC03g73840D                                          217   1e-62   Brassica napus [oilseed rape]
emb|CDP10064.1|  unnamed protein product                                216   2e-62   Coffea canephora [robusta coffee]
emb|CAR82417.1|  polyol transporter                                     211   4e-62   Plantago major [cart-track plant]
gb|EMT15230.1|  Polyol transporter 5                                    214   8e-62   
ref|NP_001045505.2|  Os01g0966900                                       213   1e-61   
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               214   1e-61   Glycine max [soybeans]
gb|AAG43998.1|AF215837_1  mannitol transporter                          213   2e-61   Apium graveolens Dulce Group [celery]
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             213   2e-61   Phaseolus vulgaris [French bean]
dbj|BAJ85302.1|  predicted protein                                      214   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          213   2e-61   Sorghum bicolor [broomcorn]
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    213   3e-61   Tarenaya hassleriana [spider flower]
gb|ABX71752.1|  mannitol transporter                                    213   3e-61   Apium graveolens
gb|AEX55225.1|  sugar transporter                                       213   4e-61   Allium sativum
gb|KHN25431.1|  Polyol transporter 5                                    213   4e-61   Glycine soja [wild soybean]
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             213   5e-61   Capsella rubella
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              212   6e-61   
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    211   1e-60   
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    212   1e-60   Tarenaya hassleriana [spider flower]
emb|CAD58710.1|  polyol transporter                                     211   1e-60   Plantago major [cart-track plant]
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    211   1e-60   Setaria italica
gb|EMS55536.1|  Polyol transporter 5                                    211   2e-60   Triticum urartu
emb|CDP02097.1|  unnamed protein product                                211   2e-60   Coffea canephora [robusta coffee]
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           209   3e-60   
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             209   3e-60   Phaseolus vulgaris [French bean]
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           210   4e-60   Phoenix dactylifera
ref|XP_010095276.1|  putative polyol transporter 6                      209   4e-60   Morus notabilis
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               209   5e-60   Cucumis melo [Oriental melon]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    209   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           209   7e-60   
ref|XP_004148314.2|  PREDICTED: polyol transporter 5-like               209   9e-60   Cucumis sativus [cucumbers]
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    209   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             208   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    207   2e-59   Phoenix dactylifera
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    207   3e-59   Phoenix dactylifera
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               207   4e-59   Cucumis melo [Oriental melon]
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               206   8e-59   Setaria italica
gb|ACN26310.1|  unknown                                                 205   2e-58   Zea mays [maize]
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           201   2e-58   
ref|NP_001132062.1|  proton myo-inositol cotransporter                  205   2e-58   Zea mays [maize]
ref|NP_001168177.1|  uncharacterized protein LOC100381931               205   3e-58   Zea mays [maize]
gb|ACG35144.1|  proton myo-inositol cotransporter                       205   3e-58   Zea mays [maize]
ref|XP_008812826.1|  PREDICTED: polyol transporter 5-like               198   5e-58   Phoenix dactylifera
emb|CDP18000.1|  unnamed protein product                                204   6e-58   Coffea canephora [robusta coffee]
ref|NP_001141158.1|  hypothetical protein                               203   6e-58   Zea mays [maize]
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           204   8e-58   
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         204   9e-58   Zea mays [maize]
emb|CDY72601.1|  BnaAnng41630D                                          201   1e-57   Brassica napus [oilseed rape]
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          203   1e-57   Sorghum bicolor [broomcorn]
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               202   2e-57   Nelumbo nucifera [Indian lotus]
emb|CDY70259.1|  BnaCnng67460D                                          195   3e-57   Brassica napus [oilseed rape]
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           202   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_011659070.1|  PREDICTED: polyol transporter 5-like               202   5e-57   Cucumis sativus [cucumbers]
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               201   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP17996.1|  unnamed protein product                                202   6e-57   Coffea canephora [robusta coffee]
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           201   1e-56   Brassica rapa
emb|CDY46218.1|  BnaA07g03520D                                          201   1e-56   Brassica napus [oilseed rape]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               201   1e-56   Phoenix dactylifera
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               200   4e-56   Eucalyptus grandis [rose gum]
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               199   4e-56   Phoenix dactylifera
gb|EMS61414.1|  Polyol transporter 5                                    196   4e-56   Triticum urartu
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           199   4e-56   
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    199   5e-56   Brassica rapa
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               199   6e-56   Phoenix dactylifera
ref|XP_007156029.1|  hypothetical protein PHAVU_003G252500g             198   8e-56   Phaseolus vulgaris [French bean]
dbj|BAK00091.1|  predicted protein                                      199   9e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  198   1e-55   Medicago truncatula
gb|ACJ85829.1|  unknown                                                 197   1e-55   Medicago truncatula
ref|XP_007046983.1|  Major facilitator superfamily protein              198   1e-55   
ref|XP_009138439.1|  PREDICTED: probable polyol transporter 6           197   1e-55   Brassica rapa
gb|AFK37582.1|  unknown                                                 197   1e-55   Medicago truncatula
emb|CDY46217.1|  BnaA07g03530D                                          197   1e-55   Brassica napus [oilseed rape]
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           197   1e-55   Cucumis melo [Oriental melon]
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           197   2e-55   Prunus mume [ume]
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    196   3e-55   Arabis alpina [alpine rockcress]
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             197   3e-55   Eutrema salsugineum [saltwater cress]
emb|CDY35469.1|  BnaC03g61910D                                          196   4e-55   Brassica napus [oilseed rape]
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           196   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           196   5e-55   Brassica rapa
ref|XP_006856085.2|  PREDICTED: polyol transporter 5                    196   5e-55   
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           196   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      196   5e-55   Cicer arietinum [garbanzo]
emb|CDY24775.1|  BnaA08g15350D                                          196   6e-55   Brassica napus [oilseed rape]
emb|CDX75588.1|  BnaA01g01140D                                          195   7e-55   
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               196   7e-55   
gb|ERN17552.1|  hypothetical protein AMTR_s00059p00123280               196   7e-55   Amborella trichopoda
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           196   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             196   9e-55   Capsella rubella
emb|CDX72594.1|  BnaC07g46160D                                          198   1e-54   
ref|XP_009142783.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    195   1e-54   Brassica rapa
dbj|BAJ98962.1|  predicted protein                                      189   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           195   1e-54   Camelina sativa [gold-of-pleasure]
emb|CDY67098.1|  BnaCnng53530D                                          194   1e-54   Brassica napus [oilseed rape]
ref|XP_010446763.1|  PREDICTED: probable polyol transporter 6           194   2e-54   
ref|XP_010432153.1|  PREDICTED: probable polyol transporter 6           194   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             194   2e-54   Capsella rubella
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             194   2e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               194   2e-54   Cucumis melo [Oriental melon]
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             194   2e-54   Citrus clementina [clementine]
gb|AFK38433.1|  unknown                                                 186   3e-54   Lotus japonicus
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             194   3e-54   Eutrema salsugineum [saltwater cress]
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               194   3e-54   
ref|XP_010530516.1|  PREDICTED: putative polyol transporter 1           190   3e-54   Tarenaya hassleriana [spider flower]
ref|NP_001049270.1|  Os03g0197200                                       188   3e-54   
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           194   4e-54   Camelina sativa [gold-of-pleasure]
gb|KHN41994.1|  Putative polyol transporter 6                           192   5e-54   Glycine soja [wild soybean]
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           193   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002884156.1|  predicted protein                                  193   7e-54   
gb|EMS52712.1|  Putative polyol transporter 2                           193   7e-54   
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           193   7e-54   
ref|XP_006856084.1|  PREDICTED: polyol transporter 5                    193   9e-54   
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   193   9e-54   
ref|XP_006590682.1|  PREDICTED: probable polyol transporter 6-like      192   9e-54   
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           195   1e-53   
gb|KHN00554.1|  Putative polyol transporter 3                           192   1e-53   
emb|CDP17999.1|  unnamed protein product                                192   1e-53   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    192   1e-53   
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   192   1e-53   
ref|NP_195385.1|  putative polyol transporter 6                         192   1e-53   
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           192   2e-53   
ref|XP_011658491.1|  PREDICTED: probable polyol transporter 6           192   2e-53   
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      190   7e-53   
gb|KHN44499.1|  Putative polyol transporter 3                           189   7e-53   
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           190   1e-52   
gb|EAY88906.1|  hypothetical protein OsI_10385                          190   1e-52   
ref|NP_001182999.1|  uncharacterized protein LOC100501319               187   1e-52   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    189   1e-52   
ref|XP_003548895.1|  PREDICTED: probable polyol transporter 3-like      189   2e-52   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           189   2e-52   
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           189   2e-52   
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             189   2e-52   
dbj|BAJ93015.1|  predicted protein                                      189   2e-52   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    189   3e-52   
gb|EMS66679.1|  Putative polyol transporter 2                           187   3e-52   
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             188   3e-52   
ref|NP_001060109.2|  Os07g0582500                                       188   3e-52   
dbj|BAC83311.1|  putative sorbitol transporter                          189   4e-52   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  188   4e-52   
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    188   4e-52   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              187   4e-52   
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    188   4e-52   
gb|EEE58504.1|  hypothetical protein OsJ_09775                          189   4e-52   
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       187   5e-52   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             188   5e-52   
emb|CDY66868.1|  BnaUnng01720D                                          187   6e-52   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           188   6e-52   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           187   6e-52   
gb|ABF94465.1|  Sugar transporter family protein, expressed             189   7e-52   
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          188   8e-52   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               187   9e-52   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    187   1e-51   
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    187   1e-51   
gb|EAZ04481.1|  hypothetical protein OsI_26630                          187   1e-51   
ref|XP_011650543.1|  PREDICTED: putative polyol transporter 2           187   2e-51   
ref|XP_007156923.1|  hypothetical protein PHAVU_002G028600g             186   2e-51   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           187   2e-51   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           187   2e-51   
ref|XP_004301902.2|  PREDICTED: probable polyol transporter 6           186   2e-51   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           186   2e-51   
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    187   3e-51   
ref|NP_179438.1|  putative polyol transporter 3                         186   4e-51   
ref|XP_002886176.1|  predicted protein                                  186   4e-51   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           186   4e-51   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           186   5e-51   
gb|KHN41995.1|  Putative polyol transporter 3                           184   6e-51   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           185   6e-51   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           184   1e-50   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      184   1e-50   
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               185   1e-50   
gb|EMT00465.1|  Putative polyol transporter 1                           184   1e-50   
emb|CBI17542.3|  unnamed protein product                                182   1e-50   
emb|CAJ29288.1|  putative polyol transporter 1                          184   2e-50   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             184   2e-50   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           184   2e-50   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             184   2e-50   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           184   2e-50   
ref|NP_001147446.1|  sorbitol transporter                               184   2e-50   
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               184   2e-50   
emb|CDP02044.1|  unnamed protein product                                184   3e-50   
gb|AEI98623.1|  hypothetical protein 111O18.10                          183   4e-50   
ref|XP_006827104.1|  PREDICTED: polyol transporter 5                    183   6e-50   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    182   6e-50   
ref|XP_012084471.1|  PREDICTED: probable polyol transporter 6           182   7e-50   
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           182   9e-50   
ref|XP_011659069.1|  PREDICTED: putative polyol transporter 1 iso...    181   2e-49   
ref|XP_004148313.1|  PREDICTED: putative polyol transporter 1 iso...    181   3e-49   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      179   6e-49   
ref|XP_002439891.1|  hypothetical protein SORBIDRAFT_09g022100          180   8e-49   
ref|XP_010317209.1|  PREDICTED: probable polyol transporter 6 iso...    179   9e-49   
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               179   1e-48   
ref|XP_010317207.1|  PREDICTED: probable polyol transporter 6 iso...    179   1e-48   
ref|NP_001289849.1|  probable polyol transporter 6                      179   1e-48   
gb|EEC66802.1|  hypothetical protein OsI_33208                          178   1e-48   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    179   2e-48   
dbj|BAK07233.1|  predicted protein                                      178   2e-48   
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          178   3e-48   
ref|NP_001064429.1|  Os10g0360100                                       178   3e-48   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      177   6e-48   
ref|XP_008447048.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    177   7e-48   
ref|XP_009411236.1|  PREDICTED: probable polyol transporter 6           176   7e-48   
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   178   8e-48   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             176   8e-48   
ref|XP_010527602.1|  PREDICTED: polyol transporter 5-like               167   8e-48   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               176   1e-47   
gb|ACF83985.1|  unknown                                                 176   1e-47   
ref|XP_002531429.1|  sugar transporter, putative                        176   1e-47   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     175   1e-47   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           176   2e-47   
ref|XP_002514303.1|  sugar transporter, putative                        176   2e-47   
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    175   2e-47   
ref|XP_008679503.1|  PREDICTED: carbohydrate transporter/ sugar p...    176   3e-47   
ref|NP_001151390.1|  carbohydrate transporter/ sugar porter             176   3e-47   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           175   3e-47   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               175   4e-47   
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      175   4e-47   
gb|ERM94340.1|  hypothetical protein AMTR_s00010p00243630               174   4e-47   
ref|XP_012076685.1|  PREDICTED: polyol transporter 5-like               174   4e-47   
ref|XP_006827103.2|  PREDICTED: polyol transporter 5                    174   5e-47   
ref|XP_004233968.1|  PREDICTED: probable polyol transporter 6           174   6e-47   
ref|XP_004233514.1|  PREDICTED: probable polyol transporter 6           174   6e-47   
gb|KCW58603.1|  hypothetical protein EUGRSUZ_H01262                     173   7e-47   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           174   1e-46   
gb|ACF85526.1|  unknown                                                 164   2e-46   
ref|XP_007156922.1|  hypothetical protein PHAVU_002G028500g             173   2e-46   
gb|EAY77363.1|  hypothetical protein OsI_05348                          172   2e-46   
dbj|BAJ86116.1|  predicted protein                                      173   3e-46   
ref|XP_009396729.1|  PREDICTED: probable polyol transporter 6           172   3e-46   
ref|XP_008447302.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    172   3e-46   
ref|XP_004983249.1|  PREDICTED: probable polyol transporter 3-like      172   3e-46   
ref|XP_004980363.1|  PREDICTED: polyol transporter 5-like               172   3e-46   
ref|XP_004983248.1|  PREDICTED: probable polyol transporter 3-like      172   5e-46   
ref|XP_002310213.2|  mannitol transporter family protein                172   5e-46   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    172   6e-46   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               171   7e-46   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    171   7e-46   
dbj|BAJ93158.1|  predicted protein                                      171   1e-45   
ref|XP_004148302.1|  PREDICTED: putative polyol transporter 2           171   2e-45   
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    174   2e-45   
ref|XP_002308474.2|  hypothetical protein POPTR_0006s16130g             169   3e-45   
gb|ACN35873.1|  unknown                                                 168   3e-45   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               169   4e-45   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               169   5e-45   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               169   5e-45   
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           169   6e-45   
gb|EPS67834.1|  hypothetical protein M569_06938                         168   9e-45   
ref|XP_010497333.1|  PREDICTED: putative polyol transporter 1           164   1e-44   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               167   2e-44   
gb|EYU40145.1|  hypothetical protein MIMGU_mgv1a004984mg                167   3e-44   
gb|KHN41999.1|  Putative polyol transporter 6                           166   3e-44   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           167   5e-44   
ref|XP_011078372.1|  PREDICTED: polyol transporter 5-like               166   6e-44   
ref|XP_002514302.1|  sugar transporter, putative                        167   6e-44   
ref|XP_003538845.1|  PREDICTED: probable polyol transporter 3-like      166   8e-44   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               166   9e-44   
ref|XP_007013176.1|  Polyol/monosaccharide transporter 5 isoform 3      163   1e-43   
ref|XP_010099586.1|  Polyol transporter 5                               166   1e-43   
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           165   2e-43   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             164   2e-43   
gb|KHN41996.1|  Putative polyol transporter 6                           164   2e-43   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             164   3e-43   
ref|XP_003538847.1|  PREDICTED: probable polyol transporter 3-like      164   3e-43   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    164   5e-43   
ref|XP_004512223.1|  PREDICTED: probable polyol transporter 3-like      163   6e-43   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      164   8e-43   
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    163   9e-43   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               162   1e-42   
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      162   1e-42   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               163   1e-42   
emb|CDP03333.1|  unnamed protein product                                162   1e-42   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           163   1e-42   
gb|EMT15229.1|  Putative polyol transporter 1                           159   2e-42   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     162   2e-42   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                162   2e-42   
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like               162   3e-42   
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                   162   4e-42   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               161   4e-42   
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg             162   4e-42   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               161   5e-42   
ref|XP_012076686.1|  PREDICTED: polyol transporter 5-like               161   7e-42   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               160   8e-42   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    160   1e-41   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               160   1e-41   
ref|XP_010244297.1|  PREDICTED: putative polyol transporter 1           160   2e-41   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      160   2e-41   
ref|XP_007013178.1|  Polyol/monosaccharide transporter 5 isoform 2      157   2e-41   
ref|XP_004243120.1|  PREDICTED: polyol transporter 5-like               159   3e-41   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           159   3e-41   
emb|CAJ29290.2|  putative polyol transporter protein 3                  159   3e-41   
ref|XP_010047731.1|  PREDICTED: probable polyol transporter 6           159   3e-41   
ref|XP_010051593.1|  PREDICTED: polyol transporter 5-like               157   4e-41   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           158   4e-41   
gb|ERM98564.1|  hypothetical protein AMTR_s00109p00027810               157   5e-41   
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               159   5e-41   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           158   6e-41   
gb|ADP37150.1|  putative polyol/monosaccharide transporter              158   6e-41   
ref|XP_008805626.1|  PREDICTED: probable polyol transporter 4           157   7e-41   
ref|XP_002448219.1|  hypothetical protein SORBIDRAFT_06g023360          158   9e-41   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            158   1e-40   
ref|XP_004976318.1|  PREDICTED: probable polyol transporter 4-lik...    157   1e-40   
ref|XP_004976317.1|  PREDICTED: probable polyol transporter 4-lik...    157   1e-40   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      157   1e-40   
ref|XP_006833286.2|  PREDICTED: polyol transporter 5                    157   2e-40   
ref|XP_004148315.2|  PREDICTED: polyol transporter 5-like               156   2e-40   
ref|XP_007046981.1|  Polyol/monosaccharide transporter 5-like pro...    155   2e-40   
ref|XP_003620669.1|  Myo-inositol transporter                           156   2e-40   
gb|KJB54071.1|  hypothetical protein B456_009G019700                    155   4e-40   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6           155   4e-40   
ref|XP_010041832.1|  PREDICTED: polyol transporter 5-like               155   5e-40   
gb|KHN41998.1|  Putative polyol transporter 6                           155   5e-40   
ref|XP_010067985.1|  PREDICTED: polyol transporter 5-like               147   6e-40   
ref|XP_008667987.1|  PREDICTED: arabinose-proton symporter isofor...    155   6e-40   
ref|XP_004979804.1|  PREDICTED: polyol transporter 5-like               155   6e-40   
ref|NP_001149076.1|  arabinose-proton symporter                         155   7e-40   
ref|XP_010940404.1|  PREDICTED: probable polyol transporter 4           155   8e-40   
gb|KJB77296.1|  hypothetical protein B456_012G130400                    155   8e-40   
ref|XP_009398416.1|  PREDICTED: probable polyol transporter 4           155   8e-40   
ref|XP_010536004.1|  PREDICTED: polyol transporter 5-like               154   9e-40   
ref|XP_010935630.1|  PREDICTED: probable polyol transporter 4           155   1e-39   
gb|EMS55537.1|  Putative polyol transporter 1                           153   1e-39   
ref|XP_010049693.1|  PREDICTED: probable polyol transporter 6           155   1e-39   
gb|ERM95231.1|  hypothetical protein AMTR_s00009p00268230               154   1e-39   
ref|XP_006827815.2|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    154   1e-39   
ref|XP_002517946.1|  sugar transporter, putative                        154   1e-39   
gb|AJU57226.1|  polyol transporter 4                                    154   2e-39   
ref|XP_012088309.1|  PREDICTED: probable polyol transporter 4 iso...    154   2e-39   
ref|XP_004503439.1|  PREDICTED: polyol transporter 5-like               154   2e-39   
ref|XP_002319907.2|  mannitol transporter family protein                154   2e-39   
ref|XP_002519026.1|  sugar transporter, putative                        154   2e-39   



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 170/197 (86%), Gaps = 1/197 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL T+AVGF KTLFIL+ATF LD+ GRR LLLSSV GMI S++ L I LTII+H+D K
Sbjct  318  DKLLATMAVGFTKTLFILVATFLLDKIGRRPLLLSSVAGMILSLVGLGIGLTIIEHADQK  377

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WAV L IA VL+YVAFFSIGMGPITWVYSSEIFPLRLRA GCSMGVAANRVTSG++SM
Sbjct  378  LIWAVALCIATVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAANRVTSGMISM  437

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TF+SLYKAI+IGGAFF+Y GIA +A++FF+TL PET+GKTLEEMET FGTFFKWRST+R 
Sbjct  438  TFISLYKAISIGGAFFLYAGIAAIAWVFFYTLYPETQGKTLEEMETFFGTFFKWRSTMRA  497

Query  264  IEAKKQKMTTNQLQMSS  214
            +E KK + +  QLQ+++
Sbjct  498  LEEKKGE-SNGQLQLTT  513



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 7/203 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H KLL TVAVGFVKT+FIL+ATF LD+ GRR LLL+SV GM+ S++LLA  LTIID S+ 
Sbjct  329  HDKLLATVAVGFVKTIFILVATFMLDKSGRRPLLLTSVAGMVLSLMLLATGLTIIDQSEQ  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ LSI MVLAYVA FSIGMGPITWVYSSEIFPLRLRATGCS+GVA NRVTSGVVS
Sbjct  389  KVVWAIALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGGAFF+Y G+A VAF+FFFTLMPET+GKTLEEME LFGTF+ WR T R
Sbjct  449  MTFLSLEKAITIGGAFFLYAGLAAVAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTAR  508

Query  267  EI-EAK------KQKMTTNQLQM  220
            E+ EAK      K      Q+QM
Sbjct  509  ELKEAKITEKTEKNSNDNGQIQM  531



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 4/202 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H KLL TVAVGFVKT+FIL+ATF LD+ GRR LLL+SV GM+ S+LLLA  LTIID S+ 
Sbjct  327  HDKLLATVAVGFVKTIFILVATFMLDKSGRRPLLLTSVAGMVLSLLLLATGLTIIDQSEQ  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ LSI MVLAYVA FSIGMGPITWVYSSEIFPLRLRATGCS+GVA NRVTSGVVS
Sbjct  387  KVVWAIALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL K+ITIGGAFF+Y G+A VAF+FFFTLMPET+GKTLEEME LFG+F+ WR T R
Sbjct  447  MTFLSLVKSITIGGAFFLYFGLAAVAFVFFFTLMPETQGKTLEEMEALFGSFWDWRKTAR  506

Query  267  EI-EAKKQKMTTN---QLQMSS  214
            E+ EAK  +  +N   Q+QM +
Sbjct  507  ELKEAKITEKNSNDNGQIQMGT  528



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 168/200 (84%), Gaps = 3/200 (2%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL T+AVGF KTLFIL+ATF LD+ GRR LLLSSV GMI S+ LL + LTI+DHS+HK
Sbjct  329  DKLLATMAVGFTKTLFILVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEHK  388

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WAV   + MVLAYV+FFSIG+GPITWVYSSEIFPLRLRA GCS+GVAANRVTSGV+SM
Sbjct  389  MVWAVAWCLIMVLAYVSFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISM  448

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL KAIT GGAFF++ GIA VAF FF+TL+PETRG+TLEEME LFGTFF+WR+ +RE
Sbjct  449  TFLSLSKAITTGGAFFLFAGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMRE  508

Query  264  IEAKKQKMTTNQLQMSSTYT  205
            +E +K   T  QLQM +T T
Sbjct  509  LEKQK---TGQQLQMGTTAT  525



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 168/200 (84%), Gaps = 3/200 (2%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL T+AVGF KTLFIL+ATF LD+ GRR LLLSSV GMI S+ LL + LTI+DHS+HK
Sbjct  329  DKLLATMAVGFTKTLFILVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEHK  388

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WAV   + MVLAYV+FFSIG+GPITWVYSSEIFPLRLRA GCS+GVAANRVTSGV+SM
Sbjct  389  MVWAVAWCLIMVLAYVSFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISM  448

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL KAIT GGAFF++ GIA VAF FF+TL+PETRG+TLEEME LFGTFF+WR+ +RE
Sbjct  449  TFLSLSKAITTGGAFFLFAGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMRE  508

Query  264  IEAKKQKMTTNQLQMSSTYT  205
            +E +K   T  QLQM +T T
Sbjct  509  LEKQK---TGQQLQMGTTAT  525



>gb|EYU42629.1| hypothetical protein MIMGU_mgv1a0059092mg, partial [Erythranthe 
guttata]
Length=275

 Score =   264 bits (675),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL T+AVGF KTLFIL+ATF LD+ GRR LLLSSV GMI S+L LAI LT+I+H++HK
Sbjct  75   DKLLATMAVGFTKTLFILVATFLLDKIGRRPLLLSSVAGMIVSLLGLAIGLTVIEHAEHK  134

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ L I   L+YV+FFSIGMGPITWVYSSEIFPLRLRA GC+MGVA NRVTSGV+SM
Sbjct  135  LIWAIALCIGSTLSYVSFFSIGMGPITWVYSSEIFPLRLRAQGCAMGVALNRVTSGVISM  194

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL +AITIGGAFF+Y G+A +A +FF+TL PET+GKTLEEME+LFGTF KWRSTLR 
Sbjct  195  TFLSLNRAITIGGAFFLYAGVAAIALVFFYTLYPETQGKTLEEMESLFGTFSKWRSTLRT  254

Query  264  IEAKKQKMTTNQLQMS  217
            +  KK +    Q+Q+ 
Sbjct  255  LNEKKSE-KNGQIQLE  269



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 170/197 (86%), Gaps = 1/197 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
            ++LL T+AVGF KT+FIL+ATF LD+ GRR LLLSSVGGM+AS++ L + LTI+++SDHK
Sbjct  326  EQLLATMAVGFTKTVFILVATFLLDKIGRRPLLLSSVGGMVASLVGLGLGLTIVENSDHK  385

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ L I+ VL++VAFFSIGMGPITWVYSSEIFPLRLRA GCSMGVA NRVTSGV+SM
Sbjct  386  MVWAIALCISTVLSFVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAMNRVTSGVISM  445

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TF+SLY AI+IGG FF+Y GIA VA++FF+T +PET+GKTLEEMETLFGTF+KWRSTLR 
Sbjct  446  TFISLYNAISIGGVFFLYAGIAAVAWVFFYTFLPETQGKTLEEMETLFGTFYKWRSTLRA  505

Query  264  IEAKKQKMTTNQLQMSS  214
            +  KK++    Q+QM +
Sbjct  506  LNEKKRE-GDRQVQMRN  521



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             +LL TVAVG +KT+F+L+ATF LDR GRR LLL+SVGGM+ S++ L+I LT+IDHSD  
Sbjct  325  DRLLATVAVGIIKTIFVLVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDGT  384

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            V WA+ L I MVLAYVA FSIG GPITWVYSSEIFPLRLRATGCS+ VA NRVTSGVVSM
Sbjct  385  VFWAIALCITMVLAYVALFSIGAGPITWVYSSEIFPLRLRATGCSLAVALNRVTSGVVSM  444

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL KAITIGGAFF Y G+A +A++FFFTLMPET+GKTLEE E LFGTFFKWR TLRE
Sbjct  445  TFLSLEKAITIGGAFFFYAGLAGLAWVFFFTLMPETQGKTLEETEELFGTFFKWRLTLRE  504

Query  264  IEAKKQKMTTNQLQMSS  214
            ++A K+K    Q+QM++
Sbjct  505  LKA-KEKNNNAQIQMAT  520



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             +LL TVAVG +KT+FIL+ATF LDR GRR LLL+SVGGM+ S++ L+I LT+IDHSD  
Sbjct  325  DRLLATVAVGIIKTIFILVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDGT  384

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            V WA+ L I MVL YVA FSIG GPITWVYSSEIFPLRLRATGC + VA NRVTSGVVSM
Sbjct  385  VFWAIALCITMVLVYVALFSIGAGPITWVYSSEIFPLRLRATGCGLAVALNRVTSGVVSM  444

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL KAITIGGAFF+Y G+A +A++FFFTLMPET+GKTLEE E LFG FFKWRSTLRE
Sbjct  445  TFLSLEKAITIGGAFFLYAGLAGLAWVFFFTLMPETQGKTLEETEELFGNFFKWRSTLRE  504

Query  264  IEAKKQKMTTNQLQMSS  214
            ++AK++     Q+QM++
Sbjct  505  LQAKEEN-NNAQIQMAT  520



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 164/200 (82%), Gaps = 2/200 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KT+FIL+ATF LDR GRR LLLSSVGGM+ S+  L   LT+IDHSD 
Sbjct  330  NDKLLATVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTMIDHSDE  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+PWAV LSIAMVLAYV+FFSIGMGPITWVYSSEIFPL+LRA G SMGVA NRVTSGV+S
Sbjct  390  KLPWAVALSIAMVLAYVSFFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+ LYKAITIGG+FF++ G+A V ++FF+  +PETRG+TLE+ME LFG+FFKWRS L+
Sbjct  450  TTFILLYKAITIGGSFFLFAGVAAVGWLFFYACLPETRGRTLEDMEVLFGSFFKWRSALK  509

Query  267  EIEAKKQKMTTN--QLQMSS  214
            + + K+     N  Q+QM +
Sbjct  510  DEQRKEVSSGENGGQIQMGT  529



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL T+AVGFVKT+FIL+ATF LD+ GRR LLLSSV GMI S++ L I LTIIDHSDHK+
Sbjct  328  KLLATIAVGFVKTVFILVATFFLDKVGRRPLLLSSVAGMILSLMGLGIGLTIIDHSDHKI  387

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ L IA +L+YVAFFSIGMGPITWVYSSEIFPLRLRA GCSMGVA NR+ SGV+ MT
Sbjct  388  EWAIALCIATILSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAVNRIVSGVIGMT  447

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            F+SLYKAITIGGAFF++TG+A+V F+FF+TL PET+GK LEE+E +FGTFF+WR+   E+
Sbjct  448  FISLYKAITIGGAFFLFTGVAIVGFVFFYTLYPETQGKNLEEVEEVFGTFFRWRTRQAEL  507

Query  261  E-AKKQKMTTNQLQ  223
            + AK+ +M + + Q
Sbjct  508  DRAKEAEMVSKKAQ  521



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 163/200 (82%), Gaps = 3/200 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KT+FIL+ATF LDR GRR LLLSSVGGM+ S+  L   LT+IDHSD 
Sbjct  330  NDKLLATVAVGFTKTVFILVATFFLDRIGRRPLLLSSVGGMVLSLSTLGFGLTMIDHSDE  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+PWAV LSIAMVLAYV+FFSIGMGPITWVYSSEIFPL+LRA G SMGVA NRVTSGV+S
Sbjct  390  KLPWAVALSIAMVLAYVSFFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+ LYKAITIGG+FF++ G+A V ++FF+  +PETRG+TLE+ME LFG FF WRS L+
Sbjct  450  TTFILLYKAITIGGSFFLFAGVAAVGWLFFYACLPETRGRTLEDMEVLFGHFFNWRSALK  509

Query  267  EIEAKKQKMTTN--QLQMSS  214
            + E +K+    N  Q+QM +
Sbjct  510  D-EQRKEVSGENGGQIQMGT  528



>ref|XP_009785575.1| PREDICTED: polyol transporter 5-like isoform X2 [Nicotiana sylvestris]
Length=336

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 166/202 (82%), Gaps = 5/202 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + +LL T+AVG +KT FIL+ATF +D+ GRR LLLSS GGMI S+L LA  LTIIDHSDH
Sbjct  135  NDRLLATIAVGCMKTFFILVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDH  194

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I   L+ VAFFSIGMGPI WVYSSEIFPLRLRA GCS+GVA NR  SG + 
Sbjct  195  KLKWAIVLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAIL  254

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAI+IGGAFF+YTGIA++A+IFF+ L+PET+G+TLEEME LFGTFFKWRST++
Sbjct  255  MTFISLYKAISIGGAFFLYTGIAIIAWIFFYALLPETQGRTLEEMEELFGTFFKWRSTMK  314

Query  267  EIEAKKQKMTTN---QLQMSST  211
            E+  KK K+ ++   Q+QM ++
Sbjct  315  EL--KKNKVESDGSAQVQMGNS  334



>ref|XP_009785574.1| PREDICTED: polyol transporter 5-like isoform X1 [Nicotiana sylvestris]
Length=355

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 171/217 (79%), Gaps = 3/217 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + +LL T+AVG +KT FIL+ATF +D+ GRR LLLSS GGMI S+L LA  LTIIDHSDH
Sbjct  135  NDRLLATIAVGCMKTFFILVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDH  194

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I   L+ VAFFSIGMGPI WVYSSEIFPLRLRA GCS+GVA NR  SG + 
Sbjct  195  KLKWAIVLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAIL  254

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAI+IGGAFF+YTGIA++A+IFF+TL+PET+G+TLEEME LFGTFFKWRST++
Sbjct  255  MTFISLYKAISIGGAFFLYTGIAIIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMK  314

Query  267  EIEAKKQKMTTNQLQMSSTYTK*LPRFTFSLVKSMLS  157
            E+  KK K+ ++     S     +  + F+ + S+LS
Sbjct  315  EL--KKNKVESDGSACGSILKNLIAMYLFNFI-SVLS  348



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 166/212 (78%), Gaps = 15/212 (7%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             +KLL TVAVGFVKT+FIL+ATF LDR GRR LLLSSVGGM+AS+  L ++LTIIDHSD 
Sbjct  330  DEKLLATVAVGFVKTIFILVATFFLDRIGRRPLLLSSVGGMVASLATLGLSLTIIDHSDE  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MVLAYVAFFSIGMGPITWVYSSEIFPLRLRA G SMGVAANRVTSGV+S
Sbjct  390  KLMWAIALCITMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAANRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLYKAI+IGGAFF++ G+A VA+ FF+T +PET+GKTLEEME LFG    WR    
Sbjct  450  MSFISLYKAISIGGAFFLFAGVATVAWFFFYTCLPETQGKTLEEMEGLFGKLMGWRK---  506

Query  267  EIEAKKQKM----------TTNQLQMSSTYTK  202
              EAKK KM          +  Q+Q+ +T T 
Sbjct  507  --EAKKLKMRMKEVNGDGTSNGQIQLGNTTTN  536



>gb|AAZ80876.1| putative sorbitol transporter, partial [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=312

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 166/205 (81%), Gaps = 7/205 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVAVGFVKT+FIL+ATF LD+ GRRKLLL+SV GM+ S++LLA  LTIID S+ 
Sbjct  102  RNKLLATVAVGFVKTIFILVATFMLDKSGRRKLLLTSVAGMVLSLMLLATGLTIIDQSEQ  161

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ LSI MVLAYVA FSIGMGPITWVYSSEIFPLRLRATGCS+GVA NRVTSGVVS
Sbjct  162  KVIWAIALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVS  221

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFL+L K ITIGGAFF+Y G+A  AF+FFFTLMPET+GKTLEEME LFGTF+ WR T R
Sbjct  222  MTFLTLVKRITIGGAFFLYFGLAAAAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTAR  281

Query  267  EI-EAK------KQKMTTNQLQMSS  214
            E+ EAK      K      Q+QM +
Sbjct  282  ELKEAKITEKTEKNSNDNGQIQMGT  306



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 164/197 (83%), Gaps = 2/197 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL TVAVGF KT+FIL+ATF LDR GRR ++LSS+GGMI S++ LA  LT+ID +DHK
Sbjct  306  DKLLATVAVGFTKTVFILVATFLLDRVGRRPMVLSSMGGMIVSIMCLATGLTVIDQADHK  365

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ L  A ++ YVAFFSIGMGPI WVYSSE FPLRLRA GCSMGVA NR  S ++SM
Sbjct  366  IMWAIALCTASIMFYVAFFSIGMGPIAWVYSSETFPLRLRAQGCSMGVALNRCISALISM  425

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TF++LYK ITIGGAF++Y  I++VA++FFFTL+PET+GKTLEEME+LFGTFF+WR+TLRE
Sbjct  426  TFITLYKGITIGGAFYLYGAISIVAWLFFFTLLPETQGKTLEEMESLFGTFFRWRTTLRE  485

Query  264  IEAKKQKMTTNQLQMSS  214
            +  +K++   N ++MSS
Sbjct  486  LNERKRE--KNMIEMSS  500



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 165/199 (83%), Gaps = 5/199 (3%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL T+AVG +KT FILIATF +D+ GRR LLLSS GGMI S+L LA  LTIIDHSDHK+ 
Sbjct  333  LLATIAVGCMKTFFILIATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDHKLK  392

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA+ L I   L+ VAFFSIGMGPI WVYSSEIFPLRLRA GCS+GVA NR  SG + MTF
Sbjct  393  WAIVLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTF  452

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            +SLYKAI+IGGAFF+YTGIAV+A+IFF+TL+PET+G+TLEEME LFGTFFKWRST++E+ 
Sbjct  453  ISLYKAISIGGAFFLYTGIAVIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKEL-  511

Query  258  AKKQKMTTN---QLQMSST  211
             KK K+ ++   Q+QM ++
Sbjct  512  -KKNKVESDGSAQVQMENS  529



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KL+ T+AVGF KT+FIL+ATF LD+ GRR LLLSSV GMI S++ L + LT+I  SDHK+
Sbjct  326  KLIVTMAVGFTKTVFILVATFFLDKIGRRPLLLSSVAGMILSLMGLGLGLTVIARSDHKL  385

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV L I  VL+YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRVTSGV+SMT
Sbjct  386  VWAVALCITSVLSYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSVGVAVNRVTSGVISMT  445

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSLYKAI+IGG FF+Y G+A+VA++FF++L+PET+G+TLEEME+LFGTFFKWRST R +
Sbjct  446  FLSLYKAISIGGTFFLYGGVAMVAWVFFYSLLPETQGRTLEEMESLFGTFFKWRSTRRAL  505

Query  261  EAKKQKMTTNQLQMSST  211
            E  K K     +QM  +
Sbjct  506  EENK-KFGGKHVQMEGS  521



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 2/200 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KT+FIL+ATF LDR GRR LLLSSVGGMI S+  L   LTIIDHS  
Sbjct  330  NDKLLATVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMILSLATLGFGLTIIDHSHE  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+PWAV LSIAMVLA+VAFFSIGMGPI WVYSSEIFPLRLRA G  MGVA NRVTSGV+S
Sbjct  390  KLPWAVALSIAMVLAFVAFFSIGMGPIAWVYSSEIFPLRLRAQGTGMGVAVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+ LYKAI+IGG+FF++ GIA VA++FFF   PETRG+TLE+ME LFG F  WRS L+
Sbjct  450  TTFIMLYKAISIGGSFFLFAGIATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSALK  509

Query  267  EIEAKKQKMTTN--QLQMSS  214
            + + + +    N  Q+QM +
Sbjct  510  DEQKEGEAHGGNDGQIQMGT  529



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL TVAVGF KT+FIL+ATF LDR GRR LLLSSVGGMI S+  LA++LTIIDHS+ K
Sbjct  328  DKLLATVAVGFTKTIFILVATFLLDRVGRRPLLLSSVGGMILSLAGLAVSLTIIDHSEKK  387

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            V WAV L+I  VL++V  FSIGMGPI WVYSSEIFPLRLRA G S+G A NR+ SG +SM
Sbjct  388  VAWAVALAITTVLSFVGTFSIGMGPIAWVYSSEIFPLRLRAQGTSIGTAMNRLISGTISM  447

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TF+SLY AI+IGGAFF++ G+A+V+++FF+TL+PET+G+TLEEM+ LFGTFFKWRSTLRE
Sbjct  448  TFISLYNAISIGGAFFLFMGVAIVSWVFFYTLLPETQGRTLEEMQVLFGTFFKWRSTLRE  507

Query  264  IEAKKQ----KMTTNQLQMSST  211
            +E  K+      +  Q+Q+ +T
Sbjct  508  MEKNKKIRDNDNSNGQIQLGTT  529



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+FIL+ATF LDR GRR LLLSSV GMI S+  L  +LT+IDHS  
Sbjct  328  NDKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLSSVAGMIFSLATLGFSLTVIDHSHE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L IAM+LAYVAFFSIGMGPITWVYSSEIFPLRLRA G SMGVA NRVTSGV+S
Sbjct  388  KLTWAVALCIAMILAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVIS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+SLYK ITIGGAFF++  IA VA+ FFFT +PET+G+TLE+ME LFG F KWRS  +
Sbjct  448  TTFISLYKGITIGGAFFLFAAIASVAWTFFFTCLPETQGRTLEDMEVLFGHFIKWRSAAK  507

Query  267  EIEAKKQKM---TTNQLQMSS  214
            + +  K +    T  Q+QM +
Sbjct  508  DEKLNKAEFHGETNGQIQMGT  528



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 170/203 (84%), Gaps = 4/203 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H +LLCTVAVG VKTLFIL+ATF LDR GRR LLL+SVGGM+AS++LLA  LTIIDHS+ 
Sbjct  346  HDRLLCTVAVGVVKTLFILVATFMLDRSGRRPLLLTSVGGMVASLVLLATGLTIIDHSEQ  405

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I+MVLAYVA FSIGMGPITWVYSSEIFPL LRATGCS+GVA NRVTSGVVS
Sbjct  406  KLVWAIALCISMVLAYVALFSIGMGPITWVYSSEIFPLTLRATGCSIGVAVNRVTSGVVS  465

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIG AFF+Y  +A VA++FF+TLMPET+GKTLEEMETLFGTF+ WR   R
Sbjct  466  MTFLSLQKAITIGAAFFLYAALAAVAWVFFYTLMPETQGKTLEEMETLFGTFWNWRERGR  525

Query  267  EI-EAKKQKMTTN---QLQMSST  211
            E+ E KK +  +N   Q+QM + 
Sbjct  526  ELKELKKTEKNSNDNGQIQMGTN  548



>ref|XP_012069670.1| PREDICTED: polyol transporter 5-like [Jatropha curcas]
 gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 158/201 (79%), Gaps = 3/201 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVAVGFVKT+FIL+ATF LDR GRR LLL+SV GMI S+  L  +LTIIDHS  
Sbjct  305  DNKLLATVAVGFVKTMFILVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHD  364

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MVLAYVAFFSIGMGPITWVYSSEIFPLRLRA G SMGVA NRVTSGV+S
Sbjct  365  KLTWAIVLCITMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVIS  424

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYK ITIGGAFF++  IA VA+ FFFT +PET+G+TLE+ME LFG F  WRS L+
Sbjct  425  MTFISLYKGITIGGAFFLFAAIATVAWTFFFTCLPETQGRTLEDMEVLFGRFINWRSALK  484

Query  267  EIEAKKQKMTTN---QLQMSS  214
            E   KK+   +    Q+Q+ +
Sbjct  485  EENLKKKAANSENNGQIQLGT  505



>ref|XP_008368693.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=353

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 6/193 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT++D S  
Sbjct  153  NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHS  212

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NR TSGV+S
Sbjct  213  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRXTSGVIS  272

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  273  MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWR----  328

Query  267  EIEAKKQKMTTNQ  229
              EA      TNQ
Sbjct  329  --EANAMLNKTNQ  339



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 158/200 (79%), Gaps = 2/200 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KT+FIL+ATF LDR GRR LLLSSVGGM+ S+  L   LTIIDHS  
Sbjct  330  NDKLLATVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSPE  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+PWAV LSIAMVLA+VAFFSIGMGPI WVYSSEIFPLRLRA G  MGVA NRVTSGV+S
Sbjct  390  KLPWAVALSIAMVLAFVAFFSIGMGPIPWVYSSEIFPLRLRAQGTGMGVAMNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+ LYKAI+IGGAFF++ G A VA++FFF   PETRG+TLE+ME LFG F  WRS L+
Sbjct  450  TTFIMLYKAISIGGAFFLFAGFATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSVLK  509

Query  267  EIEAKKQKMTTN--QLQMSS  214
            + + +++    N  Q+QM +
Sbjct  510  DGKKEEEVHGGNDGQIQMGT  529



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLL T+AVGFVKTLFIL+ATF LDR GRR LLLSSVGGMI S+  L IALT+IDHS  
Sbjct  327  DKKLLATMAVGFVKTLFILVATFLLDRIGRRPLLLSSVGGMIFSLASLGIALTVIDHSSE  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L IAMVLAYVAFFSIG+GPITWVYSSEIFPL+LRA G SM VA NRVTSGV+S
Sbjct  387  KLMWAIVLCIAMVLAYVAFFSIGLGPITWVYSSEIFPLKLRAQGASMAVAVNRVTSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRS  277
            M+F+SLYK ITIGGAFF++  +AVVA++FF+TL+PET+G+TLE+ME LFG FFKWRS
Sbjct  447  MSFISLYKGITIGGAFFLFAALAVVAWVFFYTLLPETQGRTLEDMEVLFGKFFKWRS  503



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 162/206 (79%), Gaps = 6/206 (3%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVGFVKT+ ILIATF LDR GRR LLLSS+ GM+AS+  L  +LTIIDHS  K+
Sbjct  334  KLLATVAVGFVKTITILIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHEKI  393

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
            PWA+ L I MVLAYVA FSIGMGPITWVYSSEIFPLRLRA G SMGVA NRVTSGV+SMT
Sbjct  394  PWAIGLCITMVLAYVALFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMT  453

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            F+SLY+AI+IGGAFF++ G+A+VA +FF+   PET+GKTLEEME LFG FF WR   +++
Sbjct  454  FISLYEAISIGGAFFLFAGVAMVATLFFYMFYPETQGKTLEEMEGLFGKFFGWREEAKKL  513

Query  261  EAKK------QKMTTNQLQMSSTYTK  202
            + KK         +  Q+Q+ +T TK
Sbjct  514  KMKKTMEVSGDGTSNGQIQLGNTTTK  539



>ref|XP_012069657.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
Length=542

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 159/201 (79%), Gaps = 3/201 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVAVGFVKT+FIL+ATF LDR GRR LLL+SV GMI S+  L  +LTIIDHS  
Sbjct  333  DNKLLATVAVGFVKTMFILVATFLLDRIGRRPLLLTSVAGMIFSLATLGFSLTIIDHSHD  392

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L + MVLAYVAFFSIGMGPITWVYSSEIFPLRLRA G SMGVA NR+TSGV+S
Sbjct  393  KLTWAIVLCLTMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGTSMGVAVNRLTSGVIS  452

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+SLYK IT+GGAFF++  IA VA+ FFFT +PETRG+TLE+ME LFG+F  WRS L+
Sbjct  453  TTFISLYKGITMGGAFFLFAAIATVAWTFFFTCLPETRGRTLEDMEVLFGSFINWRSALK  512

Query  267  EIEAKKQKMTTN---QLQMSS  214
            E   KK+  ++    Q+Q+ +
Sbjct  513  EDSLKKKAASSENNGQIQLGT  533



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 160/206 (78%), Gaps = 6/206 (3%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            +LL TVAVGFVKT+ ILIATF LDR GRR LLLSS+ GM+AS+  L  +LTIIDHS  K+
Sbjct  334  ELLATVAVGFVKTITILIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHEKI  393

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
            PWA+ L I MVLAYVA FSIGMGPITWVYSSEIFPLRLRA G SMGVA NRVTSGV+SMT
Sbjct  394  PWAIGLCITMVLAYVALFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMT  453

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            F+SLYKAI+IGGAFF++ GIA VA +FF+   PET+GKTLEEME LFG F  WR   +++
Sbjct  454  FISLYKAISIGGAFFLFAGIATVATLFFYMFYPETQGKTLEEMEGLFGKFIGWREEAKKL  513

Query  261  EAKK------QKMTTNQLQMSSTYTK  202
            + KK         +  Q+Q+ +T TK
Sbjct  514  KMKKTMEVNGDGTSNGQIQLGNTTTK  539



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT+ID S  
Sbjct  327  NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVIDQSHS  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+S
Sbjct  387  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  447  MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  506

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  507  LLNKTKQ  513



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score =   253 bits (645),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT++D S  
Sbjct  285  NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHS  344

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NR+TSGV+S
Sbjct  345  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  404

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  405  MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  464

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  465  MLNKTKQ  471



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S +LL + LT+ID S +
Sbjct  330  NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVISFILLGVGLTVIDQSHN  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+S
Sbjct  390  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KW+    
Sbjct  450  MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWKEANA  509

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  510  MLNKTKQ  516



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM  S  LL + LT++D S  
Sbjct  327  NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHS  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NR+TSGV+S
Sbjct  387  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKA+TIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  447  MTFISLYKAVTIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  506

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  507  MLNKTKQ  513



>gb|EYU20732.1| hypothetical protein MIMGU_mgv1a026176mg [Erythranthe guttata]
Length=509

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSD-  631
              KLL T+AVG  KT+FIL+ATF +DR GRR LLL+S GG+ AS+  LA  LT+ID +D 
Sbjct  316  SDKLLATIAVGISKTMFILVATFLVDRVGRRTLLLTSCGGLAASLFGLATGLTVIDQNDD  375

Query  630  -HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGV  454
              K+ WAV L +AM L+ VAFFSIGMGPI WVYSSEI+PLRLRA GCSMGVAANR  SGV
Sbjct  376  EQKLTWAVALCVAMSLSSVAFFSIGMGPIAWVYSSEIYPLRLRAQGCSMGVAANRFMSGV  435

Query  453  VSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            V MTF+SLY+ ITIGGAFF++TGIAVVA+IFF+TL+PET+G+TLEEME LFGTFF WRST
Sbjct  436  VLMTFISLYETITIGGAFFLFTGIAVVAWIFFYTLLPETKGRTLEEMEDLFGTFFNWRST  495

Query  273  LREIEAKKQKMTT  235
             +E+  KK+   T
Sbjct  496  SKELNIKKEANNT  508



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM  S  LL + LT++D S  
Sbjct  329  NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHS  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NR+TSGV+S
Sbjct  389  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKA+TIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  449  MTFISLYKAVTIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  508

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  509  MLNKTKQ  515



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT  IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT++D S  
Sbjct  328  NDKLLATVAVGFVKTTAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSPS  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWA+ L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+S
Sbjct  388  KVPWAIGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  448  MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  507

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  508  MLNKTKQ  514



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SDH  628
             KLL T+AVG  KT+FIL+ATF +D+ GRR LLL+S GG+ AS+  LA  LT+IDH  D 
Sbjct  332  DKLLATIAVGVSKTMFILVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDDQ  391

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L +A  LA VAFFSIGMGPI WVYSSEIFPLRLRA GCSMGVAANR TSGVV 
Sbjct  392  KLTWAVVLCVATSLACVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVL  451

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF++TG+AV+A+IFF+TL+PET+G+ LEE+E LFG+FF+WRST+R
Sbjct  452  MTFISLYKAITIGGAFFLFTGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMR  511

Query  267  EIEAKKQKMTT  235
            E++ KK +  +
Sbjct  512  ELKRKKLEQDS  522



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT++D S  
Sbjct  327  NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHS  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NR+TSGV+S
Sbjct  387  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKA+TIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  447  MTFISLYKAVTIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  506

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  507  MLNKTKQ  513



>ref|XP_008246181.1| PREDICTED: polyol transporter 5-like, partial [Prunus mume]
Length=359

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGF+KT+FI IATF LDR GRR LLL+S+GGMI S+  L  ALTI+DH D  +P
Sbjct  163  LLATVAVGFIKTIFIFIATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDSTIP  222

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WAV L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRV SG++SMTF
Sbjct  223  WAVALCITMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTF  282

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSLYKAITIGGAFF+Y GI V+A++FF+T++PET+G+TLEEME LFG + KWR     ++
Sbjct  283  LSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLK  342

Query  258  AKK  250
            +KK
Sbjct  343  SKK  345



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SDH  628
             KLL T+AVG  KT+FIL+ATF +D+ GRR LLL+S GG+ AS+  LA  LT+IDH  D 
Sbjct  334  DKLLATIAVGVSKTMFILVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDDQ  393

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L +A  LA VAFFSIGMGPI WVYSSEIFPLRLRA GCSMGVAANR TSGVV 
Sbjct  394  KLTWAVVLCVATSLACVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVL  453

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF++TG+AV+A+IFF+TL+PET+G+ LEE+E LFG+FF+WRST+R
Sbjct  454  MTFISLYKAITIGGAFFLFTGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMR  513

Query  267  EIEAKKQKMTT  235
            E++ KK +  +
Sbjct  514  ELKRKKLEQDS  524



>ref|XP_008387375.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=520

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL   LT++D S  
Sbjct  320  NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGXGLTVVDQSHS  379

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+S
Sbjct  380  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  439

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KW     
Sbjct  440  MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWXEANX  499

Query  267  EIEAKKQ  247
             ++  KQ
Sbjct  500  MLKKTKQ  506



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 167/194 (86%), Gaps = 1/194 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H KLLCTVAVG VKTLFIL+ATF LDR GRR+LLL+SVGGM+AS++LLA  LTII+HS+ 
Sbjct  320  HDKLLCTVAVGVVKTLFILVATFMLDRSGRRRLLLTSVGGMVASLVLLATGLTIIEHSEQ  379

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L IAMVLAYVA FSIGMGPITWVYSSEIFPLRLRATGCS+GVA NRVTSGVVS
Sbjct  380  KLIWAIALCIAMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVS  439

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIG AFF+Y  +A VA +FF+TLMPET+GKTLEEMETLFGTF+ WR+  R
Sbjct  440  MTFLSLEKAITIGAAFFLYAALAAVALVFFYTLMPETQGKTLEEMETLFGTFWNWRARAR  499

Query  267  EI-EAKKQKMTTNQ  229
            E+ E KK +  +N 
Sbjct  500  ELKELKKTEKNSND  513



>ref|XP_012069681.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
 gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 158/201 (79%), Gaps = 3/201 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +KKLL TVAVGFVKT+FIL+ATF LDR GRR LLL+SV GMI S+  L  +LTIIDHS  
Sbjct  333  NKKLLATVAVGFVKTMFILVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHD  392

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MVLAYVAFFSIGMGPITWVYSSE+FPLRLRA G SMGVA   VTSGV+S
Sbjct  393  KLTWAIVLCITMVLAYVAFFSIGMGPITWVYSSEVFPLRLRAQGASMGVAVGGVTSGVIS  452

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+SLYK ITIGGAFF++  IA  A+ FFFT +PETRG+TLE+ME  FG+F  WRS L+
Sbjct  453  TTFISLYKGITIGGAFFLFAAIATGAWTFFFTCLPETRGRTLEDMEVRFGSFINWRSALK  512

Query  267  EIEAKKQKMTT---NQLQMSS  214
            E   KK+  ++   +Q+Q+ +
Sbjct  513  EENLKKKAASSENDDQIQLGT  533



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVG VKT+FIL+ATF LD+FGRR LLL+SVGGMI S+ LL + LT++DHS  
Sbjct  327  NDKLLATVAVGVVKTIFILVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHG  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L IAMV+  VAFFSIG+GP+TWVYSSEI+PL+LRA GC+MGVA NRV SGV+S
Sbjct  387  KVQWAVALCIAMVMFNVAFFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST--  274
            MTF+SLYKAITIGGAFF+Y G + +AFIFF+T++PET+G+TLE+ME LFG + KWR    
Sbjct  447  MTFISLYKAITIGGAFFLYAGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANA  506

Query  273  -LREIEAKKQKMT  238
             L++ EA ++  +
Sbjct  507  MLKKKEAAEKSQS  519



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVG VKT+FIL+ATF LD+FGRR LLL+SVGGMI S+ LL + LT++DHS  
Sbjct  327  NDKLLATVAVGVVKTIFILVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHG  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L IAMV+  VAFFSIG+GP+TWVYSSEI+PL+LRA GC+MGVA NRV SGV+S
Sbjct  387  KVQWAVALCIAMVMFNVAFFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST--  274
            MTF+SLYKAITIGGAFF+Y G + +AFIFF+T++PET+G+TLE+ME LFG + KWR    
Sbjct  447  MTFISLYKAITIGGAFFLYAGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANA  506

Query  273  -LREIEAKKQKMT  238
             L++ EA ++  +
Sbjct  507  MLKKKEAAEKSQS  519



>ref|XP_010068107.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=487

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLL T+AVGFVKT+FIL++TF LDR GRR LLLSSVGGMI S+  LA  LTIID S  
Sbjct  285  DKKLLATIAVGFVKTIFILVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHT  344

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             + WAV + IA VL +VAFFSIG+GPI WVYSSEIFPLRLRA GC++GVA NRV SGV+ 
Sbjct  345  TLKWAVAMCIASVLFFVAFFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLV  404

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGGAFF+YTGI   +++FF+ LMPET+G+TLEE++  FG + KWRST R
Sbjct  405  MTFLSLSKAITIGGAFFLYTGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTAR  464

Query  267  EIEAKKQKMTTNQ  229
            E+E ++ K   N 
Sbjct  465  ELEMRRNKAVVNN  477



>ref|XP_006361759.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=475

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H +LL TVA+G VKT+FIL+ATF LDR GRR LLL+S GGM  S++LL+I L +ID S+ 
Sbjct  273  HDRLLATVAMGCVKTVFILVATFLLDRVGRRPLLLTSFGGMTISLILLSIGLAVIDRSNS  332

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            +V WAV L + MV  YVA FSIG GPI WVY SE+FPL+LRATG S+GVA NRVTSGV+S
Sbjct  333  QVTWAVALCVMMVSVYVALFSIGAGPIAWVYGSEVFPLKLRATGFSVGVAVNRVTSGVIS  392

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITI GAFF Y GIA +A++FFFTLMPET+GKTLEE   LFGTFF+WRST R
Sbjct  393  MTFLSLEKAITIQGAFFSYAGIAGMAWVFFFTLMPETQGKTLEETVALFGTFFEWRSTAR  452

Query  267  EIEAKKQKMTTNQLQMSS  214
            E++ KK     +++QM++
Sbjct  453  ELKGKKMN-NNDEIQMAT  469



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+FIL+ATF LDR GRR LLLSSVGGM+AS+  +A +LTIIDHS+ 
Sbjct  329  NDKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLSSVGGMVASLAAIAFSLTIIDHSEE  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MVLA+VAFFSIGMGPI  VY+SEIFPLRLRA G SM VA NRVTSGV +
Sbjct  389  KLVWAIGLCITMVLAFVAFFSIGMGPIAGVYTSEIFPLRLRAQGVSMAVAVNRVTSGVTA  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLY AITIGGAFF++ GIA + ++FF+T +PETRGKTLEEME LFG    WR   +
Sbjct  449  MTFISLYNAITIGGAFFLFAGIAAMGWVFFYTCVPETRGKTLEEMEGLFGKLVGWREEAK  508

Query  267  EIEAKKQKMTTNQLQMSST  211
            ++++   +  + Q+Q+ +T
Sbjct  509  KMKSTVMEEESRQVQLGNT  527



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLL T+AVGFVKT+FIL++TF LDR GRR LLLSSVGGMI S+  LA  LTIID S  
Sbjct  321  DKKLLATIAVGFVKTIFILVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHT  380

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             + WAV + IA VL +VAFFSIG+GPI WVYSSEIFPLRLRA GC++GVA NRV SGV+ 
Sbjct  381  TLKWAVAMCIASVLFFVAFFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLV  440

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGGAFF+YTGI   +++FF+ LMPET+G+TLEE++  FG + KWRST R
Sbjct  441  MTFLSLSKAITIGGAFFLYTGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTAR  500

Query  267  EIEAKKQKMTTNQ  229
            E+E ++ K   N 
Sbjct  501  ELEMRRNKAVVNN  513



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGF+KT+FI IATF LDR GRR LLL+S+GGMI S+  L  ALTI+DH D  +P
Sbjct  332  LLATVAVGFIKTIFIFIATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDSTIP  391

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WAV L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRV SG++SMTF
Sbjct  392  WAVALCITMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTF  451

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSLYKAITIGGAFF+Y GI V+A++FF+T++PET+G+TLEEME LFG + KWR     ++
Sbjct  452  LSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLK  511

Query  258  AKK  250
            +KK
Sbjct  512  SKK  514



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 161/193 (83%), Gaps = 3/193 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVG VKTLFIL+ATF LD+FGRR LLL+SVGGMI S++LL + LT+++HS  
Sbjct  327  NDKLLATVAVGVVKTLFILVATFMLDKFGRRPLLLTSVGGMIFSLMLLGVGLTVVEHSHS  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ L IAMVL+ VAFFSIG+GPITWVYSSEI+PL+LRA GC+MGVA NR+ SGV+S
Sbjct  387  KVQWAIALCIAMVLSNVAFFSIGLGPITWVYSSEIYPLQLRAQGCAMGVAMNRLMSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST--  274
            MTF+SLYKAITIGGAFF+Y G + +AF+FF+T++PET+G++LE+ME LFG + KWR    
Sbjct  447  MTFISLYKAITIGGAFFLYAGTSSIAFMFFYTMLPETQGRSLEDMELLFGKYHKWRQANA  506

Query  273  -LREIEAKKQKMT  238
             L++ EA ++  +
Sbjct  507  MLKKKEAAEKSQS  519



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT++D S  
Sbjct  329  NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHS  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NR TSGV+S
Sbjct  389  KVSWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVIS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYK ITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  449  MTFISLYKTITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  508

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  509  MLNKSKQ  515



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT++D S  
Sbjct  329  NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHS  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L IAMVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NR TSGV+S
Sbjct  389  KVSWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVIS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYK ITIGGAFF+Y GIA ++++FF+TL PET+G++LE+ME LFG + KWR    
Sbjct  449  MTFISLYKTITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  508

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  509  MLNKSKQ  515



>gb|KEH30427.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=333

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            L+ T+AVGFVKTLFIL+ATF LDR+GRR LLL+SVGGM+ S+L LA++LTIIDHS+ K+ 
Sbjct  137  LIATIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLN  196

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA+ LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G + GV  NRVTSGV+SMTF
Sbjct  197  WAIGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTF  256

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSL K ITIGGAFF++ GIA + +IFF+ ++PET+GKTLEEME  FG    WR +    E
Sbjct  257  LSLSKGITIGGAFFLFGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKE  314

Query  258  AKKQKMTTNQLQMSSTYT  205
            A+K      Q+Q+ +  +
Sbjct  315  AEKDNAQVAQVQLGTNVS  332



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGFVKT+FI IATF LDR GRR LLL+S+GGMI S++ L  ALTIID+ D K+P
Sbjct  331  LLATVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIP  390

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WAV L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRV SG+VSMTF
Sbjct  391  WAVALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTF  450

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSLYKAITIGGAFF+Y GI V+A++FF+T++PET+G+TLEEME LFG + KWR     ++
Sbjct  451  LSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLK  510

Query  258  AKK  250
             KK
Sbjct  511  TKK  513



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGFVKT+FI IATF LDR GRR LLL+S+GGMI S++ L  ALTIID+ D K+P
Sbjct  331  LLATVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIP  390

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WAV L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRV SG+VSMTF
Sbjct  391  WAVALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTF  450

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSLYKAITIGGAFF+Y GI V+A++FF+T++PET+G+TLEEME LFG + KWR     ++
Sbjct  451  LSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLK  510

Query  258  AKK  250
             KK
Sbjct  511  TKK  513



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+ IL+ATF +DRFGRR LLLSSVGGM+ S  LL + LT++D S  
Sbjct  327  NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHS  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KVPWAV L IAMVL  VAFFSIG+GPITWVYSSEIF L+LRA GCSMG A NR+TSGV+S
Sbjct  387  KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFSLQLRAQGCSMGEAVNRMTSGVIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA ++++FF+TL PET G++LE+ME LFG + KWR    
Sbjct  447  MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETXGRSLEDMEVLFGKYHKWREANA  506

Query  267  EIEAKKQ  247
             +   KQ
Sbjct  507  MLNKTKQ  513



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGFVKT+FI IATF LDR GRR LLL+S+GGMI S++ L  ALTIID+ D K+P
Sbjct  331  LLATVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIP  390

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WAV L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRV SG+VSMTF
Sbjct  391  WAVALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTF  450

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSLYKAITIGGAFF+Y GI V+A++FF+T++PET+G+TLEEME LFG + KWR     ++
Sbjct  451  LSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANAMLK  510

Query  258  AKK  250
             KK
Sbjct  511  TKK  513



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K LL T+AVG VKT+FIL+ATF LDR GRR LLLSS+ GMIAS+  L   LTI+ HSD 
Sbjct  328  NKLLLATIAVGSVKTIFILVATFLLDRIGRRPLLLSSMAGMIASLACLGFGLTIVVHSDE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV LSI MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SG +S
Sbjct  388  KVMWAVVLSITMVLVYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAVNRVVSGTLS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLY+AITIGGAFF++ GIA V ++FF+T++PET+G+TLE+ME LFG F KW+    
Sbjct  448  MTFISLYEAITIGGAFFLFAGIAAVGWVFFYTMLPETQGRTLEDMEVLFGKFHKWKKANA  507

Query  267  EIEAKKQKMTTNQ  229
             +  K+    +N 
Sbjct  508  LLRNKRVDPNSND  520



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 159/204 (78%), Gaps = 6/204 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLLCTVAVGFVKT+FIL+ATF +D+ GRR LLL+SV GMI S+  L + LTIID +  
Sbjct  327  DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHE  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA  L + MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+S
Sbjct  387  RILWAAVLCLTMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLY+AITIGGAFF+Y  IA VA++FFFT++PET G+TLE+ME LFG F KWR    
Sbjct  447  MTFISLYEAITIGGAFFLYAAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  267  EIEAKKQK-----MTTN-QLQMSS  214
             ++ KK       +T N Q+Q+ +
Sbjct  507  LLKQKKNASHGDGITNNGQVQLGT  530



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +KKL+ T+AVG VKT+ IL+ATF LDR GRR LLLSSVGGMI S+  L + LTII+HS  
Sbjct  332  NKKLVATIAVGVVKTMLILVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQT  391

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV + IA VL+YVAFFSIGMGPITWVYSSEIFPLRLRA GC++GVA NRVTSGV +
Sbjct  392  KLMWAVVMCIASVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVSA  451

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLY AI+IGGAFF++  +A  A++FF+ LMPET+G+TLEEM   FG + KWRS  R
Sbjct  452  MSFISLYDAISIGGAFFLFMAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAR  511

Query  267  EIEAKKQK  244
            EI+ ++ K
Sbjct  512  EIDIQRNK  519



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KT+FIL+ATF LD+FGRR LLL+SVGGMI S++ L + LTI+DH   
Sbjct  328  NHKLLATVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMIFSLMFLGVGLTIVDHHKG  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWAV L +AMV   VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRVTSG+VS
Sbjct  388  SVPWAVGLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GI+  A++FF+T++PET+G+TLE+ME LFG +F+WR    
Sbjct  448  MTFISLYKAITIGGAFFLYAGISAAAWMFFYTMLPETQGRTLEDMEVLFGKYFRWRKANA  507

Query  267  EIEAKKQ  247
             ++ +KQ
Sbjct  508  MLKERKQ  514



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 156/195 (80%), Gaps = 6/195 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +KKL  TVAVGFVKT FIL+ATF LDR GRR LLLSSV GMI S++ LA  LT+I++SD 
Sbjct  320  NKKLGATVAVGFVKTCFILVATFLLDRVGRRPLLLSSVAGMIVSLVGLATGLTVIENSDK  379

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+PWA+ L I MVL +VA FSIG+GPITWVYSSEIFPLRLRA G ++GVA NRVTSGV++
Sbjct  380  KLPWAIVLCIMMVLTFVASFSIGLGPITWVYSSEIFPLRLRAQGAAVGVAVNRVTSGVLA  439

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y G+A VA+ FFFT +PET+G+ LEE E LFG  F+WRS L 
Sbjct  440  MTFISLYKAITIGGAFFLYGGVATVAWFFFFTFLPETQGRALEETEELFGN-FRWRSAL-  497

Query  267  EIEAKKQKMTTNQLQ  223
                 K+KM  NQ Q
Sbjct  498  ----TKKKMNKNQNQ  508



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 155/204 (76%), Gaps = 6/204 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLLCTVAVGFVKT+FIL+ATF +D+ GRR LLL+SV GMI S+  L + LTIID +  
Sbjct  327  DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHE  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA  L + MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+S
Sbjct  387  RILWAAVLCLTMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAMNRVVSGVLS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLY AITIGGAFF+Y  IA VA++FFFT++PET G+TLE+ME LFG F KWR    
Sbjct  447  MTFISLYDAITIGGAFFLYAAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  267  EIEAKKQ------KMTTNQLQMSS  214
             ++ KK            Q+Q+ +
Sbjct  507  LLKQKKNASHGDGNANNGQVQLGT  530



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L+ T+ VG VKTLFIL+ATF LDR GRR LLLSSVGGMI S+  L + LTII+HS  
Sbjct  332  NKMLVATIGVGVVKTLFILVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQT  391

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV + IA VL+YVAFFSIGMGPITWVYSSEIFPLRLRA GC++GVA NRVTSGV++
Sbjct  392  KLMWAVVVCIASVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVLA  451

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLY+AI+IGGAFF++  +A  A++FF+ LMPET+G+TLEEM   FG + KWRS  R
Sbjct  452  MSFISLYEAISIGGAFFLFMAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAR  511

Query  267  EIEAKKQK  244
            EI+ ++ K
Sbjct  512  EIDIQRNK  519



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            +LL T+AVG +KT F L+ATF +D+ GRR LLLSS GGMI S+L LA  LTIIDHSDH +
Sbjct  314  RLLATIAVGCMKTFFTLVATFLVDKIGRRILLLSSCGGMILSLLALATGLTIIDHSDHTL  373

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ + +    + VAFFSIGMGP+ WVYSSEIFPLRLRA GCS+GVA NR  SG + MT
Sbjct  374  KWAIVVCVCATYSTVAFFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMT  433

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            F+SLYKAI+IGGAFF+Y G+A VA+IFF+TL+PET+G+TLEEME LFGTFFKWRST++E+
Sbjct  434  FISLYKAISIGGAFFLYAGVASVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKEL  493

Query  261  EAKKQKMTTNQLQMSSTY  208
              KK ++  + +  S  +
Sbjct  494  --KKNRVEGDDMLSSHNF  509



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGFVKT FIL+ATF LDR GRR LLL+SV GMI S+  L + LT+IDHSD K+ 
Sbjct  330  LLATVAVGFVKTCFILVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKLI  389

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WAV LS+  VL+YVAFFSIGMGPITWVYSSEIFPLRLRA GCS+GV  NRVTSGV+SMTF
Sbjct  390  WAVALSLCTVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTF  449

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF--GTFFKWRSTLRE  265
            +SLYKAITIGGAFF+Y+G+A+V +IFF+T +PET+G+TLE+ME LF   ++ K +S+  +
Sbjct  450  ISLYKAITIGGAFFLYSGVALVGWIFFYTWLPETQGRTLEDMEILFTNSSWNKKKSSTND  509

Query  264  IEAKKQKMTTNQLQMSST  211
                       Q+Q+ + 
Sbjct  510  TSGNSNDHINGQIQLGTN  527



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            +LL T+AVG +KT F L+ATF +D+ GRR LLLSS GGMI S+L LA  LTIIDHSDH +
Sbjct  328  RLLATIAVGCMKTFFTLVATFFVDKIGRRILLLSSCGGMILSLLALATGLTIIDHSDHTL  387

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ + +    + VAFFSIGMGP+ WVYSSEIFPLRLRA GCS+GVA NR  SG + MT
Sbjct  388  KWAIVVCVCATYSTVAFFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMT  447

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            F+SLYKAI+IGGAFF+YTGIA+VA+IFF+TL+PET+G+TLEEME LFGTFFKWRST++E+
Sbjct  448  FISLYKAISIGGAFFLYTGIAIVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKEL  507

Query  261  EAKK  250
            +  +
Sbjct  508  KRSR  511



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGFVKT FIL+ATF LDR GRR LLL+SV GMI S+  L + LT+IDHSD K+ 
Sbjct  330  LLATVAVGFVKTCFILVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKLI  389

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WAV LS+  VL+YVAFFSIGMGPITWVYSSEIFPLRLRA GCS+GV  NRVTSGV+SMTF
Sbjct  390  WAVALSLCTVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTF  449

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF--GTFFKWRSTLRE  265
            +SLYKAITIGGAFF+Y+G+A+V +IFF+T +PET+G+TLE+ME LF   ++ K +S+  +
Sbjct  450  ISLYKAITIGGAFFLYSGVALVGWIFFYTWLPETQGRTLEDMEILFTNSSWNKKKSSTND  509

Query  264  IEAKKQKMTTNQLQMSST  211
                       Q+Q+ + 
Sbjct  510  TSGNSNDHINGQIQLGTN  527



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 156/204 (76%), Gaps = 6/204 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLLCTVAVGFVKT+FIL+ATF +D+ GRR LLL+SV GMI S++ L + LTIID +  
Sbjct  327  DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA  L I MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+S
Sbjct  387  RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLY+AITIGGAFF+Y  IA VA++FFF ++PET G+TLE+ME LFG F KWR    
Sbjct  447  MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  267  EIEAKKQ------KMTTNQLQMSS  214
             ++ KK            Q+Q+ +
Sbjct  507  LLKQKKNLSHGDGNTNNGQVQLGT  530



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 156/204 (76%), Gaps = 6/204 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLLCTVAVGFVKT+FIL+ATF +D+ GRR LLL+SV GMI S++ L + LTIID +  
Sbjct  327  DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA  L I MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+S
Sbjct  387  RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLY+AITIGGAFF+Y  IA VA++FFF ++PET G+TLE+ME LFG F KWR    
Sbjct  447  MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  267  EIEAKKQ------KMTTNQLQMSS  214
             ++ KK            Q+Q+ +
Sbjct  507  LLKQKKNLSHGDGNTNNGQVQLGT  530



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL T+AVG VKTLFIL+ATF LDR GRR LLL S+GGM+ S+  L  +LT+ID S  
Sbjct  328  NHKLLATIAVGVVKTLFILVATFLLDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSQG  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             V WAV L I MVL  VAFFSIG+GP+TWVY+SEIFPL+LRA GCSMGVA NRVTSG++S
Sbjct  388  TVTWAVGLCITMVLFNVAFFSIGLGPVTWVYTSEIFPLKLRAQGCSMGVAINRVTSGIIS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y G+ VVA+IFF+T++PET+G+TLEEME LFG + KW+    
Sbjct  448  MTFISLYKAITIGGAFFLYAGVGVVAWIFFYTMLPETQGRTLEEMEVLFGKYHKWKEANA  507

Query  267  EIEAKKQ  247
             ++ +KQ
Sbjct  508  MLKKRKQ  514



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 158/201 (79%), Gaps = 1/201 (0%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL T+AVGFVK +FIL+ATFTLD+ GRR L+L+S+GG    +L+LA  LT I +SDH+
Sbjct  321  HKLLATMAVGFVKLMFILVATFTLDKIGRRPLILTSIGGCCVCLLVLATGLTFIQNSDHR  380

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ L +  +L +VA F +GMGPITWVYSSEIFPLRLRA GC++ +A+NRVTS +++M
Sbjct  381  LVWAIALCLVAILCFVAIFGMGMGPITWVYSSEIFPLRLRAQGCALAIASNRVTSALLTM  440

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TF+SLYKAIT+ GAFF+Y G A VA++FF+TL PET+GKTLEEM +LFGTFFKWRST+R 
Sbjct  441  TFISLYKAITLAGAFFLYAGFAAVAWVFFYTLYPETKGKTLEEMGSLFGTFFKWRSTVRA  500

Query  264  IEAKKQKMTTNQLQMSSTYTK  202
            +E KK       +Q  +T T 
Sbjct  501  LEEKKGDY-NGHVQTGNTTTD  520



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVGFVKT+FIL ATFTLDR GRR LLLSSVGGM+ S+L LAI+LTII HS+ K+
Sbjct  324  KLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSERKL  383

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV LSIAMVLAYVA FSIG GPITWVYSSEIFPLRLRA G + GV  NR TSGVVSMT
Sbjct  384  MWAVALSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMT  443

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSL +AITIGGAFF+Y GIA + +IFF+TL+PETRGKTLE+ME  FGTF    +  + +
Sbjct  444  FLSLSEAITIGGAFFLYCGIATLGWIFFYTLLPETRGKTLEDMEGSFGTFRSKSNATKGV  503

Query  261  EAKKQKMTTNQL  226
            E    ++   QL
Sbjct  504  ENGNGQVAQVQL  515



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVGFVKT+FIL ATFTLDR GRR LLLSSVGGM+ S+L LAI+LTII HS+ K+
Sbjct  326  KLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSERKL  385

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV LSIAMVLAYVA FSIG GPITWVYSSEIFPLRLRA G + GV  NR TSGVVSMT
Sbjct  386  MWAVALSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMT  445

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSL +AITIGGAFF+Y GIA + +IFF+TL+PETRGKTLE+ME  FGTF    +  + +
Sbjct  446  FLSLSEAITIGGAFFLYCGIATLGWIFFYTLLPETRGKTLEDMEGSFGTFRSKSNATKGV  505

Query  261  EAKKQKMTTNQL  226
            E    ++   QL
Sbjct  506  ENGNGQVAQVQL  517



>ref|XP_008466959.1| PREDICTED: polyol transporter 5-like, partial [Cucumis melo]
Length=276

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 158/200 (79%), Gaps = 2/200 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            ++KLL TVAVGFVKT+FIL+ATF LDR GRR LLL+SV GMI S+  L +ALT+I+ +D 
Sbjct  73   NQKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDK  132

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L I+MVL YVA FSIGMGPITWVYSSEIFPL+LRA G SMGVA NRVTSGV+S
Sbjct  133  KLMWAVVLCISMVLTYVASFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVIS  192

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+FLSL KAIT GGAFF++  IA+VA+ FF+T +PET+GKTLEEME LFG  F+W+S   
Sbjct  193  MSFLSLSKAITTGGAFFLFAAIAIVAWFFFYTALPETQGKTLEEMEMLFG-HFRWKSAAA  251

Query  267  EIEAKKQKMTTN-QLQMSST  211
                +K   +   QL +++T
Sbjct  252  PAATEKDNGSGGVQLAVAAT  271



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVAVGFVKT+ IL+ATF LDRFGRR LLLSSV GMI S++ L + LTIID    
Sbjct  328  DHKLLATVAVGFVKTIAILVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDQHHD  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWA+ L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G SMGVA NR+TSGV+S
Sbjct  388  TVPWAIALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVIS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSLYKAITIGG+FF+Y GIA V+++FF+ L+PETRG+TLE++E LFG + KW+    
Sbjct  448  MTFLSLYKAITIGGSFFLYAGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHKWKKANA  507

Query  267  EIEAKKQ  247
             ++  KQ
Sbjct  508  LLKQSKQ  514



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVA+GFVKT+ IL+ATF LDRFGRR+LLLSSV GMI S++ L + LTIIDH   
Sbjct  314  DHKLLATVAIGFVKTIAILVATFLLDRFGRRRLLLSSVAGMIFSLVCLGVGLTIIDHHRG  373

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWA+ L I MVL  V FFSIG+GPITWVYSSEIFPL+LRA G SMGVA NR+TSGV+S
Sbjct  374  TVPWAIALCITMVLFNVVFFSIGLGPITWVYSSEIFPLKLRAQGASMGVAVNRITSGVIS  433

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSLYKAITIGG+FF+Y GIA V+++FF+ L+PETRG+TLE++E LFG + +W+    
Sbjct  434  MTFLSLYKAITIGGSFFLYAGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANA  493

Query  267  EIEAKKQ-KMTTNQLQMS  217
             ++  KQ     N+ Q++
Sbjct  494  VLKQSKQGDGDENKSQVN  511



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL T+AVG  KTLFIL+ATF LDR GRR LLL+S+GGMI S+ LL  +L +I HSDH V
Sbjct  287  KLLATIAVGISKTLFILVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIGHSDHTV  346

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV L+I  VLAYV  FSIG+GPI WVYSSE+FPLRLRA GCS+GVA NR TSG++SMT
Sbjct  347  HWAVALAIFGVLAYVGTFSIGLGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMT  406

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSLYKAI+I GAF+++  IA VA+IF FTL+PET+G++LEEM  LFGT+F WR TL+ +
Sbjct  407  FLSLYKAISIAGAFYLFAAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLKGL  466

Query  261  EAKKQKMTTN  232
            + ++ +   N
Sbjct  467  KNREAEEAKN  476



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL T+AVG VKTLFIL+ATF +DR GRR LLL S+GGM+ S+  L  +LT+ID S  
Sbjct  331  NHKLLATIAVGVVKTLFILVATFLIDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSHG  390

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWA+ L I MVL  VAFFSIG+GP+TWVY+SEIFPL+LRA GCS+GVA NRVTSG++S
Sbjct  391  TVPWAIGLCITMVLFNVAFFSIGLGPVTWVYTSEIFPLKLRAQGCSLGVAINRVTSGIIS  450

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y G+ VV +IFF+T++PET G+TLEEME LFG + KW+    
Sbjct  451  MTFISLYKAITIGGAFFLYAGVGVVGWIFFYTMLPETHGRTLEEMEVLFGKYHKWKEANA  510

Query  267  EIEAKKQKMTTNQLQMSS  214
             ++  KQ    +  ++ S
Sbjct  511  MLKNGKQGDRVDGDEIKS  528



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KT+FIL+ATF LD+FGRR LLL+SVGGM+ S++ L + LTI+DH   
Sbjct  328  NHKLLATVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKG  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWA+ L +AMV   VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRVTSGVVS
Sbjct  388  SVPWAIGLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GI+  A+IFF+T++PET+G+TLE+ E LFG + +WR    
Sbjct  448  MTFISLYKAITIGGAFFLYAGISAAAWIFFYTMLPETQGRTLEDTEVLFGKYHRWRKANA  507

Query  267  EIEAKKQ  247
             ++ +KQ
Sbjct  508  MLKERKQ  514



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   241 bits (615),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 155/204 (76%), Gaps = 6/204 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LLCTVAVGFVKT+FIL+ATF +D+ GRR LLL+SV GMI S++ L + LTII  ++ 
Sbjct  327  DKILLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIGQNNG  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA  L I MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCSMGVA NRV SGV+S
Sbjct  387  RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y  IA VA++FFF ++PET G+TLE+ME LFG F KWR    
Sbjct  447  MTFISLYKAITIGGAFFLYAAIASVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  267  EIEAKKQ------KMTTNQLQMSS  214
             ++ KK            Q+Q+ +
Sbjct  507  LLKQKKNVSHGDGNTNNGQVQLGT  530



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            L+ T+AVGFVKTLFIL+ATF LDR+GRR LLL+SVGGM+ S+L LA++LTIIDHS+ K+ 
Sbjct  276  LIATIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLN  335

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA+ LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G + GV  NRVTSGV+SMTF
Sbjct  336  WAIGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTF  395

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSL K ITIGGAFF++ GIA + +IFF+ ++PET+GKTLEEME  FG    WR +    E
Sbjct  396  LSLSKGITIGGAFFLFGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKE  453

Query  258  AKKQKMTTNQLQMSSTYT  205
            A+K      Q+Q+ +  +
Sbjct  454  AEKDNAQVAQVQLGTNVS  471



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLLCTVAVGFVKT+FIL+ATF +D+ GRR LLL+SV GMI S++ L + LTIID +  
Sbjct  278  DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  337

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA  L I MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+S
Sbjct  338  RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  397

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRS  277
            MTF+SLY+AITIGGAFF+Y  IA VA++FFF ++PET G+TLE+ME LFG F +WR 
Sbjct  398  MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHRWRK  454



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL T+AVG  KTLFIL+ATF LDR GRR LLL+S+GGMI S+ LL  +L +IDHSDH V
Sbjct  331  KLLATIAVGISKTLFILVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIDHSDHTV  390

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV L+I  VLAYV  FSIG+GPI W YSSE+FPLRLRA GCS+GVA NR TSG++SMT
Sbjct  391  HWAVALAIFGVLAYVGTFSIGLGPIAWGYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMT  450

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSLYKAI+I GAF+++  IA VA+IF FTL+PET+G++LEEM  LFGT+F WR TL+ +
Sbjct  451  FLSLYKAISIAGAFYLFAAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLKGL  510

Query  261  EAKKQKMTTN  232
            + ++ +   N
Sbjct  511  KNREAEEAKN  520



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K LL T+AVG VKT+ IL+ATF LDR GRR LLLSS+ GMIAS++ L   LTI+DH+D 
Sbjct  328  NKLLLATIAVGSVKTVVILVATFLLDRIGRRPLLLSSMAGMIASLVCLGFGLTIVDHNDE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ LSI MVL YVAFFSIGMGP+TWVY+SEIFPL+LRA G S+GVA NRV SG++S
Sbjct  388  KVMWAIVLSITMVLFYVAFFSIGMGPVTWVYTSEIFPLKLRAQGFSIGVAVNRVASGILS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GI VV ++FF+T++PET+G+TLE++E LFG F +W+ T  
Sbjct  448  MTFISLYKAITIGGAFFLYAGIGVVGWVFFYTMLPETKGRTLEDIEVLFGKFHRWKETNA  507

Query  267  EIEAKKQKMTTN  232
             ++ K+     N
Sbjct  508  FLKNKRVDPNNN  519



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 153/188 (81%), Gaps = 3/188 (2%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TV VGFVKT+ IL+ATF LDRFGRRKLLLSSV GMI S+  L + LTIID+    V
Sbjct  330  KLLATVGVGFVKTIAILVATFFLDRFGRRKLLLSSVAGMIFSLACLGVGLTIIDNHKETV  389

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
            PWA+ L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G SMGVA NR+TSGV+SMT
Sbjct  390  PWAIALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMT  449

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWR---STL  271
            FLSLYKAITIGG+FF+Y GIA ++++FF+ L+PETRG+TLE++E LFG + +W+   + L
Sbjct  450  FLSLYKAITIGGSFFLYAGIAALSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANAVL  509

Query  270  REIEAKKQ  247
            ++ +  KQ
Sbjct  510  KQTKQTKQ  517



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
              KLLCTVAVG  KT+FIL+ATF +DR GRR LLL+SV GM+ S+  LA+ LTIID H  
Sbjct  328  DHKLLCTVAVGLAKTIFILVATFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDQHHG  387

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ W   L + MVLAY AFFSIG+GPITWVYSSEIFPLRLRA GCS+GVA NRV SGV+
Sbjct  388  AKMTWTTALCLTMVLAYAAFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVL  447

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF Y GIA VA++FF+T++PET+G+TLE+ME LFG F KW+   
Sbjct  448  SMTFISLYKAITMGGAFFFYGGIATVAWLFFYTMLPETQGRTLEDMEVLFGKFHKWKEAN  507

Query  270  REIEAKKQ  247
             ++E + Q
Sbjct  508  AQLETRAQ  515



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL T+AVGF KT+FIL+ATF LD+FGRR LLL+SV GM+ S+  L + LTI+DH   
Sbjct  328  NHKLLATIAVGFTKTVFILVATFFLDKFGRRPLLLTSVAGMVFSLTFLGVGLTIVDHHKG  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWA+ L +AMV   VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRVTSGVVS
Sbjct  388  SVPWAIGLCLAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+SLYKAITIGGAFF+Y GI+  A+IFF+TL+PET+G+TLE+ME LFG F +WR    
Sbjct  448  TTFISLYKAITIGGAFFLYAGISAAAWIFFYTLLPETQGRTLEDMEVLFGKFHRWRKANA  507

Query  267  EIEAKKQ  247
             ++ +KQ
Sbjct  508  MLKERKQ  514



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KT+FIL+ATF LD+FGRR LLL+SVGGM+ S++ L + LTI+DH   
Sbjct  328  NHKLLATVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKG  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWAV L +AM+   VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRVTSG+VS
Sbjct  388  SVPWAVGLCMAMIYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GI+  A++FF+T++PET+G+ LE+ME LFG + +WR    
Sbjct  448  MTFISLYKAITIGGAFFLYAGISAAAWMFFYTMLPETQGRPLEDMEVLFGKYHRWRKADA  507

Query  267  EIEAKKQ  247
             ++ +KQ
Sbjct  508  MLKERKQ  514



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            L+ T+AVGFVKTLFIL+ATF LDR+GRR LLL+SVGGM+ S+L LA++LTIIDHS+ K+ 
Sbjct  326  LIATIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLN  385

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA+ LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G + GV  NRVTSGV+SMTF
Sbjct  386  WAIGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTF  445

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSL K ITIGGAFF++ GIA + +IFF+ ++PET+GKTLEEME  FG    WR +    E
Sbjct  446  LSLSKGITIGGAFFLFGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKNTKE  503

Query  258  AKKQKMTTNQLQMSSTYT  205
            A+K      Q+Q+ +  +
Sbjct  504  AEKDNAQVAQVQLGTNVS  521



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LLCTVAVGFVKT+FIL+ATF LDR GRR LLL+SV GM+ ++  L + LTIIDHS  K+ 
Sbjct  331  LLCTVAVGFVKTVFILVATFMLDRIGRRPLLLTSVAGMVFTLACLGLGLTIIDHSGEKIM  390

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA+ LS+ MVLAYVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+SMTF
Sbjct  391  WAIALSLTMVLAYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLSMTF  450

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            +SLYKAITIGGAFF++  IA V + FFFT++PET+G+TLE+ME LFG F++WR     ++
Sbjct  451  ISLYKAITIGGAFFLFAAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANALLK  510

Query  258  AKKQ  247
             KKQ
Sbjct  511  QKKQ  514



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
              KLLCTVAVG  KT+FIL+ATF LDR GRR LLLSSV GMI S+  L + LTIID H  
Sbjct  328  DHKLLCTVAVGLAKTIFILVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHG  387

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ W   L + MV+AY A FSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRV SGV+
Sbjct  388  AKMTWTTALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVL  447

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF+Y GIA VA++FF+T+ PET+G+TLE+ME LFG F KWR   
Sbjct  448  SMTFISLYKAITMGGAFFLYGGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREAN  507

Query  270  REIEAKKQ  247
              +E K Q
Sbjct  508  AMLETKTQ  515



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
              KLLCTVAVG  KT+FIL+ATF LDR GRR LLLSSV GM+ S+  L +ALTIID H  
Sbjct  329  DHKLLCTVAVGLAKTVFILVATFLLDRIGRRPLLLSSVAGMVFSLGSLGVALTIIDQHHG  388

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ W   L + MV+AY A FSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRV SGV+
Sbjct  389  AKMTWTTALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVL  448

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF+Y GIA VA++FF+T+ PET+G+TLE+ME LFG F KWR   
Sbjct  449  SMTFISLYKAITMGGAFFLYGGIAAVAWVFFYTMYPETQGRTLEDMEILFGKFHKWREAN  508

Query  270  REIEAKKQ  247
              +E K Q
Sbjct  509  AMLETKTQ  516



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGF KTLFIL+ATF LDR GRR LLLSSVGGM+ S+  L   LTIIDHS  
Sbjct  330  NDKLLATVAVGFTKTLFILVATFFLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSHE  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+PWAV LSIAMVLA+VAFFSIGMGPI  VYSSEIFPLRLRA G  MGVA NRVTSGV++
Sbjct  390  KLPWAVALSIAMVLAFVAFFSIGMGPIAGVYSSEIFPLRLRAQGIGMGVAVNRVTSGVIT  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFK  286
             TF+ LYKAI+IGGAFF++ GIA VA++FFF   PETRG+TLE+ME LFG F K
Sbjct  450  TTFIMLYKAISIGGAFFLFAGIATVAWVFFFACYPETRGRTLEDMEVLFGNFIK  503



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
              KLLCTVAVG  KT+FIL+ATF LDR GRR LLLSSV GMI S+  L + LTIID H  
Sbjct  328  DHKLLCTVAVGLAKTIFILVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHG  387

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ W   L + MV+AY A FSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRV SG++
Sbjct  388  AKMTWTTALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGIL  447

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF+Y GIA VA++FF+T+ PET+G+TLE+ME LFG F KWR   
Sbjct  448  SMTFISLYKAITMGGAFFLYGGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREAN  507

Query  270  REIEAKKQ  247
              +E K Q
Sbjct  508  AMLETKTQ  515



>gb|ACD68477.1| plasma membrane mannitol transporter [Arachis hypogaea]
Length=434

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 156/198 (79%), Gaps = 4/198 (2%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL TVAVGFVKTLFIL+ATF LDR GRR LLLSSVGGMI S+L L I+LTII HSD K
Sbjct  241  DKLLATVAVGFVKTLFILVATFMLDRVGRRPLLLSSVGGMILSVLTLGISLTIITHSDKK  300

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WAV LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G +MGV  NRVTSGV+SM
Sbjct  301  LMWAVGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISM  360

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL KAI+IGGAFF++ GIA V +IFF+T++PETRGKTLE+ME  FG F    +  + 
Sbjct  361  TFLSLSKAISIGGAFFLFGGIATVGWIFFYTMLPETRGKTLEDMEGSFGQFRANPAGTKG  420

Query  264  IEAKKQKMTTNQLQMSST  211
            ++   +     Q+Q+ +T
Sbjct  421  VDNGNK----GQVQLGTT  434



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLL TVAVGFVKT+FIL+ATF LD+ GRR LLLSSV GMIAS+  LAI+LT+ID S  
Sbjct  329  DKKLLATVAVGFVKTIFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHK  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L+I+ VL+YVAFFSIGMGPITWVYSSEI PL+LRA G S+GV  NRVTSGVVS
Sbjct  389  KMIWAIGLAISTVLSYVAFFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGG+FF+Y  IA VA++FF+T +PET+GKTLEEM  LFG  F+W   LR
Sbjct  449  MTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRW---LR  504

Query  267  EIEAKKQKMTTNQLQMSS  214
            + + +K++   N++   S
Sbjct  505  DSKREKRRNKANEINGDS  522



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             +KLL TVAVG VKT+ IL+AT  LD+FGRR LLL+SV GM+ S+  L   LTI+D    
Sbjct  330  DQKLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLTCLGAGLTIVDQHHG  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+S
Sbjct  390  KITWAIVLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA V ++FF+TL PET+G+TLE+ME LFG + KWR    
Sbjct  450  MTFISLYKAITIGGAFFLYAGIAAVGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANA  509

Query  267  EIEAKKQ  247
             ++  KQ
Sbjct  510  MLKKTKQ  516



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
              KLLCTVAVG  KT+FIL+A F +DR GRR LLL+SV GM+ S+  LA+ LTIID H  
Sbjct  328  DHKLLCTVAVGLAKTIFILVAMFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDRHQG  387

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ W   L + MVLAY AFFSIG+GPITWVYSSEIFPLRLRA GCS+GVA NRV SGV+
Sbjct  388  AKMTWTTALCLTMVLAYAAFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVL  447

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF Y GIA VA++FF+T++PET+G+TLE+ME LFG F KW+   
Sbjct  448  SMTFISLYKAITMGGAFFFYAGIATVAWVFFYTMLPETQGRTLEDMEVLFGKFHKWKEVN  507

Query  270  REIEAKKQ  247
              +E K Q
Sbjct  508  ALLETKTQ  515



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLLCTVAVG  KT+FIL+ATF LDR GRR LLL+SV GMI S++ L + LTIID +  
Sbjct  278  DHKLLCTVAVGLAKTIFILVATFLLDRVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  337

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA  L I MVL YVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+S
Sbjct  338  RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  397

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRS  277
            MTF+SLY+AITIGGAFF+Y  IA VA++FFF ++PET G+TLE+ME LFG + +WR 
Sbjct  398  MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKYHRWRE  454



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   238 bits (608),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 158/195 (81%), Gaps = 4/195 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             KKLL TVAVGFVKT+FIL+ATF LD+ GRR LLLSSV GMIAS+  LAI+LT+ID S  
Sbjct  329  DKKLLATVAVGFVKTIFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHK  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L+I+ VL+YVAFFSIGMGPITWVYSSEI PL+LRA G S+GV  NRVTSGVVS
Sbjct  389  KMIWAIGLAISTVLSYVAFFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGG+FF+Y  IA VA++FF+T +PET+GKTLEEM  LFG  F+W   LR
Sbjct  449  MTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRW---LR  504

Query  267  EIEAKKQKMTTNQLQ  223
            + + +K++   N++ 
Sbjct  505  DSKREKRRNKANEIN  519



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVG VKT+ IL+AT  LD+FGRR LLL+SV GM+ S+  L  +LTI+D    K+
Sbjct  287  KLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLSCLGASLTIVDQQHGKI  346

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+SMT
Sbjct  347  MWAIVLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMT  406

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            F+SLYKAITIGGAFF+Y GIA V ++FF+ L PET+G+TLE+ME LFG + KWR     +
Sbjct  407  FISLYKAITIGGAFFLYAGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANALL  466

Query  261  EAKKQKMTTNQLQM  220
            +  KQ    ++ Q+
Sbjct  467  QKAKQVDGDDKGQV  480



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL T+AVG  KT+FIL+ATF LD+FGRR LLL+SV GM+ S+L L + LTI+DH   
Sbjct  328  NHKLLATIAVGGTKTVFILVATFFLDKFGRRPLLLTSVAGMVFSLLFLGVGLTIVDHHKG  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWAV L +AMV   VAFFSIG+GPITWVYSSEIFPL+LRA G S+GVA NRVTSG+VS
Sbjct  388  SVPWAVGLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y+GI+  A++FF+T++PET+G+TLE+ME LFG + +WR    
Sbjct  448  MTFISLYKAITIGGAFFLYSGISAAAWVFFYTMLPETQGRTLEDMEVLFGKYHRWRKANA  507

Query  267  EIEAKKQ  247
             ++ +KQ
Sbjct  508  MLKERKQ  514



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LLCTVAVGFVKT+FIL+ATF LDR GRR LLL+SV GM+ ++ LL + LTIIDH   
Sbjct  328  DKILLCTVAVGFVKTVFILVATFMLDRLGRRPLLLTSVAGMVVTLALLGLGLTIIDHHHE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WAV L + MVLAYVAFFSIGMGPITWVYSSEIFPL+LRA GCS+GVA NRV SGV+S
Sbjct  388  RIMWAVVLCLTMVLAYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF++  IA V + FFFT++PET+G+TLE+ME LFG F++WR    
Sbjct  448  MTFISLYKAITIGGAFFLFAAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANA  507

Query  267  EIEAKKQ  247
             ++ KKQ
Sbjct  508  LLKQKKQ  514



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 149/194 (77%), Gaps = 0/194 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVG VKT+ IL+AT  LD+FGRR LLL+SV GM+ S+  L   LTI+D    K+
Sbjct  332  KLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLSCLGAGLTIVDQQHGKI  391

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+SMT
Sbjct  392  MWAIVLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMT  451

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            F+SLYKAITIGGAFF+Y GIA V ++FF+ L PET+G+TLE+ME LFG + KWR     +
Sbjct  452  FISLYKAITIGGAFFLYAGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANALL  511

Query  261  EAKKQKMTTNQLQM  220
            +  KQ    ++ Q+
Sbjct  512  KKAKQADGDDKGQV  525



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 157/196 (80%), Gaps = 4/196 (2%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            +LL T+AVGFVKT+FIL+ATF LDR GRR LLL+SVGGM+ S+L LA++LTIIDHS+ K+
Sbjct  325  QLLATIAVGFVKTIFILVATFMLDRVGRRPLLLTSVGGMVLSLLTLAVSLTIIDHSETKL  384

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G +MGV  NRVTSGV+SMT
Sbjct  385  MWAVGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMT  444

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFK----WRST  274
            FLSL KAITIGGAFF++  IA   ++FF+T++PET+GKTLEEME  FG F +    + ST
Sbjct  445  FLSLSKAITIGGAFFLFGAIAAAGWVFFYTMLPETQGKTLEEMEGSFGKFGRKSQSYDST  504

Query  273  LREIEAKKQKMTTNQL  226
              E++  K ++   QL
Sbjct  505  HNELDNGKDQVAQVQL  520



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVAVGFVKT+ IL+ATF LDRFGRR LLLSSV GMI S++ L + LTIIDH   
Sbjct  314  DHKLLATVAVGFVKTIAILVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDHHSD  373

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWA+ L I MVL  VAFFSIG+GPITWVYSSEIFPL+LRA G SMGVA NR+TSGV+S
Sbjct  374  TVPWAIALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVIS  433

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFF---KWRS  277
            MTFLSLYKAITIGGAFF+Y GI  ++++FF+ L+PETRG+TLEE E LFG +    K  +
Sbjct  434  MTFLSLYKAITIGGAFFLYAGIGALSWVFFYMLLPETRGRTLEETEVLFGKYHRLEKANA  493

Query  276  TLREIEAKKQKMTTNQLQ  223
             LR+ E        +Q+ 
Sbjct  494  VLRQREQGFGDENKSQVN  511



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   236 bits (601),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             +KLL TVAVG VKT+ IL+AT  LD+FGRR LLL+SV GM+ S+  L   LTI+D    
Sbjct  330  DQKLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVLSLTCLGAGLTIVDQHHG  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MVL  VAF SIG+GPITWVYSSEIFPL+LRA GCSMGVA NRVTSGV+S
Sbjct  390  KITWAIVLCITMVLLNVAFXSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF+Y GIA + ++FF+TL PET+G+TLE+ME LFG + KWR    
Sbjct  450  MTFISLYKAITIGGAFFLYAGIAALGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANA  509

Query  267  EIEAKKQ  247
             ++  KQ
Sbjct  510  MLKKTKQ  516



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 153/198 (77%), Gaps = 14/198 (7%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L  TVAVGF KTLFIL+ATF LDR GRR LLLSS GGMI S+  L   LT+IDH  H
Sbjct  328  NKLLGTTVAVGFTKTLFILVATFMLDRVGRRPLLLSSTGGMIVSLASLGFGLTVIDHHPH  387

Query  627  -KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++PWA+ LSIA +LAYVAFFSIG+GPITWVYSSEIFPLRLRA G S+GV  NRVTSGV+
Sbjct  388  GQLPWAIGLSIASILAYVAFFSIGLGPITWVYSSEIFPLRLRAQGASVGVVVNRVTSGVI  447

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            +MTF+SLYKAITIGG+FF+Y G+A VA++FFFT + ETRGKTLEEME LFG         
Sbjct  448  TMTFISLYKAITIGGSFFLYAGVAAVAWVFFFTYLKETRGKTLEEMENLFG---------  498

Query  270  REIEAKKQKMTTNQLQMS  217
            ++ E KK      ++QM+
Sbjct  499  KKTEEKKD----GEVQMT  512



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 10/202 (5%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SDH  628
            K L  TVAVGF KTLFIL+ATF LDR GRR LLL+S  GMI S+  L + LT  +H +D 
Sbjct  323  KLLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLTSFAGMILSLAGLGLGLTAAEHHTDG  382

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             +PWAV LSIA VLAYVAFFSIG GPITWVYSSEIFPLRLRA G S+GVA NRVTSGV++
Sbjct  383  HLPWAVGLSIACVLAYVAFFSIGAGPITWVYSSEIFPLRLRAVGASIGVAVNRVTSGVIT  442

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAI++GG+FF+Y GIA VA++FFFT +PETRG+TLE+ME LFG         +
Sbjct  443  MTFISLYKAISLGGSFFLYGGIAAVAWVFFFTYLPETRGRTLEDMEELFG---------K  493

Query  267  EIEAKKQKMTTNQLQMSSTYTK  202
            E E  KQ    N+++M +   +
Sbjct  494  EKEVDKQTKEENRVEMVNASNR  515



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL TVAVGFVKT FIL+ATF LDR GRR LLL+SVGGM+ S+L L  +LTIID SD K
Sbjct  327  DKLLATVAVGFVKTCFILVATFMLDRIGRRPLLLTSVGGMVLSLLTLGTSLTIIDRSDTK  386

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            V WAV LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA GC+MGV  NRVTSGV+SM
Sbjct  387  VTWAVGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGCAMGVVVNRVTSGVISM  446

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL K ITIGGAFF++ GIA+  +IFF+T++PETRGKTLE+ME   G+F + +S ++ 
Sbjct  447  TFLSLSKGITIGGAFFLFGGIAICGWIFFYTMLPETRGKTLEDME---GSFGQSKSKIKG  503

Query  264  IEAKKQKMTTNQ  229
             +        +Q
Sbjct  504  NKGVGNGKDNDQ  515



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
             KKLL T+AVG  KT+FIL+ TF +DR GRR LLL+S GG++ SML LA  LT+IDH   
Sbjct  326  EKKLLATIAVGLCKTVFILVTTFMVDRIGRRVLLLTSCGGLVLSMLTLATGLTVIDHYGA  385

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             + PW V L +    + VAFFS+GMGPI WVYSSEIFPL+LRA GC +GVA NR T+GV+
Sbjct  386  DRFPWVVVLCVLTTYSSVAFFSMGMGPIAWVYSSEIFPLKLRAQGCGLGVAINRATNGVI  445

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             M+F+SLY AITIGGAF++++GI +V +IFFFTL+PETRG+TLE+ME LFGTFFKWR+T+
Sbjct  446  LMSFISLYNAITIGGAFYLFSGIGIVTWIFFFTLLPETRGRTLEDMEVLFGTFFKWRTTM  505

Query  270  REIEAKKQK  244
            RE+  K+ +
Sbjct  506  RELHKKEAE  514



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            ++KLL TVAVGFVKT FIL+ATF LD+ GRR LLLSSV GMIAS+  LAI+LT+ID S  
Sbjct  329  NEKLLATVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHK  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L+I+ VL+YVAFFSIGMGPIT VYSSEI PL+LRA G S+G+  NRVTSGVVS
Sbjct  389  KVIWAVGLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGG+FF+Y  IA VA++FF+T +PET+GKTLEEM  LFG  F+W   LR
Sbjct  449  MTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRW---LR  504

Query  267  EIEAKKQKMTTNQLQMSS  214
            + + +K++   N++   S
Sbjct  505  DSKREKRRNKANEINGDS  522



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            ++KLL TVAVGFVKT FIL+ATF LD+ GRR LLLSSV GMIAS+  LAI+LT+ID S  
Sbjct  329  NEKLLATVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHK  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L+I+ VL+YVAFFSIGMGPIT VYSSEI PL+LRA G S+G+  NRVTSGVVS
Sbjct  389  KVIWAVGLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGG+FF+Y  IA VA++FF+T +PET+GKTLEEM  LFG  F+W   LR
Sbjct  449  MTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRW---LR  504

Query  267  EIEAKKQKMTTNQLQMSS  214
            + + +K++   N++   S
Sbjct  505  DSKREKRRNKANEINGDS  522



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL TVAVGFVKT+FIL+ATF LDR GRR LLLSSV GM+ S+  L  +LTIIDHS  K
Sbjct  331  DKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLSSVAGMVFSLATLGFSLTIIDHSHEK  390

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ L IAMVL YVA FSIGMGPITWVYSSEIFPLRLRA G SMGVA NRVTSGV+S 
Sbjct  391  LTWAIALCIAMVLLYVATFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVIST  450

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TF+SLYK ITIGGAFF++  IA VA+ FFFT +PET+G+TLE+ME LFG F KWRS L+E
Sbjct  451  TFISLYKGITIGGAFFLFAAIAAVAWTFFFTCLPETQGRTLEDMEILFGHFIKWRSALKE  510



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 154/193 (80%), Gaps = 2/193 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
            +KLL TVAVG VKTLFIL+ATF LDR GRR LLLSSVGGM+ S+L LAI+LTIID S+ K
Sbjct  322  QKLLATVAVGTVKTLFILVATFMLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIDRSESK  381

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ LSI MVL YVA FSIG GPITWVYSSEIFPLRLRA G + GV  NR TSGV+SM
Sbjct  382  LMWAIGLSITMVLVYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVISM  441

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL KAITIGGAFF+Y GIAVV ++FFF ++PETRGKTLE+ME  FGT F+ +S    
Sbjct  442  TFLSLTKAITIGGAFFLYCGIAVVGWLFFFIVLPETRGKTLEDMEGSFGT-FRAKSN-NG  499

Query  264  IEAKKQKMTTNQL  226
            +E +  K+   QL
Sbjct  500  VENENAKVPQVQL  512



>gb|KJB12317.1| hypothetical protein B456_002G011600 [Gossypium raimondii]
Length=486

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL T+A+GF KT+F+L+AT  LD+ GRR LLLSSVGGM+ S+  +  +LTI DHS+ 
Sbjct  298  NGKLLATIAIGFFKTIFVLVATLLLDKIGRRVLLLSSVGGMVVSLATIGFSLTIADHSET  357

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L + MVLA+V+FF+IGMGPIT VY SEIFPLRLRA G SMGVA NRV SG++S
Sbjct  358  KLTWAIVLCMTMVLAFVSFFAIGMGPITNVYMSEIFPLRLRAQGVSMGVAVNRVVSGIIS  417

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFF++ GIA V ++FF+  MPETRGKTLEEME LFG    W+   +
Sbjct  418  MTFISLYKAITIGGAFFLFAGIATVGWVFFYVCMPETRGKTLEEMECLFGKLVGWKEASK  477

Query  267  EIE  259
            ++ 
Sbjct  478  KMN  480



>gb|AAL38359.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AAM10180.1| sugar transporter protein [Arabidopsis thaliana]
Length=245

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATF LDR GRR LLL+SVGGM+ S+  L  +LTIID S+ 
Sbjct  36   HQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEK  95

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV ++IA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  96   KVMWAVVVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  155

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            ++FL + KA+T GGAF+++ GIA VA++FF+T +PET+G+ LE+M+ LF + F+WR +  
Sbjct  156  ISFLPMSKAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKS  214

Query  267  EIEAKKQKMTTN  232
            + +   +K   N
Sbjct  215  KPKGNPEKTVPN  226



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 157/200 (79%), Gaps = 2/200 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKTLFIL+ATF LDR GRR LLL+SVGGM+ S++ L  +LTIIDHS+ 
Sbjct  331  HQQLLATVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVLSLMALGTSLTIIDHSEK  390

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L+IA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  391  KVMWAVVLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  450

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFL + K +T GGAF+++ GIA VA++FF+T +PET+G+ LE+ME LF + F+WR +  
Sbjct  451  MTFLPMSKKMTTGGAFYLFGGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKN  509

Query  267  EIEAKKQKMTTN-QLQMSST  211
            + +   +K   N +++++S 
Sbjct  510  KPKGNPEKTIANPEVEIASN  529



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 151/192 (79%), Gaps = 1/192 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKTLFIL+ATF LDR GRR LLL+SVGGM+ S+L L  +LTIIDHS+ 
Sbjct  331  HQQLLATVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVLSLLALGTSLTIIDHSEK  390

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L+IA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  391  KVMWAVVLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  450

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFL + K +T GGAF+++ GIA VA++FF+T +PET+G+ LE+ME LF + F+WR +  
Sbjct  451  MTFLPMSKKMTTGGAFYLFGGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKN  509

Query  267  EIEAKKQKMTTN  232
            + +   +K   N
Sbjct  510  KPKGNPEKTIAN  521



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 154/201 (77%), Gaps = 8/201 (4%)
 Frame = -2

Query  807  HKKLL-CTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHS  634
             K LL  T AVG  KTLFIL+ATF LDR GRR LLLSS GGMI S++ L   LT++  H 
Sbjct  315  DKHLLGTTCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHP  374

Query  633  DHKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGV  454
            D K+PWA+ LSIA  LAYVAFFSIG+GPITWVYSSEIFPL++RA GCS+GVAANRVTSGV
Sbjct  375  DAKIPWAIGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGV  434

Query  453  VSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            +SMTFLSL KAITIGG+FF+Y+GIA +A++FF+T +PETRG+TLEEM  LFG       T
Sbjct  435  ISMTFLSLSKAITIGGSFFLYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG------DT  488

Query  273  LREIEAKKQKMTTNQLQMSST  211
                E+ +      +++M++T
Sbjct  489  AAASESDEPAKEKKKVEMAAT  509



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVGFVKT+FIL ATFTLDR GRR LLLSSVGGM+ S+L LAI+LT+IDHS+ K+
Sbjct  326  KLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSERKL  385

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV  SIAMVLAYVA FSIG GPITWVYSSEIFPLRLRA G + GVA NR TS VVSMT
Sbjct  386  MWAVGSSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMT  445

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSL +AITIGGAFF+Y GIA V +IFF+T++PETRGKTLE+ME  FGTF    +  + +
Sbjct  446  FLSLTRAITIGGAFFLYCGIATVGWIFFYTVLPETRGKTLEDMEGSFGTFRSKSNASKAV  505

Query  261  EAKKQKMTTNQL  226
            E +  ++   QL
Sbjct  506  ENENGQVAQVQL  517



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 151/194 (78%), Gaps = 7/194 (4%)
 Frame = -2

Query  789  TVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSDHKVPWA  613
            T AVG  KTLFIL+ATF LDR GRR LLLSS GGMI S++ L   LT++  H D K+PWA
Sbjct  322  TCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWA  381

Query  612  VTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTFLS  433
            + LSIA  LAYVAFFSIG+GPITWVYSSEIFPL++RA GCS+GVAANRVTSGV+SMTFLS
Sbjct  382  IGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLS  441

Query  432  LYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIEAK  253
            L KAITIGG+FF+Y+GIA +A++FF+T +PETRG+TLEEM  LFG       T    E+ 
Sbjct  442  LSKAITIGGSFFLYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG------DTAAASESD  495

Query  252  KQKMTTNQLQMSST  211
            +      +++M++T
Sbjct  496  EPAKEKKKVEMAAT  509



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   230 bits (587),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL TVAVGFVKT+FIL+ATF LDR GRR LLLSSVGGMI S+  L  ALTIIDHS  
Sbjct  329  NDKLLATVAVGFVKTVFILVATFLLDRIGRRPLLLSSVGGMIFSLATLGFALTIIDHSHE  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L IAMVLA VAFFSIG+GPI WVY++EI PLRLRA G SMG A NRVTSGV+S
Sbjct  389  KLTWAIALCIAMVLANVAFFSIGLGPIAWVYTTEIIPLRLRAQGASMGAAVNRVTSGVIS  448

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
             TF+SLYK ITIGGAFF++  IA VA+ FFFT +PET+G+TLE+ME LFG F KWRS L+
Sbjct  449  TTFISLYKGITIGGAFFLFAAIAAVAWSFFFTCLPETQGRTLEDMEVLFGHFIKWRSALK  508

Query  267  EIEAKKQKMTTN-QLQM  220
            + E   +   +N Q Q+
Sbjct  509  KHEEGNKDGESNGQTQL  525



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVGFVKT+FIL ATFTLDR GRR LLLSSVGGM+ S+L LAI+LT+IDHS+ K+
Sbjct  326  KLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSERKL  385

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV  SIAMVLAYVA FSIG GPITWVYSSEIFPLRLRA G + GVA NR TS VVSMT
Sbjct  386  MWAVGSSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMT  445

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSL +AITIGGAFF+Y GIA V +IFF+T++PETRGKTLE+ME  FGTF    +  + +
Sbjct  446  FLSLTRAITIGGAFFLYCGIATVGWIFFYTVLPETRGKTLEDMEGSFGTFRSKSNASKAV  505

Query  261  EAKKQKMTTNQL  226
            E +  ++   QL
Sbjct  506  ENENGQVAQVQL  517



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 155/202 (77%), Gaps = 1/202 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL T+A+G  KT+FIL+ATF LD+ GRR LLL S GGM+  +  L  +LTII HSD+
Sbjct  330  DHKLLATIAIGLSKTIFILVATFLLDKIGRRPLLLISSGGMVVILATLGFSLTIIGHSDN  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L I MVL+ VA FSIGMGPI WVYS+EIFPLRLRA G S+GVA NRVTSGV+S
Sbjct  390  KITWAVGLCITMVLSSVAVFSIGMGPIAWVYSTEIFPLRLRAQGASIGVAVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLY+AITIGGAFF+Y G+A+VAF FFFT +PET+GKTLEEME LFG    WR   +
Sbjct  450  MSFISLYEAITIGGAFFLYAGVALVAFFFFFTFLPETQGKTLEEMEWLFGKLVGWREEAQ  509

Query  267  EIEAKKQKMTTN-QLQMSSTYT  205
            +++ K++    N Q+Q+ +  T
Sbjct  510  KLKRKRKMNEANHQIQLGNNLT  531



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 157/200 (79%), Gaps = 7/200 (4%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
            ++ L  T AVG  KTLFIL+ATF LDR GRR LLLSSVGGMI S++ LA  LT+I+H  D
Sbjct  316  NQLLGTTCAVGVTKTLFILVATFLLDRVGRRPLLLSSVGGMIISLVGLAAGLTVIEHHPD  375

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+PWA+ ++IA  +AYVAFFSIGMGPITWVYSSE+FPL +RA GC++GVA+NRVTSGV+
Sbjct  376  GKIPWAIGVAIASTMAYVAFFSIGMGPITWVYSSEVFPLHVRALGCALGVASNRVTSGVI  435

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SL KAITIGGAFF+Y G+AV+A++FFFT +PETRG+TLE M  LFG      +T 
Sbjct  436  SMTFISLTKAITIGGAFFLYAGVAVLAWVFFFTFLPETRGRTLEAMHKLFG------ATD  489

Query  270  REIEAKKQKMTTNQLQMSST  211
             +++ +       +L+M++T
Sbjct  490  DDLKPQDGATKDKKLEMAAT  509



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            ++KLL TVAVGFVKT+FIL+ATF LDR GRR LLL+SV GMI S+  L +ALT+I+ +D 
Sbjct  331  NQKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDK  390

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L I+MVL YVA FSIGMGPITWVYSSEIFPL+LRA G SMGVA NRVTSGV+S
Sbjct  391  KLMWAVVLCISMVLTYVASFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVIS  450

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            M+FLSL KAIT GGAFF++  IA+VA+ FF+T +PET+GKTLEEMETLFG
Sbjct  451  MSFLSLSKAITTGGAFFLFAAIAIVAWFFFYTALPETQGKTLEEMETLFG  500



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKTLFIL+ATF LDR GRR LLL+SVGGM+ S++ L  +LTIIDH+  
Sbjct  331  HQQLLATVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVISLIALGTSLTIIDHTKK  390

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV L+IA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  391  KVTWAVVLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  450

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFL + K +T GGAF+++ GIA VA++FF+T +PET+G+ LE+ME LF   F+WR +  
Sbjct  451  MTFLPMSKKMTTGGAFYLFGGIATVAWLFFYTFLPETQGRMLEDMEELFNG-FRWRDSKN  509

Query  267  EIEAKKQKMTTN  232
            + +   +K   N
Sbjct  510  KPKGNPEKTIAN  521



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
             + LLCTV VG  KT+F L+ATF LDR GRR LLL+S+ GM+ S++ L  +LTI+D H  
Sbjct  285  DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGSLVCLGTSLTIVDQHEG  344

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L +  VLAYV FFSIG+GPI WVYSSEIFPLRLRA GC MGVA NR+ SG++
Sbjct  345  VRMTWAVVLCLCCVLAYVGFFSIGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGIL  404

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF++LYKAIT+GG FF+Y  I +V +IFFFT++PET+G+TLE+ME LFG F KWR   
Sbjct  405  SMTFITLYKAITMGGTFFLYAAIGIVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  270  REIEAKKQ  247
            + +E KKQ
Sbjct  465  KLLEKKKQ  472



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHS-D  631
            +++LL TVAVGFVKT+FIL+ATF LDR GRR LLLSSVGGM+ S+L L ++LT++DH+ D
Sbjct  328  NQQLLATVAVGFVKTVFILVATFFLDRIGRRPLLLSSVGGMVLSLLTLGMSLTVVDHTVD  387

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             KV WAV LSI  V+ YVA FSIG GPITWVYSSEIFPLRLRA G SMGV  NRVTSGV+
Sbjct  388  KKVMWAVVLSITTVMTYVATFSIGAGPITWVYSSEIFPLRLRAQGASMGVIVNRVTSGVI  447

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            SMTFLSL KAIT GGAFF++ GIA VA++FF+T +PET+GK LEEM+ LF   F WR +
Sbjct  448  SMTFLSLSKAITTGGAFFLFGGIATVAWVFFYTFLPETQGKMLEEMDELFEK-FNWRDS  505



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 154/201 (77%), Gaps = 8/201 (4%)
 Frame = -2

Query  807  HKKLL-CTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHS  634
             K LL  T AVG  KTLFIL+ATF LDR GRR LLLSS GGMI S++ L   LT++  H 
Sbjct  382  DKHLLGTTCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHP  441

Query  633  DHKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGV  454
            D K+PWA+ LSIA  LAYVAFFSIG+GPITWVYSSEIFPL++RA GCS+GVAANRVTSGV
Sbjct  442  DAKIPWAIGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGV  501

Query  453  VSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            +SMTFLSL KAITIGG+FF+Y+GIA +A++FF+T +PETRG+TLEEM  LFG       T
Sbjct  502  ISMTFLSLSKAITIGGSFFLYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG------DT  555

Query  273  LREIEAKKQKMTTNQLQMSST  211
                E+ +      +++M++T
Sbjct  556  AAASESDEPAKEKKKVEMAAT  576



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 147/193 (76%), Gaps = 5/193 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL T+AVGF KT FIL+ATF LD+ GRR LLL S GGM+  +  L ++LT+I HSD 
Sbjct  330  DHKLLATMAVGFSKTTFILVATFLLDKIGRRPLLLISSGGMVVILATLGLSLTVIGHSDK  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K  WAV L I MVL+ VA FSIGMGPITWVYS+EIFPLRLRA G S+GVA NRV SGV+S
Sbjct  390  KQTWAVGLCITMVLSSVAVFSIGMGPITWVYSTEIFPLRLRAQGASLGVAVNRVMSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLYKAITIGGAFF+Y G+A+VAF FFFT +PETRGKTLEEME LFG    WR    
Sbjct  450  MSFISLYKAITIGGAFFLYAGVALVAFFFFFTFLPETRGKTLEEMEGLFGKLVGWRE---  506

Query  267  EIEAKKQKMTTNQ  229
              EAKK K   N+
Sbjct  507  --EAKKMKRKRNE  517



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 158/202 (78%), Gaps = 8/202 (4%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            ++KLL TVAVGFVKT FIL+ATF LD+ GRR LLLSSV GMIAS+  LAI+LT+ID S  
Sbjct  329  NEKLLATVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHK  388

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSM----GVAANRVTS  460
            KV WAV L+I+ VL+YVAFFSIGMGPIT VYSSEI PL+LRA G S+    GV  NRVTS
Sbjct  389  KVIWAVGLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVGVMVNRVTS  448

Query  459  GVVSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWR  280
            GVVSMTFLSL KAITIGG+FF+Y  IA VA++FF+T +PET+GKTLEEM  LFG  F+W 
Sbjct  449  GVVSMTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRW-  506

Query  279  STLREIEAKKQKMTTNQLQMSS  214
              LR+ + +K++   N++   S
Sbjct  507  --LRDSKREKRRNKANEINGDS  526



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
             + LLCTV VG  KT+F L+ATF LDR GRR LLL+S+ GM+ S++ L  +LTI+D H  
Sbjct  285  DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEG  344

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L +  VLA+V FFS G+GPI WVYSSEIFPLRLRA GC MGVA NRV SG++
Sbjct  345  ARMTWAVVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGIL  404

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF+Y  I  V +IFFFT++PET+G+TLE+ME LFG F KWR   
Sbjct  405  SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  270  REIEAKKQ  247
            + +E K+Q
Sbjct  465  KLLEKKRQ  472



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
             + LLCTV VG  KT+F L+ATF LDR GRR LLL+S+ GM+ S++ L  +LTI+D H  
Sbjct  285  DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEG  344

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L +  VLA+V FFS G+GPI WVYSSEIFPLRLRA GC MGVA NRV SG++
Sbjct  345  ARMTWAVVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGIL  404

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF+Y  I  V +IFFFT++PET+G+TLE+ME LFG F KWR   
Sbjct  405  SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  270  REIEAKKQ  247
            + +E K+Q
Sbjct  465  KLLEKKRQ  472



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 152/200 (76%), Gaps = 7/200 (4%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            ++ L  T AVG  KTLFIL+ATF LDR GRR LLLSS GGMI S++ L   LT++  H D
Sbjct  316  NQLLGTTCAVGVTKTLFILVATFFLDRIGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPD  375

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+PWA+ LSIA  LAYVAFFSIG+GPITWVYSSEIFPL++RA GC++GVA+NRVTSGV+
Sbjct  376  AKIPWAIGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCALGVASNRVTSGVI  435

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTFLSL  AITIGG+FF+Y GIA +A++FF+T +PETRG+TLEEM  LFG      +T 
Sbjct  436  SMTFLSLSNAITIGGSFFLYAGIAALAWVFFYTYLPETRGRTLEEMSKLFG------ATD  489

Query  270  REIEAKKQKMTTNQLQMSST  211
               EA        +++M++T
Sbjct  490  ARPEADDTAKEKQKVEMAAT  509



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
             + LLCTV VG  KT+F L+ATF LDR GRR LLL+S+ GM+ S++ L  +LTI+D H  
Sbjct  285  DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEG  344

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L +  VLA+V FFS G+GPI WVYSSEIFPLRLRA GC MGVA NRV SG++
Sbjct  345  ARMTWAVVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGIL  404

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF+Y  I  V +IFFFT++PET+G+TLE+ME LFG F KWR   
Sbjct  405  SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  270  REIEAKKQ  247
            + +E K+Q
Sbjct  465  KLLEKKRQ  472



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 157/204 (77%), Gaps = 10/204 (5%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
             KLL TVAVGFVKT+F+L+ATF LDR GRR LLL+SVGG+I S+L LAI+LTIID+S   
Sbjct  320  NKLLATVAVGFVKTMFVLVATFLLDRVGRRVLLLTSVGGLIISLLTLAISLTIIDNSSAT  379

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA++LSIA VL+Y A FSIG GPITWVYSSEIFPLRLRA G S+G   NRVTSGV+SM
Sbjct  380  LTWAISLSIAAVLSYAATFSIGSGPITWVYSSEIFPLRLRAQGVSIGAVVNRVTSGVISM  439

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWR----S  277
            TFLSL  AITIGGAFF++ GIA+VA+IF +T++PET+GKTLEE+E  FG F  WR    S
Sbjct  440  TFLSLSNAITIGGAFFLFAGIAIVAWIFHYTMLPETQGKTLEEIEGSFGNF--WRKPKAS  497

Query  276  TLREIEAKKQKMTTNQLQMSSTYT  205
               E    K +++TN      TYT
Sbjct  498  ATAEGANGKIQLSTND----KTYT  517



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGF KT+F L+A   LDR GRR LLL+SV GMIAS+L L  +LTI+DH   K+ 
Sbjct  323  LLATVAVGFSKTIFTLVAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHETEKMM  382

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA  L + MVLAYV FFSIGMGPI WVYSSEIFPL+LRA GCSMG A NR+ SGV+SM+F
Sbjct  383  WASVLCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLSMSF  442

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            +SLYKAIT+GG FF+Y GIA V ++FF+T++PET+G+TLE+ME LFG F++WR     + 
Sbjct  443  ISLYKAITMGGTFFLYAGIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLR  502

Query  258  AKK  250
             K+
Sbjct  503  NKR  505



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ LLCTV VG  KT+F  +ATF LDR GRR L+L+S+ GM+AS++ L  +LTI+D H  
Sbjct  285  NQLLLCTVGVGLSKTVFTFVATFFLDRVGRRPLVLTSMAGMVASLVCLGTSLTIVDQHEG  344

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L +  VLA+V FFS G+GPI WVYSSEIFPLRLRA GC MGVA NRV SGV+
Sbjct  345  ARMTWAVVLCLCCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGVL  404

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GGAFF+Y  I  V +IFFFT++PET+G+TLE+ME LFG F KWR   
Sbjct  405  SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  270  REIEAKKQ  247
            + +E ++Q
Sbjct  465  KLLEKERQ  472



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   225 bits (574),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = -2

Query  807  HKK---LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH  637
            H K   L  TVAVGF KTLFIL+ATF LDR GRR LLLSS GGMI S+  L + LTI+DH
Sbjct  325  HDKDTLLGATVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMILSLAGLGLGLTIVDH  384

Query  636  SDH-KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTS  460
              +  +PWA+ L IA +LAYVAFFSIG+GPITWVYSSEIFPLRLRA G S GV  NRVTS
Sbjct  385  HPNGHLPWALGLCIASILAYVAFFSIGLGPITWVYSSEIFPLRLRAQGASAGVVVNRVTS  444

Query  459  GVVSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGT  295
            GV++MTF+SLYKAITIGG+FF+Y G+A  A++FFFT + ETRGKTLEEME LFG 
Sbjct  445  GVITMTFISLYKAITIGGSFFLYAGVAAAAWVFFFTYLKETRGKTLEEMENLFGN  499



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ LLCTV VG  KT+F L+ATF LDR GRR LLL+S+ GM+ +++ L  +LTI+D H  
Sbjct  285  NQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTIVDQHEG  344

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L +  VLAYV FFS G+GPI WVYSSEIFPLRLRA GC MGVA NR+ SG++
Sbjct  345  VRMTWAVILCLCCVLAYVGFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGIL  404

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GG FF+Y  I  V +IFFFT++PET+G+TLE+ME LFG F KWR   
Sbjct  405  SMTFISLYKAITMGGTFFLYAAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  270  REIEAKKQ  247
            + +E KK+
Sbjct  465  KLLEKKKR  472



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 157/204 (77%), Gaps = 8/204 (4%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
            ++ L  T AVG  KTLFIL+ATF LDR GRR LLLSSVGGMI S++ LA  LT+I H  D
Sbjct  316  NQLLGTTCAVGVTKTLFILVATFLLDRVGRRPLLLSSVGGMIFSLVGLAAGLTVIGHYQD  375

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+PWA+ ++IA  +AYVAFFSIG+GPITWVYSSE+FPL +RA GC++GVA+NR+TSGV+
Sbjct  376  EKIPWAIGVAIASTMAYVAFFSIGLGPITWVYSSEVFPLHVRAMGCALGVASNRLTSGVI  435

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SL KAITIGGAFF+Y G+AV+A++FFFT +PETRG+TLE M  LFG      +T 
Sbjct  436  SMTFISLSKAITIGGAFFLYAGVAVLAWVFFFTFLPETRGRTLEAMSKLFG------ATD  489

Query  270  REIEAKKQKMTTNQ-LQMSSTYTK  202
             E++ +       Q L++++T T 
Sbjct  490  DELKPQDGATKDKQKLELAATGTN  513



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 153/210 (73%), Gaps = 10/210 (5%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K+LL TVAVG VKTLFIL+ATF LD++GRR LLL+SVGGMI ++L LA++LT+IDHS H
Sbjct  332  RKQLLATVAVGVVKTLFILVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSHH  391

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MV A VA FSIG+GPITWVYSSE+FPLRLRA G SMGVA NRV SGV+S
Sbjct  392  KITWAIALCITMVCAVVASFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVIS  451

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWR----  280
            + FL L   IT GGAFF++ GIA++A+ FF T +PETRG+TLE M  LF   F+WR    
Sbjct  452  IFFLPLSHKITTGGAFFLFGGIAIIAWFFFLTFLPETRGRTLENMHELFED-FRWRESFP  510

Query  279  ---STLREIEAKKQKMTTN--QLQMSSTYT  205
               S   E   +KQ    +  Q+Q+  T T
Sbjct  511  GNKSNNDENSTRKQSNGNDKSQVQLGETTT  540



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 146/195 (75%), Gaps = 1/195 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
            +K L  TVAVG  KTLFIL+ATF LDR GRR LLLSS GGMI S+  L + LT+IDH  D
Sbjct  319  NKLLGTTVAVGVTKTLFILVATFLLDRIGRRPLLLSSTGGMILSLAGLGLGLTLIDHHPD  378

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L IA +L YVAFFSIG+GPITWVYSSEI PLRLRA G S+ VA NRVTSGV+
Sbjct  379  GQLRWAVGLCIASILGYVAFFSIGLGPITWVYSSEILPLRLRAQGASIAVAVNRVTSGVI  438

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            +MTF+SLYKAITIGG+FF+Y GIA +A++FFF  +PETRG+TLE+ME LFGT    + T 
Sbjct  439  TMTFISLYKAITIGGSFFLYGGIAALAWVFFFACLPETRGRTLEDMEDLFGTRNDTKETT  498

Query  270  REIEAKKQKMTTNQL  226
              +E         ++
Sbjct  499  NGVEMANASQGNEKI  513



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
            ++LL TVAVGF KT+FIL+ATF LDR GRR LLL+SVGGM+ S+L L ++LT+IDHS   
Sbjct  321  EQLLATVAVGFAKTVFILVATFLLDRVGRRPLLLTSVGGMVFSLLTLGLSLTVIDHSRAV  380

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ LSI MVL+YV+ FS+G GPITWVYSSEIFPLRLRA G +MGV  NRVTSGV+SM
Sbjct  381  LKWAIGLSIGMVLSYVSTFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISM  440

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKW  283
            TFLSL   ITIGGAFF++ GIA+  +IFF+T++PET+GKTLEEME  FG F  W
Sbjct  441  TFLSLSNKITIGGAFFLFGGIAMCGWIFFYTMLPETQGKTLEEMEGSFGKFASW  494



>gb|KJB12318.1| hypothetical protein B456_002G011700 [Gossypium raimondii]
Length=525

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +++LL TVAVG  KT+FIL+ATF LD+ GRR LLL S GGM+ S+  L  +LTII+HS+ 
Sbjct  327  NEQLLTTVAVGICKTIFILVATFLLDKSGRRALLLISTGGMVVSLATLGFSLTIINHSEA  386

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MVL++ AFF+IGMGPI  +Y+SEIFPL+LRA G S+GVA NRVTSG++S
Sbjct  387  KLTWAIALCITMVLSFAAFFAIGMGPIAGIYTSEIFPLKLRAQGISLGVAVNRVTSGIIS  446

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSLY+AITIGGAFF++ GIA V ++FF   +PETRGKTLEE E LFG    WR   +
Sbjct  447  MTFLSLYQAITIGGAFFLFAGIAAVGWLFFNICLPETRGKTLEETERLFGNLVGWREVDK  506

Query  267  EIEAKKQKMTTNQLQMSS  214
            +++    K TT+  + S 
Sbjct  507  KMKEDNTKGTTHGQEGSD  524



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 152/196 (78%), Gaps = 1/196 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATF +DR GRR LLL+SVGGMI S+  L  +LTIIDH++ 
Sbjct  330  HQQLLATVAVGVVKTSFILVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEK  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ LSI  V+ YVA FSIG GPITWVY+SEIFPLRLR+ G SM V  NRVTSGV+S
Sbjct  390  KVTWALVLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFL L KA+T GGAF+++ GIA VA++FF+T +PET+G++LE+M+ LF + F+WR +  
Sbjct  450  MTFLLLSKAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKS  508

Query  267  EIEAKKQKMTTNQLQM  220
            + +  K   +  Q+++
Sbjct  509  KPKNNKNSSSNPQVEI  524



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ LLCTV VG  KT+F L+ATF LDR GRR LLL+S+ GM+ +++ L  +LT++D H  
Sbjct  327  NQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTMVDQHEG  386

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WAV L +  VLAYV FFS G+GPI WVYSSEIFPLRLRA GC MGVA NR+ SG++
Sbjct  387  VRMTWAVILCLCCVLAYVGFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGIL  446

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SLYKAIT+GG FF+Y  I  V +IFFFT++PET+G+TLE+ME LFG F KWR   
Sbjct  447  SMTFISLYKAITMGGTFFLYAAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  506

Query  270  REIEAKKQ  247
            + +E KK+
Sbjct  507  KLLEKKKR  514



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 154/203 (76%), Gaps = 2/203 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATF LDR GRR LLL+SVGGM+ S+  L  +LTIID S+ 
Sbjct  330  HQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEK  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV ++IA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  390  KVMWAVVVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M FL L K IT GGAF+++ GIA VA++FF+T +PET+G+ LE+M+ LF + F+WR +  
Sbjct  450  MAFLPLSKGITTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKN  508

Query  267  EIEAKKQKMTTN-QLQMSSTYTK  202
            + ++  +   +N ++++ S   +
Sbjct  509  KPKSNPEMTVSNPEVEIGSNKQR  531



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K+LL TVAVG VKTLFIL+ATF LD++GRR LLL+SVGGMI ++L LA++LT+IDHS H
Sbjct  332  RKQLLATVAVGVVKTLFILVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSHH  391

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L I MV A VA FSIG+GPITWVYSSE+FPLRLRA G SMGVA NRV SGV+S
Sbjct  392  KITWAIALCITMVCAVVASFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVIS  451

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            + FL L   IT GGAFF++ GIA++A+ FF T +PETRG+TLE M  LF   F+WR +  
Sbjct  452  IFFLPLSHKITTGGAFFLFGGIAIIAWFFFLTFLPETRGRTLENMHELFED-FRWRESFP  510

Query  267  EIEAKKQKMTTNQ  229
              ++   + +T +
Sbjct  511  GNKSNNDENSTRK  523



>ref|XP_004958137.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=515

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 153/203 (75%), Gaps = 4/203 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
            ++ L  T AVG  KTLFIL+ATF LD+ GRR LLLSSVGGMI S++ LA  LT+I H  D
Sbjct  316  NQVLGTTCAVGVTKTLFILVATFLLDKVGRRPLLLSSVGGMIFSLVGLATGLTVIGHYPD  375

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+PWA+ +SIA  +AYVAFFSIG+GPITWVYSSEIFPL++RA GC++GVA NRVTSGV+
Sbjct  376  AKIPWAIAVSIASTMAYVAFFSIGLGPITWVYSSEIFPLQVRAMGCALGVATNRVTSGVI  435

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SL  AITIGGAFF+Y GIAV+A++FFF+ +PETRG+TLE M  LFG        L
Sbjct  436  SMTFISLSNAITIGGAFFLYGGIAVLAWVFFFSFLPETRGRTLESMSKLFGATDD-EDDL  494

Query  270  REIEAKKQKMTTNQLQMSSTYTK  202
            R  +    K    +L+M++  T 
Sbjct  495  RPQQGGDTK--DKKLEMAAATTN  515



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGF KT+F LIA   LDR GRR LLL+SV GMIAS+L L  +LTI+DH + K+ 
Sbjct  323  LLATVAVGFSKTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENEKMM  382

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA  L + MVLAYV FFSIGMGPI WVYSSEIFPL+LRA GCSMG A NR+ SGV++MTF
Sbjct  383  WASVLCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTF  442

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            ++LYKAIT+GG FF+Y  IA V ++FF+T++PET+G+TLE+ME LFG F++WR     + 
Sbjct  443  ITLYKAITMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLR  502

Query  258  AKK  250
             K+
Sbjct  503  NKR  505



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATFTLDRFGRR LLL+SVGGM+ S+  L  +LTIID ++ 
Sbjct  330  HQQLLATVAVGIVKTSFILVATFTLDRFGRRPLLLTSVGGMVLSLAALGTSLTIIDQTEK  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV LSI  V+ YVA FSIG GPITWVY+SEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  390  KVMWAVVLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMGVVVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRS  277
            + F+ L + IT GGAF+++ G+A VA+IFF+T +PETRG+TLE+M  LFG  F+WR 
Sbjct  450  IGFIPLSEGITTGGAFYLFCGVATVAWIFFYTFLPETRGRTLEDMGELFGN-FRWRD  505



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
            +K L  TVAVGF KTLFIL+ATF +DR GRR LLLSS GGMI S+  L + LT IDH  D
Sbjct  367  NKLLATTVAVGFTKTLFILVATFLVDRIGRRPLLLSSTGGMILSLAALGLGLTQIDHHPD  426

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++ WA+ L I  +LAYVAFFSIG+GP+TWVY SEI PLRLRA G S+GVA NRVTSGV+
Sbjct  427  GQLRWAIGLCIVSILAYVAFFSIGLGPVTWVYCSEILPLRLRAQGASIGVAVNRVTSGVI  486

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGT  295
            +MTF+SLYKAITIGG+FF+Y GIA+ A++FFFT +PETRG+TLE+ME LFGT
Sbjct  487  TMTFISLYKAITIGGSFFLYGGIALAAWVFFFTYLPETRGRTLEDMEELFGT  538



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATF LDR GRR LLL+SVGGM+ S+  L  +LTIID S+ 
Sbjct  330  HQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEK  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV ++IA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  390  KVMWAVVVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            ++FL + KA+T GGAF+++ GIA VA++FF+T +PET+G+ LE+M+ LF + F+WR +  
Sbjct  450  ISFLPMSKAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKS  508

Query  267  EIEAKKQKMTTN  232
            + +   +K   N
Sbjct  509  KPKGNPEKTVPN  520



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATF +DR GRR LLL+SVGGMI S+  L  +LTIIDH++ 
Sbjct  330  HQQLLATVAVGIVKTSFILVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEK  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ LSI  V+ YVA FSIG GPITWVY+SEIFPLRLR+ G SM V  NRVTSGV+S
Sbjct  390  KVTWALVLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVIS  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFL L +A+T GGAF+++ GIA VA++FF+T +PET+G++LE+M+ LF + F+WR +  
Sbjct  450  MTFLLLSEAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKS  508

Query  267  EIEAKKQKMTTNQLQMSST  211
            + +  K   +  Q+++   
Sbjct  509  KPKNNKNSSSNPQVEIGPN  527



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGF KT+F LIA   LDR GRR LLL+SV GMIAS+L L  +LTI+DH + K+ 
Sbjct  323  LLATVAVGFSKTVFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENEKMM  382

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA  + + MVLAYV FFSIGMGPI WVYSSEIFPL+LRA GCSMG A NR+ SGV++MTF
Sbjct  383  WATVVCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTF  442

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            ++LYKAIT+GG FF+Y  IA V ++FF+T++PET+G+TLE+ME LFG F++WR     + 
Sbjct  443  ITLYKAITMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLR  502

Query  258  AKK  250
             K+
Sbjct  503  NKR  505



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   223 bits (567),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATF LDR GRR LLL+SVGGM+ S+ +L  +LT+ID SD 
Sbjct  336  HEQLLATVAVGIVKTSFILVATFLLDRVGRRPLLLTSVGGMVISLAVLGTSLTVIDQSDK  395

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV LSIA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  396  KVMWAVVLSIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  455

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRS  277
            MTFL + K +T GGAF+++ GIA VA++FF+T +PET+G+ LE+M+ LF + F+WR 
Sbjct  456  MTFLPMSKGMTTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRD  511



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 150/204 (74%), Gaps = 3/204 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L  T AVG  KT+FIL+ATFTLDRFGRR LLL+S GGM+ S++ L   LT+I H   
Sbjct  327  NKLLGTTCAVGVTKTVFILVATFTLDRFGRRPLLLTSTGGMVVSLVGLGFGLTVIGHHPE  386

Query  627  K--VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGV  454
               +PWA+ + IA +L  VAFFSIG+GPITWVYSSEIFPL LRA GC++GV  NRVTSGV
Sbjct  387  GTTIPWAIGVCIASILGVVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGVNRVTSGV  446

Query  453  VSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            +SMTFLSL K ITIGG+FF+Y G+A +A++FFFT +PETRG+TLE+M  LFG        
Sbjct  447  ISMTFLSLSKGITIGGSFFLYAGVATLAWVFFFTYLPETRGRTLEQMGDLFG-IPNMAGD  505

Query  273  LREIEAKKQKMTTNQLQMSSTYTK  202
              +   +K+K T + ++MSST T 
Sbjct  506  SDQQSPEKEKTTLSNVEMSSTATS  529



>ref|XP_004148312.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGG-MiasmlllaialtiIDHSDH  628
            +KLL TVAVGF KT+FIL+ATF LDR GRR LLL+SV G M++ + L      I  H D 
Sbjct  318  EKLLATVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHEDV  377

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L IAMVL  VAFFSIGMGPI WVYSSEIFPL+LRA G S+GV  NRVTSGV++
Sbjct  378  KLTWAVGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVIT  437

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGGAFF+Y GIA ++ +FF+ + PET+GKTLE+ME LFG    W+ +  
Sbjct  438  MTFLSLTKAITIGGAFFLYAGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLL-WKFSKH  496

Query  267  EIEAKKQKMTTNQLQMSST  211
                K       QLQ+ + 
Sbjct  497  RHFHKNDVGDVAQLQLHTN  515



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 1/187 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSDH  628
             KLL T+AVG  KT FILI TF +DRFGRR LLL+S  G+  SM  L  +LTIID + D 
Sbjct  337  DKLLATIAVGVSKTFFILITTFFVDRFGRRPLLLTSCAGVALSMFALGTSLTIIDRNPDG  396

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             +   +  ++ + +A V FFS+G+GPI WVYSSEIFPL+LRA GCSMGVA NR  SGV+ 
Sbjct  397  NIKGLLIFAVILTMAIVGFFSMGLGPIAWVYSSEIFPLKLRAQGCSMGVAMNRFMSGVIL  456

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLYKAITIGGAFF++ GI  VAFIFF+TL PET+G+TLEEME LFGTFF WR+ ++
Sbjct  457  MSFISLYKAITIGGAFFLFGGITTVAFIFFYTLFPETQGRTLEEMEELFGTFFSWRTRMK  516

Query  267  EIEAKKQ  247
            E++AKK+
Sbjct  517  ELDAKKK  523



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 143/183 (78%), Gaps = 0/183 (0%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGF KT+F LIA   LDR GRR LLL+SV GMIAS+L L  +LTI+DH   K+ 
Sbjct  323  LLATVAVGFSKTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHEKEKMM  382

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA  + + MVLAYV FFSIGMGPI WVYSSEIFPL+LRA GCSMG A NR+ SGV++MTF
Sbjct  383  WASVVCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTF  442

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            ++LYKAIT+GG FF+Y  IA V ++FF+T++PET+G+TLE+ME LFG F++WR     + 
Sbjct  443  ITLYKAITMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYALLR  502

Query  258  AKK  250
             K+
Sbjct  503  NKR  505



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 150/196 (77%), Gaps = 6/196 (3%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
            ++LL TVAVGF KT+FIL+ATF LDR GRR LLL+SVGGM+ S+L LA++LT+I+ S  +
Sbjct  322  EQLLATVAVGFAKTVFILVATFLLDRVGRRPLLLTSVGGMVFSLLTLAVSLTVIERSRAE  381

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
            + WA+ LSIA VL+YV+ FS+G GPITWVYSSEIFPLRLRA G +MGV  NRVTSGV+SM
Sbjct  382  LKWAIGLSIATVLSYVSTFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISM  441

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TFLSL   ITIGGAFF++ GIA+  +IFFFT++PET+GKTLEE E  FG F  W      
Sbjct  442  TFLSLSNKITIGGAFFIFGGIAMCGWIFFFTMLPETQGKTLEETEECFGKFGSWS-----  496

Query  264  IEAKKQKMTTNQLQMS  217
              +K  K T N  ++ 
Sbjct  497  -HSKGNKDTHNSAEIE  511



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ L  T AVG  KT+FIL+ATF LDR GRR LLLSS GGMI S++ LA  LT++  H D
Sbjct  316  NRLLGTTCAVGVTKTVFILVATFLLDRVGRRPLLLSSTGGMIVSLVGLAAGLTVVSRHPD  375

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++PWA+ L I  +LAYVAFFSIG+GPITWVYSSEIFPL +RA GCS+GVAANR+TSGV+
Sbjct  376  EQIPWAIALCILCILAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAANRLTSGVI  435

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGT--FFKWRS  277
            SMTF+SL KAITIGGAFF++ GIA +A++FFFT +PETRG+TLE+M  LFG     K + 
Sbjct  436  SMTFISLSKAITIGGAFFLFAGIASLAWVFFFTYLPETRGRTLEDMSALFGNTATHKQQG  495

Query  276  TLREIEAKKQKM  241
            +    + K++K+
Sbjct  496  SNGADDGKEKKV  507



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
            ++LL TVAVG  KT+FIL+ATF LDR GRR LLLSSVGGM+ S+L LA++LT++DHS  +
Sbjct  324  EQLLATVAVGLAKTVFILVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSRVR  383

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
              WAV LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G S GV  NRVTSG++SM
Sbjct  384  QMWAVGLSIASVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISM  443

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTF  292
            TFLSL   I+IGGAFF++ GIA   +IFF+TL+PET+GKTLEEME  FG F
Sbjct  444  TFLSLSDKISIGGAFFLFGGIAACGWIFFYTLLPETQGKTLEEMEGTFGKF  494



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TV VGFVKT+FIL+ATF LDR GRR LLLSS GGM+ S+L LA++LT+I  S  K 
Sbjct  321  KLLATVGVGFVKTMFILVATFMLDRLGRRPLLLSSFGGMLLSLLTLAVSLTVIHESKKKP  380

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             W + LS+ MVL+YVA FSIG GP+TWVYSSEIFPLRLRA G ++GV  NR TSGV+S+T
Sbjct  381  IWVIGLSMVMVLSYVASFSIGAGPVTWVYSSEIFPLRLRAQGMAVGVVVNRTTSGVLSIT  440

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSL KAITIGGAFF+Y+ IA   ++F +T++PETRGKTLEEM+T FG F+   +T + +
Sbjct  441  FLSLSKAITIGGAFFLYSAIAAFGWLFIYTVLPETRGKTLEEMDTSFGKFWVKSTTTKPV  500

Query  261  EAKKQKMTTNQLQMSSTYTK  202
              +  ++   QLQ  + + +
Sbjct  501  NNRHAQVP--QLQQGTIHVQ  518



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGG-MiasmlllaialtiIDHSDH  628
            +KLL TVAVGF KT+FIL+ATF LDR GRR LLL+SV G M++ + L      I  + + 
Sbjct  318  EKLLATVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGFGLTVIQQNEEV  377

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L IAMVL  VAFFSIGMGPI WVYSSEIFPL+LRA G S+GV  NRVTSGV++
Sbjct  378  KLRWAVGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVIT  437

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGGAFF+Y GIA ++++FF+ + PET+GKTLE+ME LFG+   W+ +  
Sbjct  438  MTFLSLTKAITIGGAFFLYAGIAAISWLFFYVVFPETQGKTLEDMEGLFGSLL-WKFSKD  496

Query  267  EIEAKKQKMTTNQLQMSST  211
                K     T QLQ+ + 
Sbjct  497  GKIDKNDVGVTRQLQLHTN  515



>ref|XP_010908358.1| PREDICTED: probable polyol transporter 6 [Elaeis guineensis]
Length=535

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 160/221 (72%), Gaps = 10/221 (5%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K LL T++VG  KT FILIATF LDR GRR LLL+S+GGM+ S+  L + LT+++H++ 
Sbjct  273  NKLLLTTMSVGLTKTCFILIATFLLDRVGRRPLLLTSLGGMVVSLSGLGLGLTMVEHTEE  332

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WAVTLSI  VL++VAF+S+G+GPITWVYSSEIFPLRLRA G SMGVA NRV +G +S
Sbjct  333  RLVWAVTLSILAVLSFVAFYSVGLGPITWVYSSEIFPLRLRAQGASMGVAVNRVMNGTIS  392

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLY AITIGGAFFM+ GI+++A++FFF L PETRG+ LEEME +F    K     R
Sbjct  393  MTFISLYNAITIGGAFFMFGGISILAWLFFFFLCPETRGRPLEEMEEVFS---KKIIDER  449

Query  267  EIEAKKQKM-TTNQLQMSSTYTK*LPRFTFSLVKSMLSATI  148
             IE    KM  TN + M  T         F+L+ +ML   I
Sbjct  450  TIEDSISKMINTNVVVMGMTSP------LFNLLLTMLVPVI  484



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
            ++LL TVAVG  KT+FIL+ATF LDR GRR LLLSSVGGM+ S+L LA++LT++DHS  +
Sbjct  328  EQLLATVAVGLCKTVFILVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSHVR  387

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
              WAV LSI  VL+YVA FSIG GPITWVYSSEIFPLRLRA G S GV  NRVTSG++SM
Sbjct  388  KMWAVGLSIVSVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISM  447

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTF  292
            TFLSL   I+IGGAFF++ GIA   +IFF+ L+PET+GKTLEEME  FG F
Sbjct  448  TFLSLSDKISIGGAFFLFGGIAACGWIFFYALLPETQGKTLEEMEGSFGKF  498



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            H++LL TVAVG VKT FIL+ATF LDR GRR LLL+SVGGM+ S+ +L  +LT+I+ SD 
Sbjct  336  HEQLLATVAVGVVKTSFILVATFLLDRVGRRPLLLTSVGGMVLSLAVLGTSLTVINQSDK  395

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WAV LSIA V+ YVA FSIG GPITWVYSSEIFPLRLR+ G SMGV  NRVTSGV+S
Sbjct  396  KVMWAVVLSIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  455

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            MTFL + K +T GGAF+++ GIA VA++FF+T + ET+G+ LE+M+ LF + F+WR +
Sbjct  456  MTFLPMSKGMTTGGAFYLFGGIATVAWVFFYTFLRETQGRMLEDMDELF-SGFRWRDS  512



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 147/193 (76%), Gaps = 1/193 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
            + KLLCT+AVG  KT+FILI+T  LDR GRR LL++S  G++AS+  LAI LT+IDH   
Sbjct  326  NGKLLCTIAVGVTKTIFILISTCYLDRVGRRVLLIASSAGLVASLWGLAIGLTVIDHYPG  385

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ +S    L+ VA FS GMGPI WVYSSEIFPL+LRA G S+ VA NRVTSG++
Sbjct  386  QKLTWAIGISFFCTLSSVATFSSGMGPIAWVYSSEIFPLKLRAQGNSIAVAINRVTSGII  445

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTF+SLYKAITIGG+FF Y  IA   F+FF TL+PET+G++LEE E LFGTFF+WRS  
Sbjct  446  LMTFISLYKAITIGGSFFFYGAIAFAGFLFFCTLLPETKGRSLEETEELFGTFFRWRSRA  505

Query  270  REIEAKKQKMTTN  232
            RE+E++K +   N
Sbjct  506  REVESRKWENEKN  518



>emb|CAR82417.1| polyol transporter [Plantago major]
Length=348

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHS-DH  628
             KLL T+AVG  KT FILI TF +DRFGRR LLL S  G+  SM  L   LTIID + D 
Sbjct  156  DKLLATIAVGISKTFFILITTFYVDRFGRRFLLLVSCAGVALSMFALGTVLTIIDRNPDA  215

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K    + L + + +  V FFS+G+GPI WVYSSEIFPL+LRA GC +GVA NR  SGV+ 
Sbjct  216  KQTGVLVLVVLLTMVIVGFFSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVIL  275

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLYK ITIGG+FF++ GI  + +IFFFTL PETRG+TLEEME LFGTFFKWR+T++
Sbjct  276  MSFISLYKEITIGGSFFLFGGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTMK  335

Query  267  EIEAKKQKMTTN  232
            E++AKK+  T  
Sbjct  336  ELDAKKRSGTDG  347



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ L  TVAVG  KT+FIL+ATF LDR GRR LLLSS GGMI S++ LA  LT+I  H D
Sbjct  326  NRLLGTTVAVGATKTVFILVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPD  385

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ L I  ++AYVAFFSIG+GPITWVYSSEIFPL +RA GCS+GVA NR+TSGV+
Sbjct  386  EKITWAIVLCIFCIMAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVI  445

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTF+SL KA+TIGGAFF++ GIA  A++FFF  +PETRG+TLE+M +LFG     +   
Sbjct  446  SMTFISLSKAMTIGGAFFLFAGIASFAWVFFFAYLPETRGRTLEDMSSLFGNTATHKQGA  505

Query  270  REIEAKKQKMTTNQLQMSST  211
             E +    K    +++M++T
Sbjct  506  AEADDDAGK--EKKVEMAAT  523



>ref|NP_001045505.2| Os01g0966900 [Oryza sativa Japonica Group]
 dbj|BAD88259.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ14958.1| hypothetical protein OsJ_04892 [Oryza sativa Japonica Group]
 dbj|BAF07419.2| Os01g0966900 [Oryza sativa Japonica Group]
Length=479

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L  T AVG  KTLFIL+ATFTLDRFGRR LLL+S GGMIA+++ L + LT+I     
Sbjct  263  NKLLGTTCAVGVTKTLFILVATFTLDRFGRRPLLLASAGGMIATLVTLGLGLTVIGEDAT  322

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
               WA+ +SIA +LA+VAFFSIG+GPITWVYSSEIFPL LRA GC++GV  NRVTSGV+S
Sbjct  323  GGGWAIAVSIASILAFVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVIS  382

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFF----KWR  280
            MTFLSL KAITIGG+FF+Y G+A +A++FFFT +PETRG+TLE+M  LF           
Sbjct  383  MTFLSLSKAITIGGSFFLYAGVASLAWLFFFTYLPETRGRTLEQMGELFRIHNMAGDDDS  442

Query  279  STLREIEAKKQKMTTNQLQMSS  214
            +  R    ++++  TN ++M++
Sbjct  443  AATRPPSPEEEEKITNYVEMAA  464



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            +LL TVAVGFVKT+ IL+ATF LDR GRR LLL SV G+I S+L L ++LT++DHS   +
Sbjct  333  RLLATVAVGFVKTVSILVATFFLDRAGRRVLLLCSVSGLILSLLTLGLSLTVVDHSQTTL  392

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WAV LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G ++G A NRVTSGV++MT
Sbjct  393  NWAVGLSIAAVLSYVATFSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVIAMT  452

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFK  286
            FLSL KAITIGGAFF++ G+A VA+IF +TL+PETRGKTLEE+E  FG F +
Sbjct  453  FLSLQKAITIGGAFFLFAGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCR  504



>gb|AAG43998.1|AF215837_1 mannitol transporter [Apium graveolens Dulce Group]
Length=513

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
            KKLL T+AVG  KT+FILI+TF LD+ GRR L+L+S+GGM+ ++ +LA +LT+I+ S H 
Sbjct  318  KKLLATIAVGVCKTVFILISTFQLDKIGRRPLMLTSMGGMVIALFVLAGSLTVINKSHHT  377

Query  624  VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSM  445
              WA  L+I  V A+V+ FS GMGPI WVYSSE+FPLRLRA GCS+GVA NR  SG++ M
Sbjct  378  GHWAGGLAIFTVYAFVSIFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGMSGIIGM  437

Query  444  TFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            TF+S+YKA+TIGGAF ++  +A + ++F +T+ PET+G+ LEE+E LFG++F WR TL++
Sbjct  438  TFISMYKAMTIGGAFLLFAVVASIGWVFMYTMFPETQGRNLEEIELLFGSYFGWRKTLKD  497

Query  264  IEAKK  250
            ++AK+
Sbjct  498  LKAKE  502



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVGFVKT FIL+ATF +DR GRR +LLSSVGGM+ S L+L I  TII+ S+ K 
Sbjct  323  KLLATVAVGFVKTTFILVATFMMDRVGRRPMLLSSVGGMVVSFLILGIVFTIIEQSESKP  382

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ LSI MVL +VA FSIG GPITWVYS+EIFPLRLRA G + GV  NR+TSGV++MT
Sbjct  383  MWAIGLSITMVLVFVATFSIGAGPITWVYSAEIFPLRLRAQGVAAGVVVNRITSGVITMT  442

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTF-FKWRSTLRE  265
            FLSL KAIT+GG FF+Y GIA    +FF+  +PETRGKTLE+ME  FG F  K    L  
Sbjct  443  FLSLTKAITVGGTFFLYCGIAATGGLFFYIALPETRGKTLEDMEASFGNFNLKSNKGLEN  502

Query  264  IEAKKQKM  241
              AK  ++
Sbjct  503  GNAKLTQL  510



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 155/202 (77%), Gaps = 7/202 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ L  TVAVG  KT+FIL+ATF LDR GRR LLL+S GGMI S++ LA  LT++  H D
Sbjct  348  NRLLGTTVAVGATKTVFILVATFLLDRIGRRPLLLTSTGGMIVSLVGLATGLTVVSRHPD  407

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ L I  ++AYVAFFSIG+GPITWVYSSEIFPL +RA GCS+GVA NR+TSGV+
Sbjct  408  EKITWAIVLCIFCIMAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVI  467

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFF--KWRS  277
            SMTF+SL KA+TIGGAFF++ GIA  A++FFF  +PETRG+TLE+M +LFG+    K  +
Sbjct  468  SMTFISLSKAMTIGGAFFLFAGIASFAWVFFFAYLPETRGRTLEDMSSLFGSTATRKQGA  527

Query  276  TLREIEAKKQKMTTNQLQMSST  211
            T  + +A K K    +++M++T
Sbjct  528  TEADDDAGKDK----KVEMAAT  545



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 149/192 (78%), Gaps = 6/192 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KTLFIL+ATF LDR GRR LLL+S GGMI S++ L   LT++  H D
Sbjct  311  NKLLGTTCAVGVTKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPD  370

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+PWAV L I  VLAYV+FFSIG+GPI  VY+SEIFPLR+RA G ++GVA+NRVTSGV+
Sbjct  371  AKIPWAVALCILSVLAYVSFFSIGLGPIAGVYTSEIFPLRVRALGFAVGVASNRVTSGVI  430

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTFLSL KAITIGG+FF+Y+GIA +A++FFFT +PETRG+TLEEM  LFG      + +
Sbjct  431  SMTFLSLSKAITIGGSFFLYSGIAALAWVFFFTYLPETRGRTLEEMGKLFGM---EDTDM  487

Query  270  REIE--AKKQKM  241
             EIE  A K+K+
Sbjct  488  AEIENTAAKEKV  499



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 158/205 (77%), Gaps = 5/205 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
             ++LL TVA+G VKT  IL++TF LDR GRR LLLSSVGGM+ S+L LA++LT+IDH  D
Sbjct  321  KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ LS+A  + YVA FS G+GPITWVYSSEIFPLRLRA G SMG+  NRVTSGV+
Sbjct  381  KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            +MTFLSL KAIT GGAFF++ G+A+ A++FF+T +PET+GK LEEM+ LF   F+WR + 
Sbjct  441  AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGS-  498

Query  270  REIEAKKQKMTTNQ--LQMSSTYTK  202
            +  E  + +MTT +   +M+ST  +
Sbjct  499  KTKEHMEVEMTTERSPEKMNSTVER  523



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + KLL T+ VG  KT+F+LI+TF LD+ GRR L+LSS+GGM+ ++L+L+ +L++I+HS  
Sbjct  328  NHKLLATIGVGVCKTIFVLISTFLLDKVGRRPLMLSSMGGMVIALLVLSGSLSVINHSHQ  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             VPWAV L+I  V  +V+ FS GMGPI WVYSSE+FPLRLRA GCS+GVA NR  SG++ 
Sbjct  388  TVPWAVALAIISVYGFVSVFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGVSGIIG  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+S+YKA+TIGGAFF++  +A + ++F FT+ PET+G+ LEE+E LFG++F WR TL+
Sbjct  448  MTFISMYKALTIGGAFFVFAVVAAIGWVFMFTMFPETQGRNLEEIEVLFGSYFGWRKTLK  507

Query  267  EIEAKKQKMTTN  232
            +++ K+     N
Sbjct  508  DLKKKEAAEAKN  519



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSDHKV  622
            L  TVAVGF KT+FIL+AT  LDR GRR LLL+   GMI S+  L   LT++D H + ++
Sbjct  325  LGATVAVGFTKTIFILVATVLLDRVGRRPLLLTGTAGMILSLASLGFGLTVVDRHPNERL  384

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ + IA +L YVAFFSIG+GPITWVY+SE+FPLRLRA G ++GVA NR TSGV++MT
Sbjct  385  EWAIVVCIASILIYVAFFSIGLGPITWVYTSEVFPLRLRAQGAAIGVAVNRTTSGVLTMT  444

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            F+SLYKAITIGGAFF+Y G+A++A+IFFFT +PETRGKTLEEME  FG
Sbjct  445  FISLYKAITIGGAFFLYGGVALIAWIFFFTYLPETRGKTLEEMEEFFG  492



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + +LL TVAVGFVKT+ IL+ATF LDR GRR LLL SV G+I S+L L ++LT++DHS  
Sbjct  318  NYRLLATVAVGFVKTVSILVATFFLDRAGRRVLLLCSVSGLILSLLTLGLSLTVVDHSQT  377

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             + WAV LSIA VL+YVA FSIG GPITWVYSSEIFPLRLRA G ++G A NRVTSGV++
Sbjct  378  TLNWAVGLSIAAVLSYVATFSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVIA  437

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFK  286
            MTFLSL  AITIGGAFF++ G+A VA+IF +TL+PETRGKTLEE+E  FG F +
Sbjct  438  MTFLSLQNAITIGGAFFLFAGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCR  491



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 152/201 (76%), Gaps = 3/201 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHS-D  631
            H++LL TVAVG VKT FIL+ATF LDR GRR LLL+SVGGM+ S++ L  +LTII  S +
Sbjct  329  HQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLMGLGTSLTIIGQSGE  388

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             KV WAV ++I  V+ YVA FSIG GPITWVYSSEIFPLRLR+ G S+GV  NRVTSGV+
Sbjct  389  KKVMWAVVVAITTVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSLGVVVNRVTSGVI  448

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTFL +   +T GGAF+++ GIA VA++FF+T +PET+GK LE+M+ LF + F+WR + 
Sbjct  449  SMTFLPMSDGMTTGGAFYLFGGIATVAWVFFYTFLPETQGKMLEDMDELF-SGFRWRDSK  507

Query  270  REIEAKKQKMTTN-QLQMSST  211
             + +   +K   N +++++S 
Sbjct  508  NKPKGNPEKTIPNPEVEIASN  528



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L  T AVG  KTLFIL+ATFTLDRFGRR LLL+S GGM+ S++ L   LT+I H   
Sbjct  327  NKLLGTTCAVGVTKTLFILVATFTLDRFGRRPLLLASTGGMVVSLVGLGFGLTVIGHHQE  386

Query  627  --KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGV  454
               +PWA+ + IA +L  VAFFSIG+GPITWVYSSEIFPL LRA GC++GV  NRVTSGV
Sbjct  387  GTTIPWAIGVCIASILGVVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGV  446

Query  453  VSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            +SMTFLSL K ITIGG+FF+Y GIA +A++FFFT +PETRG+TLE+M  LFG
Sbjct  447  ISMTFLSLSKGITIGGSFFLYAGIASLAWVFFFTYLPETRGRTLEQMGGLFG  498



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L  T AVG  KTLFIL+ATFTLD FGRR LLL+S GGM+ S++ L + LT+I H   
Sbjct  316  NKLLGTTCAVGATKTLFILVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPE  375

Query  627  K--VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGV  454
               +PWAV + IA +L  VAFFSIG+GPI WVYSSEIFPL LRA GC++GV  NRVTSGV
Sbjct  376  GTTIPWAVGVCIASILGVVAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGV  435

Query  453  VSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            +SMTFLSL K ITIGG+FF+Y GIA +A++FFFT + ETRG+TLE+M  LFG       +
Sbjct  436  ISMTFLSLSKGITIGGSFFLYAGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDS  495

Query  273  LREIEAKKQKMTTNQLQMSST  211
             ++ ++ +++   N ++M+ST
Sbjct  496  YQQQQSPEKE--RNNVEMAST  514



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 151/203 (74%), Gaps = 7/203 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
             ++LL TVA+G VKT  IL++TF LDR GRR LLLSSVGGM+ S+L LA++LT+IDH  D
Sbjct  321  KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ LS+A  + YVA FS G+GPITWVYSSEIFPLRLRA G SMG+  NRVTSGV+
Sbjct  381  KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            +MTFLSL KAIT GGAFF++ G+A+ A++FF+T +PET+GK LEEM+ LF   F+WR + 
Sbjct  441  AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGS-  498

Query  270  REIEAKKQKMTTNQLQMSSTYTK  202
                  K+ M     + S   TK
Sbjct  499  ----KTKEHMEVEDTRDSPRKTK  517



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSDH  628
             KLL T+AVG  KT FILI TF +DRFGRR LLL S  G+  SM  L   LTIID + D 
Sbjct  338  DKLLATIAVGISKTFFILITTFYVDRFGRRFLLLVSCAGVALSMFALGTVLTIIDRNPDA  397

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K    + L + + +  V FFS+G+GPI WVYSSEIFPL+LRA GC +GVA NR  SGV+ 
Sbjct  398  KQTGVLVLVVLLTMVIVGFFSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVIL  457

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+SLYK ITIGG+FF++ GI  + +IFFFTL PETRG+TLEEME LFGTFFKWR+T++
Sbjct  458  MSFISLYKEITIGGSFFLFGGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTMK  517

Query  267  EIEAKKQKMTTN  232
            E++AKK+  T  
Sbjct  518  ELDAKKRSGTDG  529



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L  T AVG  KTLFIL+ATFTLD FGRR LLL+S GGM+ S++ L + LT+I H   
Sbjct  328  NKLLGTTCAVGATKTLFILVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPE  387

Query  627  K--VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGV  454
               +PWAV + IA +L  VAFFSIG+GPI WVYSSEIFPL LRA GC++GV  NRVTSGV
Sbjct  388  GTTIPWAVGVCIASILGVVAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGV  447

Query  453  VSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            +SMTFLSL K ITIGG+FF+Y GIA +A++FFFT + ETRG+TLE+M  LFG       +
Sbjct  448  ISMTFLSLSKGITIGGSFFLYAGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDS  507

Query  273  LREIEAKKQKMTTNQLQMSST  211
             ++ ++ +++   N ++M+ST
Sbjct  508  YQQQQSPEKE--RNNVEMAST  526



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ L  TVAVG  KT+FIL+ATF LDR GRR LLLSS GGMI S++ LA  LT+I  H D
Sbjct  317  NRLLGTTVAVGATKTVFILVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPD  376

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ L I  ++AYVAFFSIG+GP+TWVYSSEIFPL +RA GCS+GVA NR+TSGV+
Sbjct  377  EKITWAIVLCIFCIMAYVAFFSIGLGPVTWVYSSEIFPLHVRALGCSLGVAVNRLTSGVI  436

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTF+SL KA+TIGGAFF++ GIA  A++FFF  +PETRG+TLE+M +LFG
Sbjct  437  SMTFISLSKAMTIGGAFFLFAGIASFAWVFFFAYLPETRGRTLEDMSSLFG  487



>emb|CDP02097.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            + +LL T++VG  KT+ IL++TF LD+ GRR LLL+S GG + S + LA+ LT+ID H +
Sbjct  312  NDRLLATISVGVTKTICILVSTFWLDKIGRRALLLTSSGGFVCSTMGLAVGLTVIDRHPN  371

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+       L  V  FS+GMGP+ WVYSSEIFPLRLRA G +M   ANR++SG++
Sbjct  372  EKITWAIAFCFLCTLGSVGTFSMGMGPVAWVYSSEIFPLRLRALGGAMAAGANRLSSGII  431

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL KAITIGGAFF++ GIA++AFIFFFTL+PETRG+ LEEME LFGTFFKWRST 
Sbjct  432  LMTFLSLSKAITIGGAFFLFGGIALLAFIFFFTLLPETRGRGLEEMEELFGTFFKWRSTA  491

Query  270  REIEAKKQK  244
            +E+E +K+K
Sbjct  492  KELEERKRK  500



>ref|XP_008795662.1| PREDICTED: probable polyol transporter 6 [Phoenix dactylifera]
Length=480

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            +K L+ T+ VG  KT FILIATF LDR GRR LLL+S+GGMI S+  L + LT+++H++ 
Sbjct  285  NKLLVATMGVGLTKTFFILIATFLLDRVGRRPLLLTSLGGMIVSLSGLGLGLTMVEHTEE  344

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA++LSI  V  +VA FSIG+GPITWVYSSEIFPL+LRA G S+GVA NRV +G +S
Sbjct  345  RLVWAISLSILTVFFFVASFSIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRVMNGTIS  404

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+SLYKAITIGGAFFM+ GI+++A++FFF L PET+G+ LEEME +F    KW  + R
Sbjct  405  MTFISLYKAITIGGAFFMFAGISILAWMFFFFLCPETKGRPLEEMEEVFSK--KWLYS-R  461

Query  267  EIEAKKQKMTTNQLQMSS  214
             +  ++ +M   + +++S
Sbjct  462  PVNRERFEMGKVEAELTS  479



>ref|XP_007131748.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
 gb|ESW03742.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
Length=495

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 143/196 (73%), Gaps = 6/196 (3%)
 Frame = -2

Query  798  LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVP  619
            LL TVAVGFVKT  +L+ATF LDR GRR LLL SV G+I S++ L + LT++ HS   + 
Sbjct  298  LLATVAVGFVKTASVLVATFLLDRAGRRVLLLCSVSGLILSLVTLGVCLTVVGHSGSTLT  357

Query  618  WAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTF  439
            WA+ LSIA VLAY + FSIG GPITWVYSSEIFPLRLRA G ++G   NRVTSGV+SMTF
Sbjct  358  WAIGLSIAAVLAYASTFSIGSGPITWVYSSEIFPLRLRAQGVAIGAVVNRVTSGVISMTF  417

Query  438  LSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREIE  259
            LSL KAIT GGAFF++ G+AV A+IF +T++PETRGKTLEE+E  FG F  WR+     +
Sbjct  418  LSLCKAITTGGAFFLFAGVAVAAWIFHYTMLPETRGKTLEEIEGSFGNF--WRNP----K  471

Query  258  AKKQKMTTNQLQMSST  211
             K         Q+ ST
Sbjct  472  PKGLHCANGDAQLRST  487



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 141/175 (81%), Gaps = 4/175 (2%)
 Frame = -2

Query  807  HKK---LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-  640
            H K   L  TVAVGF KTLFIL+ATF LDR GRR LLLSS GGMI S+  L + LT++D 
Sbjct  325  HDKDALLGTTVAVGFTKTLFILVATFQLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDR  384

Query  639  HSDHKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTS  460
            H D ++PWAV L IA +LAYVAFFSIG+GPIT VY SEIFPLRLRA G S+GV  NRVTS
Sbjct  385  HPDGQLPWAVGLCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTS  444

Query  459  GVVSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGT  295
            GV++MTF+SLYKAITIGG+FF+Y GIA VA++FFFT + ETRGKTLEEME LFG 
Sbjct  445  GVITMTFISLYKAITIGGSFFLYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|XP_010095276.1| putative polyol transporter 6 [Morus notabilis]
 gb|EXB59122.1| putative polyol transporter 6 [Morus notabilis]
Length=501

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL TV VG  KT FIL+ATF LDR GR++LLL+S GGMI ++  L   LT+++HS  
Sbjct  310  DKLLLATVGVGVTKTTFILVATFWLDRIGRKRLLLTSTGGMIVALTGLGFCLTMVEHSKE  369

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA+ LSIA V  +VAFFSIG+GPITWVYSSEIFPLRLRA G S+GVA NRV +  VS
Sbjct  370  ELVWALGLSIASVYVFVAFFSIGLGPITWVYSSEIFPLRLRAQGMSIGVAVNRVMNATVS  429

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTF+S+YKAITIGG FFM+ GIAV+A+ FF+  +PET+G+TLEEMETLF    K +S   
Sbjct  430  MTFISIYKAITIGGTFFMFAGIAVLAWGFFYFFLPETKGRTLEEMETLFSRNGK-KSGNV  488

Query  267  EIEAKKQK  244
            +IE +++ 
Sbjct  489  DIEIQRRN  496



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 144/196 (73%), Gaps = 8/196 (4%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVAVG VK +FIL+ATF LDR GRR L+L+SV G   S+ +L  +LTII++SD 
Sbjct  330  DHKLLATVAVGIVKAIFILVATFLLDRVGRRPLILTSVAGQTISLAILGFSLTIINNSDV  389

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ L IA VL+ VAFFSIG+GP++ VY+SEIFPLRLRA G S+ V  NR+ SGVV+
Sbjct  390  KVKWAIVLCIATVLSNVAFFSIGLGPMSPVYTSEIFPLRLRALGVSVAVTLNRIVSGVVA  449

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSLY A+TIGGAFF+Y GIA V ++FFF + PETRG  LE++E LFG  F WR    
Sbjct  450  MTFLSLYHALTIGGAFFLYAGIAAVGWLFFFVVFPETRGHNLEDIEGLFGN-FSWR----  504

Query  267  EIEAKKQKMTTNQLQM  220
                KK K T  ++++
Sbjct  505  ---LKKNKNTAMEVEL  517



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
             ++LL TVA+G VKT  IL++TF LDR GRR LLLSSVGGM+ S+L LA++LT+IDH  D
Sbjct  321  KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ LS+A  + YVA FS G+GPITWVYSSEIFPLRLRA G SMG+  NRVTSGV+
Sbjct  381  KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            +MTFLSL KAIT GGAFF++ G+A+ A++FF+T +PET+GK LEEM+ LF   F+WR +
Sbjct  441  AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGS  498



>ref|XP_008670519.1| PREDICTED: putative polyol transporter 1 [Zea mays]
 tpg|DAA41238.1| TPA: hypothetical protein ZEAMMB73_503211 [Zea mays]
Length=520

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 146/202 (72%), Gaps = 6/202 (3%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KT FIL+ATF LDR GRR LLL+S GGMI S+L L   LT+   H D
Sbjct  319  NKLLGVTCAVGVTKTFFILVATFLLDRAGRRPLLLASTGGMIVSLLSLGAGLTVAGHHPD  378

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             KV WAV L IA  LAY+AFFSIG+GPIT VY+SEIFPLR+RA G ++GVA+NRVTS V+
Sbjct  379  GKVAWAVALCIASTLAYIAFFSIGLGPITGVYTSEIFPLRVRALGFAVGVASNRVTSAVI  438

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTFLSL K ITIGG+FF+Y GIA VA++FFFT +PETRG+TLEEM  LFG        +
Sbjct  439  SMTFLSLSKGITIGGSFFLYAGIAAVAWVFFFTCLPETRGRTLEEMGKLFG--MPDTDDM  496

Query  270  REIE---AKKQKMTTNQLQMSS  214
             E E   A K+K+   ++ M S
Sbjct  497  AEAEDATAGKEKVAEVEMYMPS  518



>ref|XP_004148314.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44327.1| hypothetical protein Csa_7G253820 [Cucumis sativus]
Length=519

 Score =   209 bits (532),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 143/190 (75%), Gaps = 8/190 (4%)
 Frame = -2

Query  801  KLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKV  622
            KLL TVAVG VKT FIL+ATF LDR GRR  +L+SV G   S+  L  +LTII++S  KV
Sbjct  331  KLLATVAVGIVKTAFILVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINNSHEKV  390

Query  621  PWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMT  442
             WA+ L IAMVL+ V+FFSIG+GP+  VY+SEIFPLRLRA G S+ + ANR+TSGVV+MT
Sbjct  391  KWAIVLCIAMVLSNVSFFSIGLGPMASVYTSEIFPLRLRALGVSVAIMANRITSGVVTMT  450

Query  441  FLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLREI  262
            FLSLY A+TIGGAFF++ GI+ V+++FF+ + PETRG+ LE++E LFG  F WR      
Sbjct  451  FLSLYHAVTIGGAFFLFAGISAVSWLFFYVVFPETRGQNLEDVEKLFGN-FPWR------  503

Query  261  EAKKQKMTTN  232
              KK K TTN
Sbjct  504  -MKKSKDTTN  512



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
             ++LL TVA+G VKT  IL++TF LDR GRR LLLSSVGGM+ S+L LA++LT+IDH  D
Sbjct  321  KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+ WA+ LS+A  + YVA FS G+GPITWVYSSEIFPLRLRA G SMG+  NRVTSGV+
Sbjct  381  KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRST  274
            +MTFLSL KAIT GGAFF++ G+A+ A++FF+T +PET+GK LEEM+ LF   F+WR +
Sbjct  441  AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGS  498



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 146/193 (76%), Gaps = 4/193 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
            H++LL TVAVG VKT FIL+ATF LDR GRR LLL+SVGGM+ S+  L  +LTIIDH ++
Sbjct  330  HQQLLATVAVGIVKTSFILVATFLLDRVGRRPLLLTSVGGMVLSLATLGTSLTIIDHQTE  389

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K  W + LSI+MV+ YVA FSIG GPITWVYSSEIFPLRLR+ G S  V  NRVTSGV+
Sbjct  390  KKAMWVLVLSISMVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSFAVVVNRVTSGVI  449

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SM FL L + IT GGAF+++ GIA VA+ FF+T +PET+G+ LE+M+ LF + F+WR + 
Sbjct  450  SMGFLPLTEGITTGGAFYLFCGIATVAWFFFYTFLPETQGRMLEDMDELF-SGFRWRDS-  507

Query  270  REIEAKKQKMTTN  232
             + + K +  ++N
Sbjct  508  -KSKPKNRSSSSN  519



>ref|XP_008795607.1| PREDICTED: polyol transporter 5-like isoform X2 [Phoenix dactylifera]
Length=487

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = -2

Query  807  HKK---LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-  640
            H K   L  TVAVGF KTLFIL+ATF LDR GRR LLLSS GGMI S+  L + LT++D 
Sbjct  290  HDKDALLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDR  349

Query  639  HSDHKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTS  460
            H D ++PWAV   IA +LAYVAFFSIG+GPIT VY SEIFPLRLRA G S+GV  NRVTS
Sbjct  350  HPDGQLPWAVGFCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTS  409

Query  459  GVVSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGT  295
            GV++MTF+SLYKAITIGG+FF+Y GIA VA++FFFT + ETRGKTLEEME LFG 
Sbjct  410  GVITMTFISLYKAITIGGSFFLYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  464



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = -2

Query  807  HKK---LLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-  640
            H K   L  TVAVGF KTLFIL+ATF LDR GRR LLLSS GGMI S+  L + LT++D 
Sbjct  325  HDKDALLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDR  384

Query  639  HSDHKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTS  460
            H D ++PWAV   IA +LAYVAFFSIG+GPIT VY SEIFPLRLRA G S+GV  NRVTS
Sbjct  385  HPDGQLPWAVGFCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTS  444

Query  459  GVVSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGT  295
            GV++MTF+SLYKAITIGG+FF+Y GIA VA++FFFT + ETRGKTLEEME LFG 
Sbjct  445  GVITMTFISLYKAITIGGSFFLYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 144/196 (73%), Gaps = 8/196 (4%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL TVAVG VKT FIL+ATF LDR GRR  +L+SV G   S+  L  +LTII+ S  
Sbjct  328  DHKLLATVAVGIVKTAFILVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINRSQE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ L IAMVL+ V+FFSIG+GP+  VY+SEIFPLRLRA G S+ + ANR+TSGVV+
Sbjct  388  KVKWAIVLCIAMVLSNVSFFSIGLGPMAAVYTSEIFPLRLRALGVSVAIMANRITSGVVT  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSLY A+TIGGAFF++ GI+ V+++FF+ + PETRG+ LE++E LFG  F WR    
Sbjct  448  MTFLSLYHALTIGGAFFLFAGISAVSWLFFYVVFPETRGQNLEDVERLFGN-FPWRK---  503

Query  267  EIEAKKQKMTTNQLQM  220
                KK K T  ++++
Sbjct  504  ----KKNKDTNIEVEL  515



>ref|XP_004958138.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=509

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KTLFIL+ATF LDR GRR LLL+S GGM+ S++ L   LT++  H D
Sbjct  315  NKLLGTTCAVGVTKTLFILVATFLLDRAGRRPLLLTSTGGMVISLIGLGTGLTVVGHHPD  374

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+PWAV L I  +LAYV+FFSIG+GP+  VY+SEIFPLR+RA G ++GVA+NRVTSGV+
Sbjct  375  AKIPWAVALCILSILAYVSFFSIGLGPMASVYTSEIFPLRVRALGFAVGVASNRVTSGVI  434

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTFLSL KAITIGG+FF+Y+GIAV+A++FFFT + ETRG+TLEEM  LFG
Sbjct  435  SMTFLSLSKAITIGGSFFLYSGIAVLAWVFFFTYLRETRGRTLEEMGKLFG  485



>gb|ACN26310.1| unknown [Zea mays]
Length=483

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KT FIL+ATF LDR GRR LLL S GGMI S++ L   LT+   H D
Sbjct  287  NKLLGVTCAVGVTKTFFILVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPD  346

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             KV WAV L IA  L+Y+AFFSIG+GPIT VY+SEIFPL++RA G ++GVA+NRVTS V+
Sbjct  347  TKVAWAVALCIASTLSYIAFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVI  406

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTFLSL KAITIGG+FF+Y+GIA VA++FFFT +PETRG+TLEEM  LFG
Sbjct  407  SMTFLSLSKAITIGGSFFLYSGIAAVAWVFFFTCLPETRGRTLEEMGKLFG  457



>ref|XP_011088761.1| PREDICTED: putative polyol transporter 1 [Sesamum indicum]
Length=336

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  642  DHSDHKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVT  463
             +SDH++ WAV L +  +L YV+ F+IGMGP+TWVYSSEIFPLR+RA GC + VA NRVT
Sbjct  187  QNSDHRLIWAVALCVCSILCYVSIFAIGMGPLTWVYSSEIFPLRVRAQGCGLAVAVNRVT  246

Query  462  SGVVSMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKW  283
            S V++MTF+SLYKAITIGGAFF+Y G A +A++FF+TL PETRGKTLEE+E LFGTFFKW
Sbjct  247  SAVLTMTFISLYKAITIGGAFFLYAGFAALAWLFFYTLFPETRGKTLEEIEALFGTFFKW  306

Query  282  RSTLREIEAKKQKMTTNQLQMSST  211
            RST+R +  K   + + Q+Q  +T
Sbjct  307  RSTMRALNQKSGDV-SGQVQTGNT  329



>ref|NP_001132062.1| proton myo-inositol cotransporter [Zea mays]
 gb|ACF80747.1| unknown [Zea mays]
 tpg|DAA63327.1| TPA: proton myo-inositol cotransporter [Zea mays]
Length=513

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KT FIL+ATF LDR GRR LLL S GGMI S++ L   LT+   H D
Sbjct  317  NKLLGVTCAVGVTKTFFILVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPD  376

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             KV WAV L IA  L+Y+AFFSIG+GPIT VY+SEIFPL++RA G ++GVA+NRVTS V+
Sbjct  377  TKVAWAVALCIASTLSYIAFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVI  436

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTFLSL KAITIGG+FF+Y+GIA VA++FFFT +PETRG+TLEEM  LFG
Sbjct  437  SMTFLSLSKAITIGGSFFLYSGIAAVAWVFFFTCLPETRGRTLEEMGKLFG  487



>ref|NP_001168177.1| uncharacterized protein LOC100381931 [Zea mays]
 gb|ACN27335.1| unknown [Zea mays]
 tpg|DAA63326.1| TPA: hypothetical protein ZEAMMB73_286001 [Zea mays]
Length=510

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 146/195 (75%), Gaps = 3/195 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KTLFIL+ATF LDR GRR LLL+S GGM+ S++ L  ALT++  H D
Sbjct  316  NKLLGVTCAVGVTKTLFILVATFLLDRVGRRPLLLTSTGGMVISLISLGTALTVVGHHPD  375

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+P  V L IA  LA+VAFFSIG+GPIT VY+SEIFPL+LRA G ++GVA NRVTS V+
Sbjct  376  AKIPSVVALCIASTLAFVAFFSIGLGPITGVYNSEIFPLQLRALGFAVGVACNRVTSAVI  435

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SMTFLSL KAITIGG+FF+Y+GIA V ++FFFT +PETRG+TLEEM  LFG      +  
Sbjct  436  SMTFLSLSKAITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFGMPDTDMAEA  495

Query  270  REIEAKKQ--KMTTN  232
             +  AK++  +M+T 
Sbjct  496  DDTAAKEKVVEMSTK  510



>gb|ACG35144.1| proton myo-inositol cotransporter [Zea mays]
Length=513

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KT FIL+ATF LDR GRR LLL S GGMI S++ L   LT+   H D
Sbjct  317  NKLLGVTCAVGVTKTFFILVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPD  376

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             KV WAV L IA  L+Y+AFFSIG+GPIT VY+SEIFPL++RA G ++GVA+NRVTS V+
Sbjct  377  TKVAWAVALCIASTLSYIAFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVI  436

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTFLSL KAITIGG+FF+Y+GIA VA++FFFT +PETRG+TLEEM  LFG
Sbjct  437  SMTFLSLSKAITIGGSFFLYSGIAAVAWVFFFTCLPETRGRTLEEMGKLFG  487



>ref|XP_008812826.1| PREDICTED: polyol transporter 5-like, partial [Phoenix dactylifera]
Length=281

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH-  628
              L  TVAVGF+KT  IL+ATF LDR GRR LLLSS GGM+ S+++LA +L++I+H  H 
Sbjct  83   NSLGATVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHE  142

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA  +SIA VL +V  FSIG+GPI WVY+SEIFPLRLRA G S+G   NR+ SGV+S
Sbjct  143  KLTWAAAMSIATVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTGTNRIVSGVIS  202

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            MTF+SLYKAITI G++F Y GIA   ++FF+  +PETRG++LE+ME LF
Sbjct  203  MTFISLYKAITIAGSYFFYAGIAAAGWLFFYFFLPETRGRSLEDMEVLF  251



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            + KLL T++VG  KT+FIL++TF +D+FGRR LLL+S GG++ S+L LAI LT+ID H  
Sbjct  308  NGKLLATISVGVTKTIFILVSTFNIDKFGRRILLLTSTGGLVCSLLGLAIGLTVIDQHPT  367

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+  AV +    VL+ VA FS+GMGP+ WVYSSEIFPLRLRA G  +  A NR+ SGV+
Sbjct  368  EKLTGAVAVCFFCVLSSVATFSMGMGPVAWVYSSEIFPLRLRALGSGLAAAMNRLVSGVI  427

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTF+SLYKAITIGGAFF++ GIA VAFIFFFTL+PET+G+ LEEME +FGTFFKWRST+
Sbjct  428  LMTFISLYKAITIGGAFFLFAGIAFVAFIFFFTLLPETQGRGLEEMEEMFGTFFKWRSTV  487

Query  270  REIEAKKQ  247
            RE+E +K+
Sbjct  488  RELEERKK  495



>ref|NP_001141158.1| hypothetical protein [Zea mays]
 gb|ACF85577.1| unknown [Zea mays]
 tpg|DAA41235.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=473

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KTLFIL+ATF LDR GRR LLL+S GGMI S++ L   LT++  H D
Sbjct  275  NKLLGVTCAVGVAKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPD  334

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+P AV L IA  LAYVAFFSIG+GP+T VY+SEIFPL++RA G ++GVA NRVTS V+
Sbjct  335  AKIPSAVALCIASTLAYVAFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVI  394

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTFLSL K ITIGG+FF+Y+GIA V ++FFFT +PETRG+TLEEM  LFG
Sbjct  395  SMTFLSLSKGITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG  445



>ref|XP_010905473.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=523

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 148/199 (74%), Gaps = 14/199 (7%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SD  631
             K L  TVAVGF KTLFIL+ATF LDR GRR LLLSS GGMI S+  L + LTIIDH  +
Sbjct  328  DKLLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLSSQGGMIVSLAGLGLGLTIIDHHPN  387

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             ++PWA+ L IA +LA+VAFFSIGMGP+  VY SEIFPLRLRA G S+GV  NRVTSGV+
Sbjct  388  GQLPWAIGLCIASILAFVAFFSIGMGPMPSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVI  447

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            +MTFLSLYKAITIGG+FF+Y GIA V ++FFFT + ETRGKTLEEME LFGT        
Sbjct  448  TMTFLSLYKAITIGGSFFLYAGIAAVGWVFFFTYLKETRGKTLEEMENLFGT--------  499

Query  270  REIEAKKQKMTTNQLQMSS  214
                 K ++    ++QM++
Sbjct  500  -----KTEEEEDGEVQMAN  513



>ref|XP_008667512.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA41234.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=516

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KTLFIL+ATF LDR GRR LLL+S GGMI S++ L   LT++  H D
Sbjct  318  NKLLGVTCAVGVAKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPD  377

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+P AV L IA  LAYVAFFSIG+GP+T VY+SEIFPL++RA G ++GVA NRVTS V+
Sbjct  378  AKIPSAVALCIASTLAYVAFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVI  437

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTFLSL K ITIGG+FF+Y+GIA V ++FFFT +PETRG+TLEEM  LFG
Sbjct  438  SMTFLSLSKGITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG  488



>emb|CDY72601.1| BnaAnng41630D [Brassica napus]
Length=392

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 140/194 (72%), Gaps = 11/194 (6%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSD-  631
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  
Sbjct  201  NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  260

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            H + WA+ LS+ MV+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  261  HTLKWAIVLSVTMVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  320

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL K +TIGGAF ++ G+A  A++FFFT +PETRG  LEEME+LFG++       
Sbjct  321  GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEMESLFGSY-------  373

Query  270  REIEAKKQKMTTNQ  229
                A K+K  T +
Sbjct  374  ---TANKKKNVTKE  384



>ref|XP_002460924.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
 gb|EER97445.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
Length=510

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiI-DHSD  631
            +K L  T AVG  KTLFIL+ATF LDR GRR LLL+S GGMI +++ L   LT++  H D
Sbjct  316  NKLLGVTCAVGVSKTLFILVATFLLDRVGRRPLLLTSAGGMIVALIGLGTGLTVVGHHPD  375

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+P AV L IA  LAYVAFFSIG+GPIT VY+SEIFPL++RA G ++G+A NRVTS V+
Sbjct  376  AKIPSAVALCIASTLAYVAFFSIGLGPITGVYNSEIFPLQVRALGFAVGMACNRVTSAVI  435

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SMTFLSL K ITIGG+FF+Y+GIA V ++FFFT +PETRG+TLEEM  LFG
Sbjct  436  SMTFLSLSKGITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG  486



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -2

Query  792  CTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHKVPWA  613
             TV VG  KT FIL+ATF LDR GRR LLLSSVGGMI S+L LA  LTI++HS+ KV WA
Sbjct  329  ATVCVGISKTSFILVATFLLDRMGRRPLLLSSVGGMILSLLGLASGLTIVNHSEEKVGWA  388

Query  612  VTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVSMTFLS  433
            + L I  VL +VA FSIG+GPI WVYSSEIFPLRLRA G S+    NR+ SG++  TFLS
Sbjct  389  IALCILTVLTFVASFSIGLGPIAWVYSSEIFPLRLRAQGGSLAAGVNRMMSGIIVTTFLS  448

Query  432  LYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLRE  265
            LYKAITI G+FFM+ GIA V ++F +  +PETRG+TLEEME LF    KWR TL +
Sbjct  449  LYKAITIEGSFFMFAGIATVTWVFIYVFLPETRGRTLEEMEVLFS---KWRWTLDD  501



>emb|CDY70259.1| BnaCnng67460D [Brassica napus]
Length=244

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 133/173 (77%), Gaps = 1/173 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  
Sbjct  53   NDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  112

Query  627  K-VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            + + WA+ LS+  V+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  113  QTLKWAIGLSVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  172

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTF  292
             MTFLSL K +TIGGAF ++ G+A  A++FFFT +PETRG  LEEME+LFG++
Sbjct  173  GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGMPLEEMESLFGSY  225



>ref|XP_009371568.1| PREDICTED: probable polyol transporter 6 [Pyrus x bretschneideri]
Length=504

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL TV VG  KT+FI +AT  LD+ GRR+LLL+S GGMI ++  L   LT+ +HS  
Sbjct  322  DKLLLATVGVGLTKTVFICVATLFLDKAGRRRLLLTSTGGMIIALTGLGFGLTMAEHSKE  381

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA++ SI  V  +VAFFSIG+GPITWVYS+EIFPL+LRA G S+GVA NR+ +  VS
Sbjct  382  KLTWALSFSIVAVYVFVAFFSIGLGPITWVYSTEIFPLKLRAQGSSIGVAVNRLMNATVS  441

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            M+F+S+YKAITIGGAFFM+ GIAV+A+IFFF  +PET+G++LEEME +F
Sbjct  442  MSFISIYKAITIGGAFFMFAGIAVLAWIFFFFFLPETKGRSLEEMEMVF  490



>ref|XP_011659070.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44326.1| Mannitol transporter [Cucumis sativus]
Length=522

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 145/197 (74%), Gaps = 8/197 (4%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL T+AVG VK  FIL+ATF LDR GRR L+L+SV G   S+++L I+LTII++S+ 
Sbjct  333  DHKLLATIAVGIVKGSFILVATFLLDRVGRRPLILTSVAGQTISLVILGISLTIINNSEV  392

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            KV WA+ L I  VL+ +AFFSIG+GP+  VY+SEIFPLRLRA G S+ V  NR+ SGVV+
Sbjct  393  KVKWAIVLCITTVLSNMAFFSIGLGPMAPVYTSEIFPLRLRALGVSVSVTLNRIVSGVVA  452

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSLY A+TIGGAFF+Y GIA V+++FFF + PETRG+ LE++E LFG  F WRS   
Sbjct  453  MTFLSLYHALTIGGAFFLYAGIAAVSWLFFFLVFPETRGQNLEDIEALFGN-FPWRS---  508

Query  267  EIEAKKQKMTTNQLQMS  217
                KK K    ++++ 
Sbjct  509  ----KKNKDAAMEVELE  521



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 131/181 (72%), Gaps = 1/181 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDH-SDH  628
            ++L  TVAVGF KT FIL+ATF LDR GRR LLLSS  GMIAS++ LA  L  IDH    
Sbjct  307  ERLGATVAVGFTKTSFILVATFLLDRVGRRPLLLSSAAGMIASLITLASVLLTIDHHPGE  366

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WAV L IA VL +V  FSIG+GPI WVYSSEIFPLRLRA G S+G + NR+ SG V+
Sbjct  367  KLTWAVALCIATVLTFVGSFSIGLGPIAWVYSSEIFPLRLRAQGASLGASMNRLMSGAVT  426

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+FLSLYKAI+I G+F++Y GIA   ++FF+  +PETRG+ LEEME LFG   K      
Sbjct  427  MSFLSLYKAISISGSFYLYAGIAAAGWVFFYVFLPETRGRNLEEMEELFGKASKSSEKAE  486

Query  267  E  265
            E
Sbjct  487  E  487



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            + KLL T++VG  KT+FIL++TF LD+FGRR  LL+S  G++ S++ L   LT+ID H +
Sbjct  326  NGKLLATISVGVTKTVFILVSTFYLDKFGRRISLLTSTAGLVCSLVGLGAGLTVIDQHPN  385

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+  A+  S   VLA VA FS+G+GP+ WVYSSEIFPLRLRA G  +  + NR+ SGV+
Sbjct  386  EKLTGAIGFSFFCVLASVATFSMGLGPVAWVYSSEIFPLRLRALGSGLAASMNRLISGVI  445

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTF+SLYKAITIGGAFF++ GIA VAFIFFFTL+PETRG+ LEEME LFGTF KWRST+
Sbjct  446  LMTFISLYKAITIGGAFFLFGGIAFVAFIFFFTLLPETRGRGLEEMEELFGTFCKWRSTV  505

Query  270  REIEAKKQKMTTNQ  229
            RE+E KK+  + N+
Sbjct  506  RELEEKKRLESENE  519



>ref|XP_009121227.1| PREDICTED: putative polyol transporter 1 [Brassica rapa]
Length=511

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 140/194 (72%), Gaps = 11/194 (6%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSD-  631
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  
Sbjct  320  NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            H + WA+ LS+ MV+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  380  HTLKWAIVLSVTMVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL K +TIGGAF ++ G+A  A++FFFT +PETRG  LEEME+LFG++       
Sbjct  440  GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEMESLFGSY-------  492

Query  270  REIEAKKQKMTTNQ  229
                A K+K  T +
Sbjct  493  ---TANKKKNVTKE  503



>emb|CDY46218.1| BnaA07g03520D [Brassica napus]
Length=511

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 140/194 (72%), Gaps = 11/194 (6%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSD-  631
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  
Sbjct  320  NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            H + WA+ LS+ MV+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  380  HTLKWAIVLSVTMVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL K +TIGGAF ++ G+A  A++FFFT +PETRG  LEEME+LFG++       
Sbjct  440  GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEMESLFGSY-------  492

Query  270  REIEAKKQKMTTNQ  229
                A K+K  T +
Sbjct  493  ---TANKKKNVTKE  503



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH-  628
              L  TVAVGF+KT  IL+ATF LDR GRR LLLSS GGM+ S+++LA  L++I+H  H 
Sbjct  328  NSLGATVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASCLSVIEHHPHE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA  +SIA VL +V  FSIG+GPI WVY+SEIFPLRLRA G S+G A NR+ SGVV+
Sbjct  388  KLTWAAAMSIATVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRILSGVVT  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            MTF+SLYKAITI G+FF+Y+GIA   ++FF+  +PETRG++LE+ME LF
Sbjct  448  MTFISLYKAITIAGSFFLYSGIAAAGWLFFYFFLPETRGRSLEDMEVLF  496



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
              KLL T+AVGF KT+FIL++TF LDR GRR LLL+SV GMI S+  L   LTIIDHS+ 
Sbjct  332  DHKLLATIAVGFCKTVFILVSTFFLDRVGRRPLLLTSVAGMIISLTALGCGLTIIDHSNE  391

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ L IAM L +VA FS+G+GPI WVYSSEIFPLRLRA G S+GVA NR TSG+++
Sbjct  392  KLMWAIGLCIAMTLTFVASFSMGLGPIAWVYSSEIFPLRLRAQGASIGVAVNRATSGLIT  451

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL KAITIGGAFF++  +A VA+ FFFT++PET+G+TLE+M+ LFG+   WRS  R
Sbjct  452  MTFLSLSKAITIGGAFFLFAAVAAVAWAFFFTVLPETQGRTLEDMQVLFGSLTGWRSVAR  511

Query  267  EIE  259
            +++
Sbjct  512  KLK  514



>ref|XP_008800418.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 132/169 (78%), Gaps = 1/169 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH-  628
              L  TVAVGF+KT  IL+ATF LDR GRR LLLSS GGM+ S+++LA +L++I+H  H 
Sbjct  328  NSLGATVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA  +SIA VL +V  FSIG+GPI WVY+SEIFPLRLRA G S+G A NR+ SGV++
Sbjct  388  KLTWAAAMSIASVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVIT  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            MTF+SLYK ITI G+FF+Y GIA   +IFF+  +PETRG++LE+ME LF
Sbjct  448  MTFISLYKTITIAGSFFLYAGIAAAGWIFFYFFLPETRGRSLEDMEVLF  496



>gb|EMS61414.1| Polyol transporter 5 [Triticum urartu]
Length=388

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 134/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHS-D  631
             + L  T A+G  KTL IL+A F LDR GRR LLL S GGMI S++ LA  LT++D + D
Sbjct  174  DQLLAATCAMGVAKTLVILVAMFLLDRVGRRPLLLCSTGGMIVSLVGLATGLTVVDQNPD  233

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             +VPWAV+L +A VLAYV+FFS+G+GP+T VY++EI PLR+RA G ++G A NRV SGV+
Sbjct  234  ARVPWAVSLCVASVLAYVSFFSVGLGPVTGVYTTEILPLRVRALGFAVGAAGNRVVSGVM  293

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            SM FLSL  AIT+GG FF+Y G+AV+A++FFFT +PETRG+TLEEM +LFG
Sbjct  294  SMAFLSLSGAITLGGTFFLYAGVAVLAWVFFFTCLPETRGRTLEEMGSLFG  344



>ref|XP_008338123.1| PREDICTED: probable polyol transporter 6 [Malus domestica]
Length=504

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL TV VG  K +FI +AT  LD+ GRR+LLL+S GGMI ++  L   LT+ +HS  
Sbjct  322  DKLLLATVGVGLTKXVFICVATLFLDKAGRRRLLLTSTGGMIIALAGLGFGLTMAEHSKE  381

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA++ SI  +  +VAFFSIG+GPITWVYS+EIFPL+LRA G S+GVA NR+ +  VS
Sbjct  382  KLTWALSFSIVAIYVFVAFFSIGLGPITWVYSTEIFPLKLRAQGTSIGVAVNRLMNATVS  441

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            M+F+S+YKAITIGGAFFM+ GIAV+A+IFFF  +PET+G++LEEME +F
Sbjct  442  MSFISIYKAITIGGAFFMFAGIAVLAWIFFFFFLPETKGRSLEEMELVF  490



>ref|XP_009121388.1| PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 1 
[Brassica rapa]
Length=511

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 140/194 (72%), Gaps = 11/194 (6%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  
Sbjct  320  NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  627  K-VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            + + WA+ LS+  V+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  380  QTLKWAIGLSVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL K +TIGGAF ++ G+A  A++FFFT +PETRG  LEEME+LFG++       
Sbjct  440  GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGMPLEEMESLFGSY-------  492

Query  270  REIEAKKQKMTTNQ  229
                A K+K  TN+
Sbjct  493  ---TANKKKNVTNE  503



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH-  628
              L  TVAVGF+KT  IL+ATF LDR GRR LLLSS GGM+ S+++LA +L++I+H  H 
Sbjct  328  NSLGATVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHE  387

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA  +SI+ VL +V  FSIG+GPI WVY+SEIFPLRLRA G S+G A NR+ SGV+S
Sbjct  388  KLTWAAAMSISTVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVIS  447

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            MTF+SLYK ITI G++F Y GIA   ++FF+  +PETRG++LE+ME LFG
Sbjct  448  MTFISLYKTITIAGSYFFYAGIAAAGWLFFYFFLPETRGRSLEDMEVLFG  497



>ref|XP_007156029.1| hypothetical protein PHAVU_003G252500g [Phaseolus vulgaris]
 gb|ESW28023.1| hypothetical protein PHAVU_003G252500g [Phaseolus vulgaris]
Length=495

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 138/185 (75%), Gaps = 0/185 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL TV +G  K +F+++A F LDR GRR+LL  S GGMI  + LL  +LT++DHS  
Sbjct  311  DKLLLATVGIGLTKIVFLVMALFLLDRVGRRRLLQVSTGGMICGLTLLGFSLTMVDHSSE  370

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA++LSI    AYVAFF+IG+GP+TWVYSSEIFPLRLRA G S+GVA NR  + VVS
Sbjct  371  KLLWALSLSIVATYAYVAFFNIGLGPVTWVYSSEIFPLRLRAQGASIGVAVNRTMNAVVS  430

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+S+YKAITIGG+FFM+  ++++A+ FF+  +PET+G  LEEME LF   F  ++ ++
Sbjct  431  MSFISVYKAITIGGSFFMFAAVSILAWFFFYFFLPETKGVPLEEMEMLFTKVFSGQNVVK  490

Query  267  EIEAK  253
            + + +
Sbjct  491  KTDPR  495



>dbj|BAK00091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiID-HSD  631
            ++ L  T A+G +KTLFIL+ATF LDR GRR LLL+S  GM+A ++ L   LT++D H D
Sbjct  330  NRLLGATCAMGVMKTLFILVATFQLDRIGRRPLLLTSTAGMLACLIGLGTGLTVVDRHPD  389

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
             K+PWA+ L I  VLAYV+FFS G+GP+T VY+SE+FPLR+RA G ++G + NRVTS  V
Sbjct  390  TKIPWAIALCIVSVLAYVSFFSTGLGPLTSVYTSEVFPLRVRALGFALGASCNRVTSAAV  449

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
            SM+FLSL KAITIGG+FF+Y GIA + +IFFFT +PETRG  LEE+  LFG   K R  +
Sbjct  450  SMSFLSLSKAITIGGSFFLYAGIAALGWIFFFTFIPETRGLPLEEIGKLFG--MKDR-VV  506

Query  270  REIEAKKQKMTTNQLQMSSTY  208
             E  A K K+   +++ ++++
Sbjct  507  EEDTATKDKVKVVEMKENASH  527



>ref|XP_003629474.1| hypothetical protein MTR_8g077890 [Medicago truncatula]
 gb|AET03950.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=501

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL T+ VG  K +F++IA F LD+ GRR+LL  S GGMI  + LL ++LT++D S+ 
Sbjct  314  EKLLLATIGVGLTKIVFLVIALFLLDKLGRRRLLQISTGGMIIGLTLLGLSLTVVDKSNG  373

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             V WA+ LSI    AYVAFF+IG+GPITWVYSSEIFPL+LRA G S+GVA NR  + VVS
Sbjct  374  NVLWALILSIVATYAYVAFFNIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRTMNAVVS  433

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            MTF+S+YKAITIGG+FFM+ GI+V+A++FF+  +PET+GK LEEME +F
Sbjct  434  MTFISIYKAITIGGSFFMFAGISVLAWLFFYFFLPETKGKALEEMEMVF  482



>gb|ACJ85829.1| unknown [Medicago truncatula]
Length=501

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL T+ VG  K +F++IA F LD+ GRR+LL  S GGMI  + LL ++LT++D S+ 
Sbjct  314  EKLLLATIGVGLTKIVFLVIALFLLDKLGRRRLLQISTGGMIIGLTLLGLSLTVVDKSNG  373

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             V WA+ LSI    AYVAFF+IG+GPITWVYSSEIFPL+LRA G S+GVA NR  + VVS
Sbjct  374  NVLWALILSIVATYAYVAFFNIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRTMNAVVS  433

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            MTF+S+YKAITIGG+FFM+ GI+V+A++FF+  +PET+GK LEEME +F
Sbjct  434  MTFISIYKAITIGGSFFMFAGISVLAWLFFYFFLPETKGKALEEMEMVF  482



>ref|XP_007046983.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX91140.1| Major facilitator superfamily protein [Theobroma cacao]
Length=506

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL TV VG  KT FIL+ATF LD+ GRR+LLL S GGM+ ++  L   LT+++ +  
Sbjct  317  DKLLLATVGVGLTKTTFILVATFLLDKVGRRRLLLISTGGMVVALTALGFGLTMVERTGE  376

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA++L IA    +VAFFSIG+ P+TWVYS+EIFPL+LRA G  +GVA NRV +  VS
Sbjct  377  KLLWALSLCIASTYIFVAFFSIGLAPVTWVYSAEIFPLKLRAQGVGIGVAVNRVMNATVS  436

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            M+F+S+YKAITIGG+FFM+ GIAVVA+ FFF L+PET+G++LEE+ETLF    K +    
Sbjct  437  MSFISIYKAITIGGSFFMFAGIAVVAWWFFFFLLPETKGRSLEEIETLFTRKTKPKKEGL  496

Query  267  EIEAKKQ  247
            EI+ +  
Sbjct  497  EIQPRSN  503



>ref|XP_009138439.1| PREDICTED: probable polyol transporter 6 [Brassica rapa]
 emb|CDY42700.1| BnaA03g53530D [Brassica napus]
Length=502

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K  L T+ VG +KT FI  ATF LD+ GRRKLLL+SVGGMI ++ +L   LT+  +S  
Sbjct  319  DKLFLVTIGVGIMKTTFIFTATFLLDKVGRRKLLLTSVGGMIGALTMLGFGLTMAQNSGG  378

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ LSI    ++VAFFSIG+GPITWVYSSE+FPL+LRA G S+GVA NRV +  VS
Sbjct  379  KLVWALVLSIVSAYSFVAFFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVS  438

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            M+FLSL KAIT GGAFFM+ GIA VA+ FFF LMPET+GK+LEE+E LF
Sbjct  439  MSFLSLSKAITTGGAFFMFAGIAAVAWNFFFFLMPETKGKSLEEIEALF  487



>gb|AFK37582.1| unknown [Medicago truncatula]
Length=501

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL T+ VG  K +F++IA F LD+ GRR+LL  S GGMI  + LL ++LT++D S+ 
Sbjct  314  EKLLLATIGVGLTKIVFLVIALFLLDKLGRRRLLQISTGGMIIGLTLLGLSLTVVDKSNG  373

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             V WA+ LSI    AYVAFF+IG+GPITWVYSSEIFPL+LRA G S+GVA NR  + VVS
Sbjct  374  NVLWALILSIVATYAYVAFFNIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRTMNAVVS  433

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            MTF+S+YKAITIGG+FFM+ GI+V+A++FF+  +PET+GK LEEME +F
Sbjct  434  MTFISIYKAITIGGSFFMFAGISVLAWLFFYFFLPETKGKALEEMEMVF  482



>emb|CDY46217.1| BnaA07g03530D [Brassica napus]
Length=512

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 139/194 (72%), Gaps = 11/194 (6%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSD-  631
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  
Sbjct  321  NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  380

Query  630  HKVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            H + WA+ LS+  V+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  381  HTLKWAIGLSVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  440

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL K +TIGGAF ++ G+A  A++FFFT +PETRG  LEEME+LFG++       
Sbjct  441  GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGMPLEEMESLFGSY-------  493

Query  270  REIEAKKQKMTTNQ  229
                A K+K  T +
Sbjct  494  ---TANKKKNVTKE  504



>ref|XP_008440694.1| PREDICTED: probable polyol transporter 6 [Cucumis melo]
Length=499

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL TV VG +KT FIL+ATF LDR GRR++L +S+ GM  + L+L   LT+++HS  
Sbjct  316  DKLLLATVGVGVIKTSFILVATFLLDRVGRRRILFTSITGMAVAHLMLGFGLTMVEHSHG  375

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++PWA+ +SI  V  YVA +SIGM PITWVYS+EIFPL+LRA G S+GVA NR+ +  +S
Sbjct  376  ELPWALIISIISVYMYVALYSIGMAPITWVYSTEIFPLKLRAQGLSIGVAVNRLMNAAIS  435

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFG  298
            M+F+S+Y+AITIGG FFM+ GI+V+A I+F+  +PET+GK+LEE+E LFG
Sbjct  436  MSFISIYEAITIGGTFFMFAGISVIALIYFYFFLPETKGKSLEEIEKLFG  485



>ref|XP_008241649.1| PREDICTED: probable polyol transporter 6 [Prunus mume]
Length=507

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K LL TV VG  KTLFIL+ATF LD+ GRR+LLL+S GGMI ++  L   LT+++HS  
Sbjct  325  DKLLLATVGVGVTKTLFILVATFLLDKAGRRRLLLTSTGGMIVALTGLGFCLTMVEHSKE  384

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            ++ WA++LSI  V  +V FFSIG+GPITWVYSSEIFPL+LRA G S+GVA NR+T+  +S
Sbjct  385  QLTWALSLSIVAVYVFVVFFSIGLGPITWVYSSEIFPLKLRAQGTSIGVAVNRLTNATIS  444

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            M+FLS+YKAITIGGAFFM+ G+AV+A+IFF+  +PET+G++LEEME +F
Sbjct  445  MSFLSIYKAITIGGAFFMFAGMAVLAWIFFYFCLPETKGRSLEEMEMVF  493



>gb|KFK41272.1| hypothetical protein AALP_AA2G108500 [Arabis alpina]
Length=444

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = -2

Query  804  KKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDHK  625
              LL TVAVG VKTLFIL+ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  +
Sbjct  254  DDLLATVAVGVVKTLFILVGTCVVDRFGRRALLLTSMGGMFVSLTALGTSLTVIDRNPGQ  313

Query  624  -VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
             + WA+ LS+  V+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++ 
Sbjct  314  TLKWAIGLSVTTVMTFVAAFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGIIG  373

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTLR  268
            MTFLSL K +TIGGAF ++ G+A  A++FFFT +PETRG  LEEMETLFG++   +   +
Sbjct  374  MTFLSLSKGLTIGGAFLLFAGVAFAAWVFFFTFLPETRGIPLEEMETLFGSYSANKK--K  431

Query  267  EIEAKKQKMTTNQ  229
             +  K +++   Q
Sbjct  432  NVSRKGKEVVDEQ  444



>ref|XP_006409469.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
 gb|ESQ50922.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
Length=511

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 142/194 (73%), Gaps = 3/194 (2%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+  L  +LT+ID +  
Sbjct  320  NDQLLATVAVGVVKTLFIIVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  627  K-VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            + + WA+ LS+  V+ +VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  380  QTLKWAIGLSVTTVMMFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL K +TIGGAF ++ G+A  A+IFFFT +PETRG  LEEME+LFG++   +   
Sbjct  440  GMTFLSLSKGLTIGGAFLLFAGVAAAAWIFFFTFLPETRGMPLEEMESLFGSYTANKK--  497

Query  270  REIEAKKQKMTTNQ  229
            + + +K +++   Q
Sbjct  498  KNVTSKGKEVVDEQ  511



>emb|CDY35469.1| BnaC03g61910D [Brassica napus]
Length=507

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
             K  L T+ VG +KT FI IATF LD+ GRRKLLL+SVGGM+ ++ +L   LT+  +S  
Sbjct  324  DKLFLVTIGVGIMKTTFIFIATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGG  383

Query  627  KVPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVVS  448
            K+ WA+ LSI    ++VA FSIG+GPITWVYSSE+FPL+LRA G S+GVA NRV +  VS
Sbjct  384  KLAWALVLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVS  443

Query  447  MTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLF  301
            M+FLSL +AIT GGAFFM+ G+A VA+ FFF LMPET+GK+LEE+E LF
Sbjct  444  MSFLSLTRAITTGGAFFMFAGVAAVAWNFFFFLMPETKGKSLEEIEALF  492



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 141/187 (75%), Gaps = 1/187 (1%)
 Frame = -2

Query  807  HKKLLCTVAVGFVKTLFILIATFTLDRFGRRKLLLSSVGGMiasmlllaialtiIDHSDH  628
            + +LL TVAVG VKTLFI++ T  +DRFGRR LLL+S+GGM  S+ LL  +LT+ID +  
Sbjct  320  NDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFISLTLLGTSLTVIDRNPG  379

Query  627  K-VPWAVTLSIAMVLAYVAFFSIGMGPITWVYSSEIFPLRLRATGCSMGVAANRVTSGVV  451
            + + WA+ LS+  V+++VA FSIG GP+TWVY SEIFP+RLRA G S+GV  NR+ SG++
Sbjct  380  QTIKWAIGLSVTTVMSFVATFSIGAGPVTWVYCSEIFPVRLRAQGVSLGVMLNRLMSGII  439

Query  450  SMTFLSLYKAITIGGAFFMYTGIAVVAFIFFFTLMPETRGKTLEEMETLFGTFFKWRSTL  271
             MTFLSL K +TIGGAF ++ G+A +A++FFFT +PETRG  LEE+E+LFG++   +   
Sbjct  440  GMTFLSLSKGLTIGGAFLLFAGVAAIAWVFFFTFLPETRGVPLEEIESLFGSYSANKKNN  499

Query  270  REIEAKK  250
              I+ K+
Sbjct  500  VTIKGKE  506



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1683214431688