BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12131

Length=773
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                343   3e-110   Erythranthe guttata [common monkey flower]
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        342   4e-110   Sesamum indicum [beniseed]
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        339   9e-109   Solanum tuberosum [potatoes]
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             338   2e-108   Solanum lycopersicum
emb|CAN79862.1|  hypothetical protein VITISV_021998                     336   7e-108   Vitis vinifera
emb|CBI22461.3|  unnamed protein product                                337   9e-108   Vitis vinifera
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             336   1e-107   Vitis vinifera
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        335   5e-107   Nicotiana sylvestris
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        334   7e-107   Nicotiana tomentosiformis
ref|XP_002527509.1|  zinc finger protein, putative                      333   3e-106   Ricinus communis
emb|CDO97275.1|  unnamed protein product                                331   1e-105   Coffea canephora [robusta coffee]
ref|XP_007042634.1|  Vaculolar sorting receptor 3 isoform 2             326   3e-105   
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        330   5e-105   Cicer arietinum [garbanzo]
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                  326   6e-105   Medicago truncatula
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             328   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        328   1e-104   Populus euphratica
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             328   1e-104   Populus euphratica
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        328   3e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        327   3e-104   Morus notabilis
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  327   4e-104   Medicago truncatula
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            327   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        327   5e-104   
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             326   7e-104   Theobroma cacao [chocolate]
ref|XP_003592523.1|  Vacuolar-sorting receptor                          325   9e-104   
gb|KJB79450.1|  hypothetical protein B456_013G050300                    326   1e-103   Gossypium raimondii
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        326   1e-103   Cucumis melo [Oriental melon]
ref|XP_012093114.1|  PREDICTED: vacuolar-sorting receptor 3             326   1e-103   Jatropha curcas
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        325   2e-103   Pyrus x bretschneideri [bai li]
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               325   2e-103   Gossypium arboreum [tree cotton]
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        325   3e-103   Cucumis sativus [cucumbers]
gb|KJB12290.1|  hypothetical protein B456_002G010300                    322   3e-103   Gossypium raimondii
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        325   3e-103   
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        324   4e-103   
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        324   5e-103   Sesamum indicum [beniseed]
gb|KJB12295.1|  hypothetical protein B456_002G010300                    320   6e-103   Gossypium raimondii
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             324   7e-103   Prunus mume [ume]
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                     322   8e-103   Eucalyptus grandis [rose gum]
gb|KDO57883.1|  hypothetical protein CISIN_1g006786mg                   317   9e-103   Citrus sinensis [apfelsine]
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        323   2e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        323   3e-102   Eucalyptus grandis [rose gum]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    322   4e-102   Glycine max [soybeans]
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             322   5e-102   Prunus persica
gb|KJB12294.1|  hypothetical protein B456_002G010300                    319   3e-101   Gossypium raimondii
gb|KJB32253.1|  hypothetical protein B456_005G231800                    317   3e-101   Gossypium raimondii
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             320   3e-101   Glycine soja [wild soybean]
gb|KJB12291.1|  hypothetical protein B456_002G010300                    319   5e-101   Gossypium raimondii
gb|KJB12292.1|  hypothetical protein B456_002G010300                    319   6e-101   Gossypium raimondii
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    318   1e-100   Glycine max [soybeans]
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             318   1e-100   Glycine soja [wild soybean]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             318   2e-100   Phaseolus vulgaris [French bean]
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                   315   2e-100   Citrus sinensis [apfelsine]
gb|ERN10922.1|  hypothetical protein AMTR_s00164p00059220               316   4e-100   Amborella trichopoda
gb|KJB32254.1|  hypothetical protein B456_005G231800                    315   6e-100   Gossypium raimondii
ref|XP_011625221.1|  PREDICTED: vacuolar-sorting receptor 3 isofo...    316   9e-100   
ref|XP_006849341.2|  PREDICTED: vacuolar-sorting receptor 3 isofo...    316   1e-99    Amborella trichopoda
gb|KJB32252.1|  hypothetical protein B456_005G231800                    316   1e-99    Gossypium raimondii
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             315   1e-99    Citrus clementina [clementine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   315   2e-99    Citrus sinensis [apfelsine]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             315   2e-99    Glycine soja [wild soybean]
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        315   2e-99    Glycine max [soybeans]
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   315   2e-99    Citrus sinensis [apfelsine]
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        315   2e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             315   3e-99    Fragaria vesca subsp. vesca
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        314   5e-99    Citrus sinensis [apfelsine]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             313   9e-99    Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    313   9e-99    Glycine max [soybeans]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             312   2e-98    Phaseolus vulgaris [French bean]
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             312   2e-98    Eutrema salsugineum [saltwater cress]
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             312   3e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        311   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             311   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        311   6e-98    Tarenaya hassleriana [spider flower]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             311   6e-98    Capsella rubella
ref|XP_002885935.1|  VSR-2                                              311   6e-98    
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    311   6e-98    Arabis alpina [alpine rockcress]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             311   7e-98    
ref|NP_179081.1|  vacuolar-sorting receptor 3                           311   7e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_179079.1|  vacuolar-sorting receptor 4                           311   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        311   8e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             311   9e-98    Tarenaya hassleriana [spider flower]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             310   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    309   4e-97    Cucumis sativus [cucumbers]
ref|XP_011652916.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    309   4e-97    Cucumis sativus [cucumbers]
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    308   5e-97    Camelina sativa [gold-of-pleasure]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    308   5e-97    Arabis alpina [alpine rockcress]
gb|EPS57970.1|  hypothetical protein M569_16845                         308   5e-97    Genlisea aurea
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             308   6e-97    Brassica rapa
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    308   7e-97    Cicer arietinum [garbanzo]
emb|CDY37219.1|  BnaA09g08400D                                          308   9e-97    Brassica napus [oilseed rape]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    308   1e-96    Cucumis melo [Oriental melon]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    308   1e-96    Cucumis melo [Oriental melon]
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             309   1e-96    
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        307   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    308   2e-96    
emb|CDY65441.1|  BnaCnng47180D                                          306   3e-96    Brassica napus [oilseed rape]
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    306   7e-96    Camelina sativa [gold-of-pleasure]
emb|CDX81459.1|  BnaC09g08700D                                          305   7e-96    
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        305   2e-95    Brassica rapa
gb|AAB72112.1|  vacuolar sorting receptor homolog                       305   2e-95    Arabidopsis thaliana [mouse-ear cress]
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    299   3e-93    Pisum sativum [garden pea]
gb|ABR17683.1|  unknown                                                 299   4e-93    Picea sitchensis
ref|XP_003610620.1|  Vacuolar-sorting receptor                          297   1e-92    
ref|XP_002309184.1|  vacuolar sorting receptor family protein           294   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             293   5e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW68896.1|  hypothetical protein ZEAMMB73_054159                    289   3e-90    
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   289   5e-90    Zea mays [maize]
gb|EEE52644.1|  hypothetical protein OsJ_35003                          289   1e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        290   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    288   1e-89    
ref|NP_001169650.1|  hypothetical protein precursor                     286   2e-89    
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    289   2e-89    
gb|ACN30885.1|  unknown                                                 289   2e-89    Zea mays [maize]
gb|KGN58683.1|  hypothetical protein Csa_3G728010                       286   2e-89    Cucumis sativus [cucumbers]
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        289   2e-89    Setaria italica
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     289   2e-89    Zea mays [maize]
gb|EEC68730.1|  hypothetical protein OsI_37233                          289   2e-89    Oryza sativa Indica Group [Indian rice]
ref|NP_001064400.1|  Os10g0346600                                       289   3e-89    
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    288   3e-89 
gb|EEC67546.1|  hypothetical protein OsI_34875                          288   3e-89    Oryza sativa Indica Group [Indian rice]
gb|EEE51529.1|  hypothetical protein OsJ_32728                          288   4e-89    Oryza sativa Japonica Group [Japonica rice]
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              288   4e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        287   8e-89    Phoenix dactylifera
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        287   9e-89    Zea mays [maize]
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              287   1e-88    
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1             287   1e-88    Cucumis sativus [cucumbers]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        286   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        285   1e-88    
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    286   1e-88    
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          286   2e-88    Sorghum bicolor [broomcorn]
ref|NP_001065992.1|  Os12g0116000                                       289   2e-88    
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        286   2e-88    
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        286   2e-88    Oryza brachyantha
gb|KDO64109.1|  hypothetical protein CISIN_1g0100101mg                  278   2e-88    Citrus sinensis [apfelsine]
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             286   2e-88    
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    286   2e-88    
gb|KJB71518.1|  hypothetical protein B456_011G126800                    285   3e-88    Gossypium raimondii
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             286   3e-88    Cucumis melo [Oriental melon]
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             286   3e-88    Selaginella moellendorffii
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             285   4e-88    
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        285   4e-88    Populus euphratica
gb|KDO64107.1|  hypothetical protein CISIN_1g0100101mg                  279   6e-88    Citrus sinensis [apfelsine]
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        285   6e-88    
gb|KDO64106.1|  hypothetical protein CISIN_1g0100101mg                  278   8e-88    Citrus sinensis [apfelsine]
gb|KJB71519.1|  hypothetical protein B456_011G126800                    284   9e-88    Gossypium raimondii
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               284   9e-88    Gossypium arboreum [tree cotton]
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             284   1e-87    Brachypodium distachyon [annual false brome]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        284   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_003623631.1|  Vacuolar sorting receptor                          284   1e-87    Medicago truncatula
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    283   1e-87    Nelumbo nucifera [Indian lotus]
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             284   2e-87    
ref|NP_180588.1|  vacuolar-sorting receptor 2                           283   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    283   3e-87    Tarenaya hassleriana [spider flower]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    283   3e-87    Tarenaya hassleriana [spider flower]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    283   3e-87    Nelumbo nucifera [Indian lotus]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        283   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        283   4e-87    Elaeis guineensis
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        283   5e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             282   6e-87    Tarenaya hassleriana [spider flower]
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        282   7e-87    Populus euphratica
dbj|BAK03786.1|  predicted protein                                      284   9e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             282   9e-87    Arabidopsis lyrata subsp. lyrata
dbj|BAK00302.1|  predicted protein                                      282   9e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             282   1e-86    
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    281   1e-86    Ricinus communis
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    281   1e-86    Nelumbo nucifera [Indian lotus]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    281   1e-86    Nicotiana sylvestris
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             281   1e-86    Camelina sativa [gold-of-pleasure]
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    281   2e-86    Nicotiana sylvestris
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        281   2e-86    Elaeis guineensis
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        281   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX91478.1|  BnaC04g06720D                                          281   2e-86    
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        281   2e-86    Brassica rapa
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3                278   2e-86    
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        281   2e-86    Fragaria vesca subsp. vesca
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        280   3e-86    Phoenix dactylifera
emb|CAN66483.1|  hypothetical protein VITISV_015390                     280   4e-86    Vitis vinifera
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like        277   5e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        280   9e-86    Brachypodium distachyon [annual false brome]
emb|CDY60753.1|  BnaA05g34780D                                          279   9e-86    Brassica napus [oilseed rape]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             279   9e-86    
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             279   1e-85    Capsella rubella
ref|XP_006842496.1|  PREDICTED: vacuolar-sorting receptor 1             279   1e-85    Amborella trichopoda
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             279   1e-85    Vitis vinifera
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        279   1e-85    Elaeis guineensis
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        280   1e-85    Oryza brachyantha
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             278   2e-85    Phaseolus vulgaris [French bean]
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        279   2e-85    Oryza brachyantha
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             278   2e-85    Citrus clementina [clementine]
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                278   2e-85    
emb|CDP06387.1|  unnamed protein product                                278   4e-85    Coffea canephora [robusta coffee]
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    277   7e-85    Nicotiana tomentosiformis
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    277   7e-85    Nicotiana tomentosiformis
gb|KJB29887.1|  hypothetical protein B456_005G122400                    276   8e-85    Gossypium raimondii
gb|KJB29886.1|  hypothetical protein B456_005G122400                    276   9e-85    Gossypium raimondii
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        277   9e-85    Phoenix dactylifera
gb|KJB29888.1|  hypothetical protein B456_005G122400                    276   9e-85    Gossypium raimondii
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        276   1e-84    Solanum tuberosum [potatoes]
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             276   1e-84    Prunus persica
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    276   2e-84    Solanum lycopersicum
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        276   2e-84    Prunus mume [ume]
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               276   2e-84    Gossypium arboreum [tree cotton]
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        275   2e-84    Nicotiana tomentosiformis
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    276   2e-84    Solanum lycopersicum
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        275   3e-84    Nicotiana sylvestris
dbj|BAB64531.1|  vacuolar sorting receptor                              275   4e-84    Vigna mungo [urad dal]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        275   5e-84    Glycine max [soybeans]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             275   5e-84    Glycine soja [wild soybean]
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        274   8e-84    Morus notabilis
emb|CDY04821.1|  BnaAnng00030D                                          274   9e-84    
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                    273   1e-83    
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    273   2e-83    Arabis alpina [alpine rockcress]
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    273   2e-83    Glycine max [soybeans]
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        273   2e-83    Sesamum indicum [beniseed]
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    271   3e-83    Solanum tuberosum [potatoes]
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             273   3e-83    Eutrema salsugineum [saltwater cress]
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    272   4e-83    
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    272   4e-83    
ref|XP_012091044.1|  PREDICTED: vacuolar-sorting receptor 1-like        272   6e-83    Jatropha curcas
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             277   9e-83    Triticum urartu
gb|EEC82690.1|  hypothetical protein OsI_27347                          271   9e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001060643.1|  Os07g0680000                                       271   1e-82    
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                271   1e-82    Erythranthe guttata [common monkey flower]
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        271   2e-82    Cicer arietinum [garbanzo]
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        270   3e-82    Oryza brachyantha
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        270   4e-82    
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        270   5e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    269   5e-82    Solanum tuberosum [potatoes]
emb|CDY38157.1|  BnaA07g02260D                                          262   7e-82    Brassica napus [oilseed rape]
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        268   1e-81    Cicer arietinum [garbanzo]
ref|XP_003626680.1|  Vacuolar sorting receptor                          268   3e-81    Medicago truncatula
emb|CDX93144.1|  BnaA03g38660D                                          267   3e-81    
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        267   4e-81    Eucalyptus grandis [rose gum]
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        266   8e-81    Glycine max [soybeans]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        265   2e-80    Sesamum indicum [beniseed]
gb|EPS72005.1|  hypothetical protein M569_02753                         263   2e-80    Genlisea aurea
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             265   3e-80    Triticum urartu
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        265   3e-80    Oryza brachyantha
emb|CDX73599.1|  BnaC08g24040D                                          265   4e-80    
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          265   5e-80    Sorghum bicolor [broomcorn]
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        264   6e-80    Solanum lycopersicum
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                264   9e-80    Erythranthe guttata [common monkey flower]
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             263   1e-79    Brassica rapa
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             263   2e-79    Phaseolus vulgaris [French bean]
emb|CDX78128.1|  BnaA09g33230D                                          263   2e-79    
ref|NP_001169232.1|  hypothetical protein precursor                     263   2e-79    Zea mays [maize]
gb|AAN60346.1|  unknown                                                 250   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    263   2e-79    Brassica rapa
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          261   1e-78    Sorghum bicolor [broomcorn]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    261   1e-78    Pyrus x bretschneideri [bai li]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    261   1e-78    Pyrus x bretschneideri [bai li]
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        260   1e-78    Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             260   2e-78    Glycine soja [wild soybean]
ref|NP_190853.1|  vacuolar-sorting receptor 1                           260   2e-78    Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                       260   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             260   3e-78    
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             259   3e-78    Selaginella moellendorffii
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        259   4e-78    Camelina sativa [gold-of-pleasure]
ref|XP_008655380.1|  PREDICTED: vacuolar-sorting receptor 1-like        254   7e-78    
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             258   8e-78    Arabidopsis lyrata subsp. lyrata
dbj|BAK05589.1|  predicted protein                                      262   1e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001292791.1|  vacuolar sorting receptor homolog1 precursor       258   2e-77    Zea mays [maize]
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             258   2e-77    Camelina sativa [gold-of-pleasure]
gb|AAK82551.1|  AT3g52850/F8J2_20                                       257   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        258   3e-77    Brachypodium distachyon [annual false brome]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             257   4e-77    Eutrema salsugineum [saltwater cress]
gb|ABR17707.1|  unknown                                                 256   5e-77    Picea sitchensis
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    256   5e-77    Arabis alpina [alpine rockcress]
emb|CDY13344.1|  BnaC06g14130D                                          256   6e-77    Brassica napus [oilseed rape]
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    256   6e-77    Setaria italica
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             257   6e-77    
tpg|DAA45229.1|  TPA: hypothetical protein ZEAMMB73_518849              255   7e-77    
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    256   1e-76    
emb|CDX67539.1|  BnaA07g15790D                                          255   1e-76    
ref|XP_001751750.1|  predicted protein                                  256   1e-76    
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    256   1e-76    
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        255   1e-76    Brassica rapa
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        255   2e-76    
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    256   2e-76    
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             254   3e-76    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001050034.1|  Os03g0335300                                       254   3e-76    
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             253   4e-76    
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        253   1e-75    
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        252   2e-75    
ref|XP_002304606.1|  vacuolar sorting receptor family protein           247   3e-73    
ref|XP_001765481.1|  predicted protein                                  246   3e-73    
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        246   3e-73    
ref|XP_006853456.1|  PREDICTED: vacuolar-sorting receptor 6             246   3e-73    
ref|XP_001785165.1|  predicted protein                                  245   8e-73    
ref|XP_012065972.1|  PREDICTED: vacuolar-sorting receptor 6-like        245   9e-73    
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like        245   9e-73    
gb|AGV54776.1|  vacuolar-sorting receptor                               244   1e-72    
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g             245   2e-72    
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6             245   2e-72    
ref|XP_001759820.1|  predicted protein                                  244   2e-72    
ref|XP_001776090.1|  predicted protein                                  243   7e-72    
gb|EPS73119.1|  hypothetical protein M569_01632                         243   7e-72    
ref|XP_001759928.1|  predicted protein                                  241   9e-72    
ref|XP_007040993.1|  Vacuolar sorting receptor 7                        243   9e-72    
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7             240   7e-71    
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6             239   2e-70    
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like        239   3e-70    
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like        238   4e-70    
gb|KDO77204.1|  hypothetical protein CISIN_1g0067882mg                  232   5e-70    
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like        237   1e-69    
ref|XP_009387954.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    234   2e-69    
ref|XP_008372129.1|  PREDICTED: vacuolar-sorting receptor 7-like        225   2e-69    
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like        236   2e-69    
gb|KDO77203.1|  hypothetical protein CISIN_1g0067882mg                  232   2e-69    
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like        235   5e-69    
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    234   1e-68    
ref|XP_001777810.1|  predicted protein                                  234   1e-68    
gb|KDO77202.1|  hypothetical protein CISIN_1g0067882mg                  231   1e-68    
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg             234   2e-68    
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg             234   3e-68    
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg             234   3e-68    
emb|CBI27239.3|  unnamed protein product                                239   3e-68    
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like        233   3e-68    
gb|EYU23258.1|  hypothetical protein MIMGU_mgv1a0227552mg               222   5e-68    
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like        233   6e-68    
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like        232   8e-68    
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                  231   1e-67    
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg             231   2e-67    
ref|XP_010941716.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    229   4e-67    
gb|KJB48042.1|  hypothetical protein B456_008G051500                    226   8e-67    
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    229   1e-66    
pdb|4TJV|A  Chain A, Crystal Structure Of Protease-associated Dom...    216   1e-66    
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like        228   2e-66    
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like        228   2e-66    
ref|XP_010039169.1|  PREDICTED: vacuolar-sorting receptor 1-like        216   4e-66    
gb|KCW75576.1|  hypothetical protein EUGRSUZ_E04321                     223   6e-66    
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    227   7e-66    
gb|ACS91931.1|  vacuolar sorting receptor protein                       226   7e-66    
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544          227   7e-66    
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    227   7e-66    
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7             227   7e-66    
gb|KJB48041.1|  hypothetical protein B456_008G051500                    226   8e-66    
gb|KJB48040.1|  hypothetical protein B456_008G051500                    227   9e-66    
gb|AIY30334.1|  vacuolar-sorting receptor 3 protein                     213   9e-66    
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg                226   2e-65    
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like        226   2e-65    
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein               226   2e-65    
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like        225   3e-65    
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like        225   3e-65    
gb|EEC81131.1|  hypothetical protein OsI_24020                          224   4e-65    
ref|NP_001058298.1|  Os06g0664300                                       225   5e-65    
gb|EMT02959.1|  Vacuolar-sorting receptor 4                             223   7e-65    
gb|EMS63262.1|  Vacuolar-sorting receptor 1                             227   7e-65    
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6             224   9e-65    
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                     223   1e-64    
gb|ACN28195.1|  unknown                                                 223   1e-64    
gb|AFW87686.1|  vacuolar sorting receptor 7                             223   2e-64    
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor              223   2e-64    
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6             223   2e-64    
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like        223   2e-64    
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    223   2e-64    
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6             223   3e-64    
gb|KJB38063.1|  hypothetical protein B456_006G235500                    220   3e-64    
emb|CDP18160.1|  unnamed protein product                                223   3e-64    
dbj|BAK00261.1|  predicted protein                                      222   6e-64    
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6             221   9e-64    
gb|EEC66779.1|  hypothetical protein OsI_33169                          211   9e-64    
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g             221   1e-63    
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                    221   1e-63    
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6             221   2e-63    
emb|CDY50060.1|  BnaCnng18670D                                          220   2e-63    
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7             220   2e-63    
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like        220   3e-63    
emb|CDY43178.1|  BnaCnng11060D                                          219   4e-63    
gb|AFK35926.1|  unknown                                                 208   6e-63    
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7             219   6e-63    
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6             219   7e-63    
dbj|BAJ97179.1|  predicted protein                                      219   8e-63    
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6             219   8e-63    
emb|CDY02347.1|  BnaA09g25550D                                          219   8e-63    
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                    219   8e-63    
emb|CDX78975.1|  BnaA01g10420D                                          219   8e-63    
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    218   1e-62    
dbj|BAJ91572.1|  predicted protein                                      219   1e-62    
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    219   1e-62    
emb|CAA16619.1|  vacuolar sorting receptor-like protein                 218   1e-62    
ref|NP_193744.1|  vacuolar-sorting receptor 7                           218   1e-62    
ref|NP_001190777.1|  vacuolar-sorting receptor 7                        218   1e-62    
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg             218   1e-62    
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857             218   2e-62    
dbj|BAJ88964.1|  predicted protein                                      218   3e-62    
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                        217   5e-62    
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg             216   7e-62    
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7             216   9e-62    
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like        216   1e-61    
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg             216   1e-61    
gb|AAM96969.1|  vacuolar sorting receptor-like protein                  215   2e-61    
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733             215   2e-61    
ref|NP_174375.1|  vacuolar sorting receptor 6                           214   6e-61    
gb|AAF98196.1|AC000107_19  F17F8.23                                     214   1e-60    
gb|KEH37345.1|  vacuolar-sorting receptor                               213   1e-60    
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like        213   1e-60    
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like        213   2e-60    
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like        213   2e-60    
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like        212   2e-60    
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6             212   2e-60    
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like        211   4e-60    
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like        210   1e-59    
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    210   1e-59    
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg             208   7e-59    
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7             207   3e-58    
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180          197   1e-54    
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5             194   1e-53    
ref|NP_181040.1|  vacuolar-sorting receptor 5                           192   4e-53    
emb|CAE03573.2|  OSJNBa0085I10.18                                       192   6e-53    
ref|NP_001053838.1|  Os04g0611400                                       192   9e-53    
gb|EPS72755.1|  hypothetical protein M569_02000                         189   2e-52    
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210             187   3e-51    
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    187   3e-51    
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5             187   4e-51    
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    187   4e-51    
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    189   7e-51    
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like        186   7e-51    
ref|XP_006374052.1|  hypothetical protein POPTR_0016s14430g             185   1e-50    
emb|CDY64650.1|  BnaAnng19540D                                          185   2e-50    
emb|CDY43647.1|  BnaA04g20440D                                          183   9e-50    
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like        183   1e-49    
gb|EMT28757.1|  hypothetical protein F775_13214                         179   1e-49    
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg             183   1e-49    
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg             183   1e-49    
ref|NP_001176319.1|  Os11g0116550                                       172   3e-48    
emb|CDP17487.1|  unnamed protein product                                176   1e-47    
ref|XP_003064631.1|  predicted protein                                  177   4e-47    
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335              176   5e-47    
gb|EEE61664.1|  hypothetical protein OsJ_16123                          174   1e-46    
gb|EMS68622.1|  hypothetical protein TRIUR3_18779                       174   2e-46    
ref|XP_007513418.1|  predicted protein                                  172   1e-45    
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100             168   3e-44    
ref|XP_002501193.1|  predicted protein                                  167   5e-44    
ref|XP_011001696.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   5e-44    
ref|XP_002501531.1|  predicted protein                                  165   6e-43    
ref|XP_001419041.1|  predicted protein                                  163   1e-42    
gb|EMT30552.1|  hypothetical protein F775_21497                         161   5e-42    
ref|XP_011401748.1|  Vacuolar-sorting receptor 1                        158   7e-41    
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)          157   4e-40    
ref|XP_002489189.1|  hypothetical protein SORBIDRAFT_0013s004030        152   4e-40    
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site       157   6e-40    
ref|XP_003057973.1|  predicted protein                                  155   5e-39    
gb|KHN26599.1|  Vacuolar-sorting receptor 6                             150   4e-38    
emb|CAC38995.1|  putative EGF receptor-like protein                     140   4e-36    
gb|EEE67817.1|  hypothetical protein OsJ_25571                          143   7e-36    
gb|KDD75638.1|  hypothetical protein H632_c577p0                        135   7e-33    
gb|EMS67136.1|  hypothetical protein TRIUR3_12943                       129   1e-30    
emb|CBI32834.3|  unnamed protein product                                121   6e-30    
ref|XP_010252052.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    125   2e-29    
gb|EMT00255.1|  hypothetical protein F775_19350                         122   2e-28    
ref|XP_005848848.1|  hypothetical protein CHLNCDRAFT_144184             122   6e-28    
tpg|DAA39320.1|  TPA: hypothetical protein ZEAMMB73_030788              113   3e-27    
gb|ABZ85676.1|  putative sorting receptor                               115   6e-27    
ref|XP_005643046.1|  hypothetical protein COCSUDRAFT_49231              119   1e-26    
gb|KHN42446.1|  Vacuolar-sorting receptor 4                             101   4e-23    
ref|XP_002489190.1|  hypothetical protein SORBIDRAFT_0013s004040        103   7e-23    
tpg|DAA45230.1|  TPA: hypothetical protein ZEAMMB73_518849              105   8e-23    
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like        107   1e-22    
tpg|DAA45231.1|  TPA: hypothetical protein ZEAMMB73_518849              101   1e-22    
gb|EJY73103.1|  Vacuolar sorting receptor                               102   3e-21    
gb|EMT28756.1|  hypothetical protein F775_27608                       97.4    3e-21    
gb|KJB14245.1|  hypothetical protein B456_002G116200                  94.7    3e-19    
gb|KJB14246.1|  hypothetical protein B456_002G116200                  95.5    3e-19    
ref|XP_001701186.1|  vacuolar sorting receptor                        97.4    3e-19    
ref|XP_009107752.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  94.7    4e-19    
emb|CDW90025.1|  UNKNOWN                                              93.6    2e-18    
gb|EJK43726.1|  hypothetical protein THAOC_37793                      91.7    2e-17    
gb|EJK66490.1|  hypothetical protein THAOC_12589                      91.3    2e-17    
emb|CDY22565.1|  BnaC05g24030D                                        85.5    3e-17    
ref|XP_002294134.1|  predicted protein                                90.9    3e-17    
gb|EAZ37923.1|  hypothetical protein OsJ_22274                        85.1    4e-17    
gb|EMS45035.1|  hypothetical protein TRIUR3_18121                     83.6    3e-16    
ref|XP_003603017.1|  Vacuolar sorting receptor                        82.0    3e-16    
ref|XP_002294135.1|  predicted protein                                87.4    4e-16    
ref|XP_002536854.1|  hypothetical protein RCOM_1789310                80.5    1e-15    
gb|EMT00254.1|  hypothetical protein F775_19349                       80.9    1e-15    
ref|XP_002956789.1|  hypothetical protein VOLCADRAFT_119519           86.3    1e-15    
emb|CCI44781.1|  unnamed protein product                              85.9    2e-15    
emb|CCA16097.1|  vacuolarsorting receptor putative                    85.9    2e-15    
gb|AES73268.2|  vacuolar sorting receptor protein, putative           79.3    2e-15    
gb|EJY73798.1|  Vacuolar sorting receptor 3                           84.7    2e-15    
gb|EJY86065.1|  Vacuolar-sorting receptor 1                           85.1    2e-15    
gb|KIZ02215.1|  Vacuolar-sorting receptor 2                           81.6    3e-15    
gb|KIZ05710.1|  Vacuolar-sorting receptor 2                           80.5    7e-15    
ref|XP_002176818.1|  predicted protein                                82.8    1e-14    
emb|CDW89394.1|  vacuolar sorting receptor 3                          82.4    2e-14    
ref|XP_002182623.1|  predicted protein                                82.4    2e-14    
gb|AIG55531.1|  secreted protein                                      80.5    6e-14    
gb|EJY76506.1|  Vacuolar sorting receptor 3                           80.1    9e-14    
gb|KDO23286.1|  hypothetical protein SPRG_11600                       79.7    1e-13    
ref|XP_008610541.1|  hypothetical protein SDRG_06538                  79.3    2e-13    
ref|XP_002908795.1|  vacuolar-sorting receptor, putative              79.3    2e-13    
gb|ETL86586.1|  hypothetical protein L917_14009                       76.6    2e-12    
ref|XP_008910397.1|  hypothetical protein PPTG_15123                  76.6    2e-12    
gb|EMS55782.1|  Vacuolar-sorting receptor 7                           75.9    3e-12    
gb|ETM39748.1|  hypothetical protein L914_14135                       75.1    5e-12    
gb|ETO68436.1|  hypothetical protein F444_14699                       75.1    5e-12    
gb|ETK79878.1|  hypothetical protein L915_14314                       75.1    5e-12    
emb|CBN77734.1|  conserved unknown protein                            74.7    7e-12    
ref|XP_009529907.1|  hypothetical protein PHYSODRAFT_506174           74.3    9e-12    



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 191/213 (90%), Gaps = 0/213 (0%)
 Frame = +2

Query  131  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  310
            MG SE+ KA +LLG  LL L E AAGRFVVEKN+L+V SP+SIKG +DSA+GNFGIPQYG
Sbjct  1    MGCSERSKAAVLLGFSLLILAELAAGRFVVEKNSLRVISPESIKGNHDSAIGNFGIPQYG  60

Query  311  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  490
            GSM+GTV+YPKDN+KGCK FD FGISF +KAG+LP FV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSMSGTVLYPKDNKKGCKNFDDFGISFKAKAGALPNFVLVDRGDCFFALKVWNAQNAGAA  120

Query  491  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  670
            A+LVAD+++E LITMD+PEE G+S+ Y+ NITIPSALI+KSFGEKLKKAV DGEMV+VNL
Sbjct  121  AVLVADNLDEALITMDTPEESGASAKYIANITIPSALIDKSFGEKLKKAVTDGEMVNVNL  180

Query  671  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLM  769
            DWREAVPHPDDRVEYELWTNSNDECG KCDMLM
Sbjct  181  DWREAVPHPDDRVEYELWTNSNDECGVKCDMLM  213



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = +2

Query  131  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  310
            MG SE+PK  ILLGLLLLTL E   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGCSERPKGAILLGLLLLTLAEIVVGRFVVEKNSLRVLSPDSIKGTHDSAIGNFGIPQYG  60

Query  311  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  490
            G M GTVVYP+DNRKGCK FD  GISF +KAG+LP FV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GRMGGTVVYPRDNRKGCKSFDDSGISFKAKAGALPNFVLVDRGDCFFALKVWNAQNAGAA  120

Query  491  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  670
            A+LVADD++E LITMDSPEEDG+S+ Y+ NITIPSALI+KSFGEKLKKA+ +G+MV+VNL
Sbjct  121  AVLVADDLDEPLITMDSPEEDGASARYIANITIPSALIDKSFGEKLKKAISEGDMVNVNL  180

Query  671  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLMK  772
            DWREAVPHPDDRVEYELWTNSNDECG KCDMLM+
Sbjct  181  DWREAVPHPDDRVEYELWTNSNDECGVKCDMLME  214



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = +2

Query  131  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  310
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  311  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  490
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAA  120

Query  491  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  670
            A+LVADDV+ERLITMDSPE DGSS+ Y+ENITIPSALIEKSF EKLKKAV  GEM++VNL
Sbjct  121  AVLVADDVDERLITMDSPEADGSSAKYIENITIPSALIEKSFAEKLKKAVSAGEMINVNL  180

Query  671  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLMK  772
            DWREAVPHPDDRVEYELWT+SNDECG+KCDMLMK
Sbjct  181  DWREAVPHPDDRVEYELWTSSNDECGFKCDMLMK  214



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = +2

Query  131  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  310
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  311  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  490
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAA  120

Query  491  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  670
            A+LVADDV+ERLITMDSPE DGSS+ Y+ENITIPSALIEK+F EKLKKAV  GEMV+VNL
Sbjct  121  AVLVADDVDERLITMDSPEADGSSAKYIENITIPSALIEKNFAEKLKKAVSAGEMVNVNL  180

Query  671  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLMK  772
            DWREAVPHPDDRVEYELWT+SNDECG+KCDMLMK
Sbjct  181  DWREAVPHPDDRVEYELWTSSNDECGFKCDMLMK  214



>emb|CAN79862.1| hypothetical protein VITISV_021998 [Vitis vinifera]
Length=599

 Score =   336 bits (861),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GIS
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  88   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  147

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEKSFGEKLKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIENITIPSALIEKSFGEKLKKAITSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  208  VKCDMLME  215



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   337 bits (863),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GIS
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  88   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  147

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEKSFGEKLKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  148  YIENITIPSALIEKSFGEKLKKAITSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  207

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  208  VKCDMLME  215



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GIS
Sbjct  33   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  92

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  93   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  152

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEKSFGEKLKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  153  YIENITIPSALIEKSFGEKLKKAITSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  212

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  213  VKCDMLME  220



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   335 bits (858),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
              GISF SK+G++PTFV+VDRGDC FALK WNAQNAGA+A+LVADDV+ERLITMD+PE D
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAAAVLVADDVDERLITMDTPEAD  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
            GSS+ Y+ENITIPSALIEKSF EKLKKAV  GEMV+VNLDWREAVPHPDDRVEYELWT+S
Sbjct  143  GSSAKYIENITIPSALIEKSFAEKLKKAVSAGEMVNVNLDWREAVPHPDDRVEYELWTSS  202

Query  734  NDECGYKCDMLMK  772
            NDECG+KCDMLMK
Sbjct  203  NDECGFKCDMLMK  215



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   334 bits (857),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
              GISF SK+G++PTFV+VDRGDC FALK WNAQNAGA+A+LVADDV+ERLITMD+PE D
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAAAVLVADDVDERLITMDTPEAD  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
            GSS+ Y+ENITIPSALIEKSF EKLKKAV  GEMV+VNLDWREAVPHPDDRVEYELWT+S
Sbjct  143  GSSAKYIENITIPSALIEKSFAEKLKKAVNAGEMVNVNLDWREAVPHPDDRVEYELWTSS  202

Query  734  NDECGYKCDMLMK  772
            NDECG+KCDMLMK
Sbjct  203  NDECGFKCDMLMK  215



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDN+KGCK FD 
Sbjct  26   SCVGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNKKGCKEFDD  85

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FG+SF S+ G+LPTFV++DRGDC FALK WNAQ AGASA+LV+DD+EE LITMD+PEEDG
Sbjct  86   FGVSFKSRPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVSDDIEEPLITMDTPEEDG  145

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+NY+ENITIPSALIEKSFGE LKKA+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  146  SSANYIENITIPSALIEKSFGEILKKALSNGDMVNVNLDWREAVPHPDDRVEYELWTNSN  205

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  206  DECGVKCDMLME  217



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = +2

Query  131  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  310
            MG  E+ K+ ILLG L+L L +   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGRYERSKSAILLGFLVLNLTQLVMGRFVVEKNSLRVTSPDSIKGTHDSAIGNFGIPQYG  60

Query  311  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  490
            GSM+GTVV+PK+N+KGCK F  FG SF  K+G++P F++VDRGDC FALK WNAQNAGAS
Sbjct  61   GSMSGTVVFPKENQKGCKTFSDFGSSFKPKSGAMPNFLLVDRGDCLFALKVWNAQNAGAS  120

Query  491  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNL  670
            A+LVADDV+E LITMDSPEE+ SS+ Y+ENITIPSALIEKSFGEKLKKA+  GEMV VNL
Sbjct  121  AVLVADDVDEALITMDSPEEERSSAKYIENITIPSALIEKSFGEKLKKAINAGEMVSVNL  180

Query  671  DWREAVPHPDDRVEYELWTNSNDECGYKCDMLM  769
            DWREAVPHPDDRVEYELWTNSNDECG+KCDMLM
Sbjct  181  DWREAVPHPDDRVEYELWTNSNDECGFKCDMLM  213



>ref|XP_007042634.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
 gb|EOX98465.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
Length=501

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FGIS
Sbjct  23   RFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGIS  82

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED SS+ 
Sbjct  83   FQSKPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDTSSAK  142

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEK+FGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  143  YLENITIPSALIEKTFGETLKKAISGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  202

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  203  VKCDMLME  210



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G V+YPKDNRKGCK FD 
Sbjct  22   SSIAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVLYPKDNRKGCKEFDD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF SK G+LPTFV++DRG+C FALK WNAQ AGASA+LVADD+EE+LITMD+PEEDG
Sbjct  82   SGISFKSKPGALPTFVLLDRGNCFFALKVWNAQKAGASAVLVADDIEEKLITMDTPEEDG  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK FGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKKFGEKLKSAISSGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  202  DECGVKCDMLME  213



>gb|KEH44022.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=529

 Score =   326 bits (836),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDG
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDG  142

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  143  SSAKYIENITIPSALIEKNFGEKLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  202

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFGI
Sbjct  26   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGI  85

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+P ED SS+
Sbjct  86   SFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEPLITMDTPAEDASSA  145

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSALIEKSF E LKKA+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  146  QYIENITIPSALIEKSFSETLKKALSNGDMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  205

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  206  GVKCDMLME  214



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFGI
Sbjct  26   ARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGI  85

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+P ED SS+
Sbjct  86   SFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEPLITMDTPAEDVSSA  145

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSALIEKSF E LKKA+ DG+MV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  146  QYIENITIPSALIEKSFSETLKKALSDGDMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  205

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  206  GVKCDMLME  214



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+  RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDG
Sbjct  23   SSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDG  82

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF SK G+LPTFV+VDRGDC FALK WNAQ  GASA+LVADD+EE LITMD+PEED 
Sbjct  83   FGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKVGASAVLVADDMEEALITMDTPEEDV  142

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEKSFGE LKK++ +G+MV+VNLDWREAVPHPDDRVEYELWT SN
Sbjct  143  SSAKYIENITIPSALIEKSFGETLKKSLSNGDMVNVNLDWREAVPHPDDRVEYELWTTSN  202

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N KGCK FD F
Sbjct  29   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENMKGCKDFDDF  88

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF +K+G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSP+EDG 
Sbjct  89   GISFKTKSGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEPLITMDSPQEDGG  148

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALI+K FG+KLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  149  SAKYIENITIPSALIDKKFGDKLKKALSSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  208

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  209  ECGVKCDMLME  219



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S   RFVVEKN+L+V SPD I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F  
Sbjct  25   SLHARFVVEKNSLRVTSPDRIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFSD  84

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            +GISF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDG
Sbjct  85   YGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEALITMDSPEEDG  144

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            S++ Y+ENITIPSALIEKSFGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  145  STAKYIENITIPSALIEKSFGETLKKAINSGDMVNVNLDWREAVPHPDDRVEYELWTNSN  204

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  205  DECGVKCDMLME  216



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDG
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDG  142

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  143  SSAKYIENITIPSALIEKNFGEKLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  202

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  23   SSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFEE  82

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED 
Sbjct  83   FRISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEALITMDTPEEDV  142

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEKSFGE LKKA+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  143  SSAKYIENITIPSALIEKSFGETLKKALSNGDMVNVNLDWREAVPHPDDRVEYELWTNSN  202

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  203  DECGVKCDMLME  214



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   327 bits (837),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFSEF  81

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GI+F S  G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  82   GITFKSSPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEALITMDSPEEDGS  141

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            +S Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  142  TSKYIENITIPSALIEKRFGEXLKKAISAGDMVNVNLDWREAVPHPDDRVEYELWTNSND  201

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   326 bits (836),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FGIS
Sbjct  23   RFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGIS  82

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED SS+ 
Sbjct  83   FQSKPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDTSSAK  142

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEK+FGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  143  YLENITIPSALIEKTFGETLKKAISGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  202

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  203  VKCDMLME  210



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   325 bits (834),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD  GIS
Sbjct  3    KFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDESGIS  62

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDGSS+ 
Sbjct  63   FKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDGSSAK  122

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEK+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  123  YIENITIPSALIEKNFGEKLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECG  182

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  183  VKCDMLME  190



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+KGCK FD F I
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKGCKAFDEFSI  83

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED SSS
Sbjct  84   SFPSKPGSLPTFVLVDRGDCFFALKVWNVQKAGASAVLVADDIEEALITMDTPEEDSSSS  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSALI+KSFGE LKKA+   +MV+VNLDWRE+VPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALIQKSFGEALKKAISGADMVNVNLDWRESVPHPDDRVEYELWTNSNDEC  203

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   
Sbjct  25   SVARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDA  84

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS
Sbjct  85   GISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEERLITMDSPEEDGS  144

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFGEKLKK +  GEMV V+LDWREAVPHPDDRVEYELWTNSND
Sbjct  145  TAKYIENITIPSALIEKSFGEKLKKEISSGEMVSVSLDWREAVPHPDDRVEYELWTNSND  204

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  205  ECGVKCDMLME  215



>ref|XP_012093114.1| PREDICTED: vacuolar-sorting receptor 3 [Jatropha curcas]
 gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDNRKGCK F+ F
Sbjct  24   SVARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNRKGCKDFNDF  83

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            G+SF S+ G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  84   GLSFKSQPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEPLITMDSPEEDGS  143

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENIT+PSALIEKSFGE LKKA   G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  ATKYIENITVPSALIEKSFGEMLKKATSSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  204  ECGVKCDMLME  214



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GI F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFG+ LKKA+  G+MV+VNLDWREAVPHPDDRVEY+LWTNSND
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAINAGDMVNVNLDWREAVPHPDDRVEYQLWTNSND  201

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+K CK FD F I
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKACKAFDEFSI  83

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED SSS
Sbjct  84   SFQSKPGSLPTFVLVDRGDCFFALKVWNVQKAGASAVLVADDIEEALITMDTPEEDSSSS  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSALI+KSFGE LKKA+   +MV+VNLDWRE+VPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALIQKSFGEALKKAISGADMVNVNLDWRESVPHPDDRVEYELWTNSNDEC  203

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   GIS
Sbjct  29   RFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAGIS  88

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS++ 
Sbjct  89   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNLEERLITMDSPEEDGSTAK  148

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEKSFGEKLKK +  GEMV V+LDWREAVPHPDDRVEYELWTNSNDECG
Sbjct  149  YIENITIPSALIEKSFGEKLKKEINSGEMVSVSLDWREAVPHPDDRVEYELWTNSNDECG  208

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  209  VKCDMLME  216



>gb|KJB12290.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=532

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  737  DECGYKCDMLM  769
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GI F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFG+ LKKA+  G+MV+VNLDWREAVPHPDDRVEY+LWTNSND
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAINAGDMVNVNLDWREAVPHPDDRVEYQLWTNSND  201

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKN+L+V SPD IKGTYD+A+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDTAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GI F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFG+ LKKA+  G+MV+VNLDWREAVPHPDDRVEY+LWTNSND
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAINAGDMVNVNLDWREAVPHPDDRVEYQLWTNSND  201

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  202  ECGVKCDMLME  212



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            ++  GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM G VVYPKDNRKGCK FD
Sbjct  22   QAVVGRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGIVVYPKDNRKGCKNFD  81

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FGISF +KAG++P FV+VDRGDC FALK WNAQNAGA+A+LVADD++E LITMDSPEED
Sbjct  82   DFGISFKAKAGAMPNFVLVDRGDCFFALKVWNAQNAGAAAVLVADDLDEPLITMDSPEED  141

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             +S+ Y+ NITIPSAL++K+FGEKLK+A+  G+MV+VNLDWREAVPHPDDRVEYELW+NS
Sbjct  142  AASAKYIVNITIPSALVDKNFGEKLKQAISGGDMVNVNLDWREAVPHPDDRVEYELWSNS  201

Query  734  NDECGYKCDMLMK  772
            NDECG KCDMLM+
Sbjct  202  NDECGVKCDMLME  214



>gb|KJB12295.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=477

 Score =   320 bits (819),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  737  DECGYKCDMLM  769
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   324 bits (830),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF S  G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  83   GISFKSTPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEALITMDSPEEDGS  142

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFG+ LKK++  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  143  TAKYIENITIPSALIEKSFGQTLKKSISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  202

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  203  ECGVKCDMLME  213



>gb|KCW63607.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=578

 Score =   322 bits (826),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF SK G LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EERLITMDSPEEDGS
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEERLITMDSPEEDGS  155

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  156  TAKYIENITIPSALIEKSFGETLKKAISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  215

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  216  ECGVKCDMLME  226



>gb|KDO57883.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=410

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  734  NDECGYKCDMLM  769
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F+ F
Sbjct  28   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENMKACKDFNEF  87

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            G SF +K G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD+VEE LITMDSP+EDG 
Sbjct  88   GTSFKAKPGALPTFVLVDRGDCFFALKVWNAQNAGASAVLVADNVEEPLITMDSPQEDGG  147

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALI+K+FGEKLKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  148  STKYIENITIPSALIDKNFGEKLKKALSAGDMVNVNLDWREAVPHPDDRVEYELWTNSND  207

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  208  ECGVKCDMLME  218



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF SK G LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EERLITMDSPEEDGS
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEERLITMDSPEEDGS  155

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  156  TAKYIENITIPSALIEKSFGETLKKAISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  215

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  216  ECGVKCDMLME  226



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LV+DD+EE+LITMD+PEEDGS
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVSDDIEEKLITMDTPEEDGS  143

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKVAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  204  ECGVKCDMLME  214



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF S  G+LP FV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  83   GISFKSTPGALPKFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEPLITMDSPEEDGS  142

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            +S Y+ENITIPSALIEKSFG+ LKK++  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  143  TSKYIENITIPSALIEKSFGQTLKKSISSGDMVNVNLDWREAVPHPDDRVEYELWTNSND  202

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  203  ECGVKCDMLME  213



>gb|KJB12294.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=604

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  737  DECGYKCDMLM  769
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>gb|KJB32253.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=559

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGI
Sbjct  26   ARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGI  85

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++
Sbjct  86   SFKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAA  145

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWRE+VPHPDDRVEYELWTNSNDEC
Sbjct  146  KYIENITIPSALIEKKFGETLKKAISGGDMVNVNLDWRESVPHPDDRVEYELWTNSNDEC  205

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  206  GVKCDMLME  214



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LV+DD+EE+LITMD+PEEDGS
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVSDDIEEKLITMDTPEEDGS  143

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKVAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  740  ECGYKCDMLMK  772
            ECG KCD LM+
Sbjct  204  ECGVKCDTLME  214



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  737  DECGYKCDMLM  769
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   319 bits (817),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSALIEK+FGE LKKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSN  201

Query  737  DECGYKCDMLM  769
            DECG KCDMLM
Sbjct  202  DECGVKCDMLM  212



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+ E+LITMD+PEED S
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVADDIVEKLITMDTPEEDVS  143

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKDAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  204  ECGVKCDMLME  214



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+ E+LITMD+PEED S
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVADDIVEKLITMDTPEEDVS  143

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALIEKSFGEKLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKDAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  204  ECGVKCDMLME  214



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD  
Sbjct  23   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVVYPKENQKGCKEFDDS  82

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+EE+LITMD+PEEDGS
Sbjct  83   GISFKSKPGALPTVVLLDRGNCFFALKVWNAQKAGASAVLVADDIEEKLITMDTPEEDGS  142

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALIEKSFG KLK A+ +G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  143  SAKYIENITIPSALIEKSFGGKLKDAISNGDMVNVNLDWREAVPHPDDRVEYELWTNSND  202

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  203  ECGVKCDMLME  213



>gb|KDO57886.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=560

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  734  NDECGYKCDMLM  769
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L V SPDSI+G +DSA+GNFG+PQYGGSM G VVYPKDN+KGCKGFD FG+
Sbjct  7    GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  66

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK G+LPTFV++DRG C F LK WNAQNAGA+A+LVADD +E LITMDSPEED  ++
Sbjct  67   SFKSKLGALPTFVMLDRGGCFFTLKVWNAQNAGAAAVLVADDTDEPLITMDSPEEDDKAA  126

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI+K+FG+KLKKA+ +GEMV+VNLDWREAVPHPDDRVEYE WTNSNDEC
Sbjct  127  RYIQNITIPSALIDKNFGDKLKKALSNGEMVNVNLDWREAVPHPDDRVEYEFWTNSNDEC  186

Query  746  GYKCDMLM  769
            G KCDM+M
Sbjct  187  GPKCDMIM  194



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   315 bits (808),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGIS
Sbjct  27   RFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGIS  86

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++ 
Sbjct  87   FKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAAK  146

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWRE+VPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKKFGETLKKAISGGDMVNVNLDWRESVPHPDDRVEYELWTNSNDECG  206

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  207  VKCDMLME  214



>ref|XP_011625221.1| PREDICTED: vacuolar-sorting receptor 3 isoform X2 [Amborella 
trichopoda]
Length=627

 Score =   316 bits (809),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L V SPDSI+G +DSA+GNFG+PQYGGSM G VVYPKDN+KGCKGFD FG+
Sbjct  25   GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK G+LPTFV++DRG C F LK WNAQNAGA+A+LVADD +E LITMDSPEED  ++
Sbjct  85   SFKSKLGALPTFVMLDRGGCFFTLKVWNAQNAGAAAVLVADDTDEPLITMDSPEEDDKAA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI+K+FG+KLKKA+ +GEMV+VNLDWREAVPHPDDRVEYE WTNSNDEC
Sbjct  145  RYIQNITIPSALIDKNFGDKLKKALSNGEMVNVNLDWREAVPHPDDRVEYEFWTNSNDEC  204

Query  746  GYKCDMLM  769
            G KCDM+M
Sbjct  205  GPKCDMIM  212



>ref|XP_006849341.2| PREDICTED: vacuolar-sorting receptor 3 isoform X1 [Amborella 
trichopoda]
Length=629

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L V SPDSI+G +DSA+GNFG+PQYGGSM G VVYPKDN+KGCKGFD FG+
Sbjct  25   GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK G+LPTFV++DRG C F LK WNAQNAGA+A+LVADD +E LITMDSPEED  ++
Sbjct  85   SFKSKLGALPTFVMLDRGGCFFTLKVWNAQNAGAAAVLVADDTDEPLITMDSPEEDDKAA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI+K+FG+KLKKA+ +GEMV+VNLDWREAVPHPDDRVEYE WTNSNDEC
Sbjct  145  RYIQNITIPSALIDKNFGDKLKKALSNGEMVNVNLDWREAVPHPDDRVEYEFWTNSNDEC  204

Query  746  GYKCDMLM  769
            G KCDM+M
Sbjct  205  GPKCDMIM  212



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGIS
Sbjct  27   RFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGIS  86

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++ 
Sbjct  87   FKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAAK  146

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSALIEK FGE LKKA+  G+MV+VNLDWRE+VPHPDDRVEYELWTNSNDECG
Sbjct  147  YIENITIPSALIEKKFGETLKKAISGGDMVNVNLDWRESVPHPDDRVEYELWTNSNDECG  206

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  207  VKCDMLME  214



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  734  NDECGYKCDMLM  769
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  734  NDECGYKCDMLM  769
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  140

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ YVENITIPSAL+ KSF +KLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  141  SSAKYVENITIPSALVGKSFAQKLKDAIIVGDMVNVNLDWREAVPHPDDRVEYELWTNSN  200

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  201  DECGLKCDMLMQ  212



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  140

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ YVENITIPSAL+ KSF +KLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSN
Sbjct  141  SSAKYVENITIPSALVGKSFAQKLKDAIIVGDMVNVNLDWREAVPHPDDRVEYELWTNSN  200

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  201  DECGLKCDMLMQ  212



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             SS+ Y+ENITIPSALI+KSFGE LKKA+  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  734  NDECGYKCDMLM  769
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S   RFVVEKN+L+V SPD +KGTYD+A+GNFGIPQYGGSM GTV+YPKDN+KGCK F  
Sbjct  28   SIESRFVVEKNSLRVTSPDDVKGTYDTAIGNFGIPQYGGSMAGTVIYPKDNKKGCKDFSD  87

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF  K G LPTFV++DRGDC FALK WNAQ AGA+A+LVADDV+E LITMD+PEED 
Sbjct  88   FSISFKKKPGQLPTFVLLDRGDCFFALKVWNAQEAGAAAVLVADDVDEALITMDTPEEDT  147

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             SS Y+ENITIPSALIEKSFGE LKKA   G+MV+VNLDWREAVPHPDDRVEYELWT SN
Sbjct  148  VSSKYIENITIPSALIEKSFGESLKKAFNKGDMVNVNLDWREAVPHPDDRVEYELWTTSN  207

Query  737  DECGYKCDMLM  769
            DECG KC+MLM
Sbjct  208  DECGVKCEMLM  218



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L+V SPD IKG YDSA+GNFG+PQYGGSM+G V+YPK+N+KGCK F  F
Sbjct  23   STARFVVEKNSLRVTSPDKIKGKYDSAIGNFGLPQYGGSMSGAVIYPKENQKGCKEFSDF  82

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            G+S+ S  G+LPTF++VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  83   GLSYKSTPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDIS  142

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALIEKSFG+ LKK++  G+MV+VNLDWRE+VPHPDDRVEYELWTNSND
Sbjct  143  TAKYIENITIPSALIEKSFGQTLKKSISSGDMVNVNLDWRESVPHPDDRVEYELWTNSND  202

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  203  ECGVKCDMLME  213



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   314 bits (804),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             SS+ Y+ENITIPSALI+KSFGE LKK++  GEMV+VNLDWREAVPHPDDRVEYELWTNS
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKSLSGGEMVNVNLDWREAVPHPDDRVEYELWTNS  202

Query  734  NDECGYKCDMLM  769
            NDECG KCDMLM
Sbjct  203  NDECGVKCDMLM  214



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  155

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ YVENITIPSAL+ KSFG KLK A   G+MV++NLDWRE+VPHPDDRVEYELWTNSN
Sbjct  156  SSAKYVENITIPSALVGKSFGLKLKDAFSGGDMVNLNLDWRESVPHPDDRVEYELWTNSN  215

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  216  DECGVKCDMLME  227



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 167/192 (87%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  155

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ YVENITIPSAL+ KSFG KLK A   G+MV++NLDWRE+VPHPDDRVEYELWTNSN
Sbjct  156  SSAKYVENITIPSALVGKSFGLKLKDAFSGGDMVNLNLDWRESVPHPDDRVEYELWTNSN  215

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  216  DECGVKCDMLME  227



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  19   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNKKGCKEFED  78

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF S  G+LPTFV++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  79   SGISFKSTPGALPTFVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  138

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ YV NITIPSAL+ KSFGEKLK A+  G+MV+VNLDWRE+VPHPDDRVEYELW+NSN
Sbjct  139  SSAKYVANITIPSALVGKSFGEKLKDAISGGDMVNVNLDWRESVPHPDDRVEYELWSNSN  198

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  199  DECGVKCDMLME  210



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  27   ARFVVEKNSLSVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  86

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  87   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  146

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  147  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  206

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  207  GVKCDMLME  215



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S   RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  
Sbjct  19   SCEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSD  78

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED 
Sbjct  79   FSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDV  138

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS+ Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSN
Sbjct  139  SSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSN  198

Query  737  DECGYKCDMLMK  772
            DECG KCDMLM+
Sbjct  199  DECGVKCDMLME  210



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ KSFGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKSFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENQKACKEFSDFSI  90

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF+++DRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  150

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ KSFGEK+KKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  151  KYIENITIPSALVTKSFGEKMKKAISRGDMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  210

Query  746  GYKCDMLMK  772
            G KCDM+M+
Sbjct  211  GVKCDMMMQ  219



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  85   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  205  GVKCDMLME  213



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  203  GVKCDMLME  211



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  203  GVKCDMLME  211



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   311 bits (796),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  203  GVKCDMLME  211



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   311 bits (796),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  203

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   311 bits (796),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  144  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  203

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  204  GVKCDMLME  212



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   311 bits (796),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ KSFGEKLKKA   G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKSFGEKLKKATSGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   311 bits (796),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N K CK F  F I
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENHKACKEFSDFSI  90

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF+++DRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  150

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ KSFGEK+KKA+  G+MV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  151  KYIENITIPSALVTKSFGEKMKKAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  210

Query  746  GYKCDMLMK  772
            G KCDM+M+
Sbjct  211  GVKCDMMMQ  219



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  141

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 4 isoform X2 [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   309 bits (792),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F I
Sbjct  25   GRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDFHI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS++
Sbjct  85   SFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGSTA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  TYVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  746  GYKCDMLMK  772
            G+KCDMLM+
Sbjct  205  GFKCDMLME  213



>ref|XP_011652916.1| PREDICTED: vacuolar-sorting receptor 4 isoform X1 [Cucumis sativus]
Length=633

 Score =   309 bits (792),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F I
Sbjct  25   GRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDFHI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS++
Sbjct  85   SFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGSTA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  TYVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  746  GYKCDMLMK  772
            G+KCDMLM+
Sbjct  205  GFKCDMLME  213



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ KSFGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKSFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  202

Query  746  GYKCDMLMK  772
            G KC+MLM+
Sbjct  203  GVKCNMLME  211



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 4/190 (2%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKD-NRKGCKGFDGFG  382
            GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPKD NRKGCK FD   
Sbjct  1    GRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVLYPKDDNRKGCKTFDA--  58

Query  383  ISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  562
             SF + AG+LP F++VDRGDC FALK WNAQNAGA+A+LVADDV E LITMD+PEEDGSS
Sbjct  59   -SFKANAGALPNFLLVDRGDCFFALKVWNAQNAGAAAVLVADDVSEALITMDTPEEDGSS  117

Query  563  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  742
             +Y+ NITIPSAL+ KSFGEKLKKAV  G+MV ++LDWRE+VPHPDDRVEYELWTNSNDE
Sbjct  118  LSYIANITIPSALVTKSFGEKLKKAVSSGDMVSLSLDWRESVPHPDDRVEYELWTNSNDE  177

Query  743  CGYKCDMLMK  772
            CG KCDMLM+
Sbjct  178  CGVKCDMLME  187



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  F
Sbjct  25   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDF  84

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED S
Sbjct  85   SISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVS  144

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSAL+ K+FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSND
Sbjct  145  SAKYIENITIPSALVTKTFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSND  204

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  205  ECGVKCDMLME  215



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   308 bits (789),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 166/191 (87%), Gaps = 3/191 (2%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQ-  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF S+ G+LPT +++DRG+C FALK WNAQ AGASA+LVADD+EE LITMD+PEEDGS
Sbjct  79   --SFKSRPGALPTILLLDRGNCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDGS  136

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALIEKSFGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  137  SAKYIENITIPSALIEKSFGEKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  196

Query  740  ECGYKCDMLMK  772
            ECG KCDML++
Sbjct  197  ECGVKCDMLIE  207



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   308 bits (788),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSAL+ KSFGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDECG
Sbjct  141  YIENITIPSALVTKSFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDECG  200

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  201  VKCDMLME  208



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F I
Sbjct  25   ARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDFHI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS++
Sbjct  85   SFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGSTA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  TYVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  746  GYKCDMLMK  772
            G+KCDMLM+
Sbjct  205  GFKCDMLME  213



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F I
Sbjct  25   ARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDFHI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS++
Sbjct  85   SFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGSTA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             YVENITIPSALI K F E+LKK +  GEMV ++LDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  TYVENITIPSALIRKGFSEQLKKEINAGEMVSLSLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  746  GYKCDMLMK  772
            G+KCDMLM+
Sbjct  205  GFKCDMLME  213



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  94   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  153

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  154  SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  213

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  214  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  273

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  274  GVKCDMLME  282



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F  F I
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENHKSCKEFSDFSI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  85   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  145  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  204

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  205  GVKCDMLME  213



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 166/191 (87%), Gaps = 3/191 (2%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQ-  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF S+ G+LPT +++DRG+C FALK WNAQ AGASA+LVADD+EE LITMD+PEEDGS
Sbjct  79   --SFKSRPGALPTILLLDRGNCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDGS  136

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALIEKSFGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  137  SAKYIENITIPSALIEKSFGEKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  196

Query  740  ECGYKCDMLMK  772
            ECG KCDML++
Sbjct  197  ECGVKCDMLIE  207



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  F
Sbjct  25   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDF  84

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED S
Sbjct  85   SISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDIS  144

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ YVENITIPSAL+ K FGEKLKK++  G+MV++NLDWREAVPHPD RVEYELWTNSND
Sbjct  145  SAKYVENITIPSALVTKGFGEKLKKSISGGDMVNLNLDWREAVPHPDARVEYELWTNSND  204

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  205  ECGVKCDMLME  215



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   306 bits (783),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  141

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  202  GVKCDMLME  210



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDECG
Sbjct  141  YIENITIPSALVTKGFGEKLKKAIGGGDMVNLNLDWREAVPHPDARVEYELWTNSNDECG  200

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  201  VKCDMLME  208



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F S+ G+LPTF++VDRGDC FALK WNAQ  GASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKTGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            Y+ENITIPSAL+ K FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDECG
Sbjct  141  YIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDECG  200

Query  749  YKCDMLMK  772
             KCDMLM+
Sbjct  201  VKCDMLME  208



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = +2

Query  206  GRFVV--EKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
             RFVV  EKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F
Sbjct  24   ARFVVSNEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  83

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED S
Sbjct  84   SISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVS  143

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSAL+ K FGEKLK+A+  G+MV++NLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  SAKYIENITIPSALVTKGFGEKLKQAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSND  203

Query  740  ECGYKCDMLMK  772
            ECG KCDMLM+
Sbjct  204  ECGVKCDMLME  214



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 3/191 (2%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L V SP+ IKG +DSA+GNFGIPQYGGSM G VVYPKDN KGCK FD  
Sbjct  20   STARFVVEKNSLSVTSPEKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNSKGCKDFDS-  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF S+ G+LPT +++DRG C FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  79   --SFKSRPGALPTILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDVS  136

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALI KSFGEKLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  137  SAKYIENITIPSALIGKSFGEKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  196

Query  740  ECGYKCDMLMK  772
            ECG KCDML++
Sbjct  197  ECGVKCDMLIE  207



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A  +FVVEKN+L+V SP++IKG YDSA+GNFGIPQYGG+M GT VYPK+N+ GCK FD F
Sbjct  29   AMAKFVVEKNSLRVLSPENIKGNYDSAIGNFGIPQYGGTMVGTAVYPKENQNGCKTFDTF  88

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF SK G LP  V+V+RGDC FALK WNAQNAGA+A+LV+DD +E LITMDSPEED S
Sbjct  89   EISFKSKPGGLPNVVLVNRGDCYFALKVWNAQNAGAAAVLVSDDRDEPLITMDSPEEDSS  148

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y++NITIPSALIEK+FG+KLK A+  G+MV++NLDWRE+VPHPDDRVEYELWTNSND
Sbjct  149  AAEYLQNITIPSALIEKAFGDKLKVAINKGDMVNINLDWRESVPHPDDRVEYELWTNSND  208

Query  740  ECGYKCDMLMK  772
            ECG KCD  ++
Sbjct  209  ECGAKCDTQLE  219



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM G VVYPKDN KGCK FD  
Sbjct  21   STARFVVEKNSLSVTSPDKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNNKGCKDFDDS  80

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF SK G+LPT +++DRG C FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  81   S-SFKSKPGALPTILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDVS  139

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            S+ Y+ENITIPSALI K+FG+KLK A+  G+MV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  140  SAKYIENITIPSALIGKTFGQKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSND  199

Query  740  ECGYKCDMLMK  772
            ECG KCDML++
Sbjct  200  ECGVKCDMLIE  210



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKNNLK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTV+YPK N+K CKGFDG  I
Sbjct  21   GRFVVEKNNLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVIYPKANQKACKGFDGVDI  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G LPTFV+VDRGDC F LKAWNAQN GA+AILVADD +E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDKDEPLITMDTPEEENADA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y++NITIPSALI KS G+ +KKA+ +GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  DYLQNITIPSALISKSLGDSIKKAISNGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   293 bits (749),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  G+FVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPK NRKGC+GFD 
Sbjct  20   SCWGKFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKANRKGCQGFDN  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ SK G  PTF++VDRGDC F  KAWNAQNAGA+A+LVAD+  E LITMD+PEED 
Sbjct  80   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAVLVADNKAEPLITMDTPEEDD  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI KSFG+ LKKA+++G+MV VNLDWRE++PHPDDRVEYE WTNSN
Sbjct  140  NKADYLQNITIPSALISKSFGDSLKKAIENGDMVSVNLDWRESLPHPDDRVEYEFWTNSN  199

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  200  DECGPKCDSQIQ  211



>gb|AFW68896.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=548

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  28   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  86

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  87   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  146

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  147  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  206

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  207  GPKCDMLM  214



>gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays]
Length=575

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  21   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  79

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  80   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  139

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  140  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  199

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  200  GPKCDMLM  207



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             +++Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  203  DECGPKCD  210



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AAGRFVVEKN+L V SP  +KG +DSA+GNFGIPQYGGSM G VVYPK+N + C  F   
Sbjct  27   AAGRFVVEKNSLMVISPSELKGKHDSAIGNFGIPQYGGSMAGAVVYPKENARACDQFSRS  86

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             + F  KAG+LP FV++DRGDC FA K WNAQNAGASA+LV DD  E LITMD P ED  
Sbjct  87   DL-FKPKAGALPNFVLIDRGDCLFAKKVWNAQNAGASAVLVVDDKNEPLITMDLPREDDE  145

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y+ENITIPSALI+K FGE+LKKAV+ GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  146  AAKYIENITIPSALIDKKFGEQLKKAVRSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  205

Query  740  ECGYKCDMLM  769
            ECG KCDMLM
Sbjct  206  ECGTKCDMLM  215



>gb|AFW68895.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=601

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  28   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  86

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  87   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  146

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  147  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  206

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  207  GPKCDMLM  214



>ref|NP_001169650.1| hypothetical protein precursor [Zea mays]
 gb|ACN34397.1| unknown [Zea mays]
Length=521

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  24   GRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  83

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G ++
Sbjct  84   SYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEE-GGNT  142

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG++LKKA+  G+MV+VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  143  DYLENITIPSALITKSFGDRLKKAIDSGDMVNVNLDWREALPHPDERVEYEFWTNSNDEC  202

Query  746  GYKCD  760
            G KCD
Sbjct  203  GPKCD  207



>gb|AFW68894.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=618

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  28   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  86

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  87   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  146

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  147  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  206

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  207  GPKCDMLM  214



>gb|ACN30885.1| unknown [Zea mays]
Length=625

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  21   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  79

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  80   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  139

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  140  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  199

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  200  GPKCDMLM  207



>gb|KGN58683.1| hypothetical protein Csa_3G728010 [Cucumis sativus]
Length=522

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + SNY++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADSNYLKGIAIPSALISKSLGDDIKKALSSGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_004983263.1| PREDICTED: vacuolar-sorting receptor 3-like [Setaria italica]
Length=631

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G  DSA+GNFGIPQYGGSM G VVYPKDN   C  FDG   
Sbjct  27   ARFVVEKNSLMVTSPTSLRGRRDSAIGNFGIPQYGGSMAGAVVYPKDNSNACDDFDG-KH  85

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G++PTF++VDRGDC FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  86   PFRAKPGAMPTFLLVDRGDCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  145

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI+K FGE+LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  146  KYIQNITIPSALIDKKFGEQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  205

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  206  GPKCDMLM  213



>ref|NP_001130741.1| uncharacterized protein LOC100191845 precursor [Zea mays]
 gb|ACF79081.1| unknown [Zea mays]
Length=632

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  28   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  86

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  87   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  146

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  147  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  206

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  207  GPKCDMLM  214



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 161/188 (86%), Gaps = 1/188 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE+G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEENG  143

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             +++Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  203  DECGPKCD  210



>ref|NP_001064400.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa 
Japonica Group]
 gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group]
Length=631

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN   C+ +DG   
Sbjct  27   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDNADACEAYDG-DR  85

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  86   HFRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  145

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI+K FGE+LKKA+KDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  146  KYIQNITIPSALIDKKFGEQLKKAIKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  205

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  206  GPKCDMLM  213



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV  PDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTYPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF SK GSLPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMDSPEE  
Sbjct  78   VGISFKSKPGSLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDRLEPLITMDSPEEAK  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + +NY+++ITIPSALI KS G+++KKA+ +GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADANYLKDITIPSALISKSLGDEIKKALSNGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGAKCD  205



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             +++Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  203  DECGPKCD  210



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   288 bits (737),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             +++Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  202

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  203  DECGPKCD  210



>gb|AAN05373.1| Putative vacuolar sorting receptor protein [Oryza sativa Japonica 
Group]
Length=643

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN   C+ +DG   
Sbjct  27   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDNADACEAYDG-DR  85

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  86   HFRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  145

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI+K FGE+LKKA+KDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  146  KYIQNITIPSALIDKKFGEQLKKAIKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  205

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  206  GPKCDMLM  213



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C  FD 
Sbjct  21   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACSKFDD  80

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK GS PTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD PEE+ 
Sbjct  81   FDISFKSKPGSFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADDKVEPLITMDMPEEES  140

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
              ++Y++NITIPSALI KSFG+ LKKA+ +G+M++VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  141  GGADYLQNITIPSALISKSFGDNLKKALDNGDMINVNLDWRESLPHPDERVEYEFWTNSN  200

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  201  DECGPKCD  208



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   287 bits (734),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G ++
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESG-NT  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG+KLKK + +G+MV VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDKLKKVIDNGDMVSVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  746  GYKCD  760
            G KCD
Sbjct  204  GLKCD  208



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G ++
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESG-NT  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG+KLKK + +G+MV VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDKLKKVIDNGDMVSVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  746  GYKCD  760
            G KCD
Sbjct  204  GLKCD  208



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis sativus]
Length=624

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + SNY++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADSNYLKGIAIPSALISKSLGDDIKKALSSGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPKDN+K CK F  
Sbjct  19   SCWGRFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKDNQKACKSFRD  78

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ SK G  PTF++VDRGDC F  KAWNAQNAGA+AILVAD+  E LITMD+PEE+ 
Sbjct  79   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADNKAEPLITMDTPEEED  138

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y+++ITIPSALI KSFG+ LKKA+++G+MV VNLDWRE++PHPDDRVEYE WTNSN
Sbjct  139  TKADYLQDITIPSALISKSFGDSLKKAIENGDMVSVNLDWRESLPHPDDRVEYEFWTNSN  198

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  199  DECGPKCD  206



>ref|XP_008787225.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=568

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AAGRFVVEKN+L V SP  I+G +DSA+GNFGIPQYGGSM GTVVYPK N   CK F   
Sbjct  27   AAGRFVVEKNSLMVTSPSEIRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNNYACKEFSAS  86

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             + F  K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  87   DL-FKPKPGALPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  145

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y++NITIPSALI+K+FGEKLKKAV+ GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  146  AAKYIQNITIPSALIDKNFGEKLKKAVRSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  205

Query  740  ECGYKCDMLM  769
            ECG KC+MLM
Sbjct  206  ECGPKCNMLM  215



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  21   CCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  80

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  81   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEE-G  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             +++Y+ENITIPSALI KSFG++LKKA+  G+MV+VNLDWREA+PHPD+RVEYE WTNSN
Sbjct  140  GNTDYLENITIPSALITKSFGDRLKKAIDSGDMVNVNLDWREALPHPDERVEYEFWTNSN  199

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  200  DECGPKCD  207



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  28   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  87

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G ++
Sbjct  88   SYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESG-NT  146

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG++LKKA+  G+MV+VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  147  DYLENITIPSALITKSFGDRLKKAIDKGDMVNVNLDWREALPHPDERVEYEFWTNSNDEC  206

Query  746  GYKCD  760
            G KCD
Sbjct  207  GPKCD  211



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  126  SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  185

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  186  FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  245

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             +++Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  246  -NTDYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  304

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  305  DECGPKCD  312



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K G+ PTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G  +
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDKDEPLITMDTPEESG-RA  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG++LKKA+ +G+MV+VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDRLKKAIDNGDMVNVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  746  GYKCD  760
            G KCD
Sbjct  204  GPKCD  208



>ref|XP_006661708.1| PREDICTED: vacuolar-sorting receptor 3-like [Oryza brachyantha]
Length=627

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPK+N   C  FDG   
Sbjct  23   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKENADACDAFDG-DR  81

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  82   HFRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  141

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI+K FGE+LKK++KDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  142  KYIQNITIPSALIDKKFGEQLKKSIKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  201

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  202  GPKCDMLM  209



>gb|KDO64109.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=362

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KC+
Sbjct  201  GPKCE  205



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  21   GRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKSNRKACKSFDDFDI  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K GSLPTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G  +
Sbjct  81   SYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESG-RA  139

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG++L+KAV  G MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  140  DYLENITIPSALITKSFGDRLRKAVDGGHMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  199

Query  746  GYKCD  760
            G KCD
Sbjct  200  GPKCD  204



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K G+ PTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G  +
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDKDEPLITMDTPEESG-RA  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG++LKKA+ +G+MV+VNLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  144  DYLENITIPSALITKSFGDRLKKAIDNGDMVNVNLDWREALPHPDERVEYEFWTNSNDEC  203

Query  746  GYKCD  760
            G KCD
Sbjct  204  GPKCD  208



>gb|KJB71518.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=569

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +++ Y++NITIPSALI KS G+ LKKA+  GEMV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKALNGGEMVNMNLDWRESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
             GISF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + +NY++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPDDRVEYE WTNSN
Sbjct  138  ADANYLKGIAIPSALISKSLGDDIKKALSSGEMVNINLDWTEALPHPDDRVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSD-SD  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            +F  K+G LP  V+VDRGDC FALK WNAQNAGA+A+LVADD  E LITMDSPEED ++S
Sbjct  81   TFRRKSGGLPNVVLVDRGDCYFALKVWNAQNAGAAAVLVADDRSEPLITMDSPEEDSAAS  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             YVENITIPSALIEKSF +KLK+A+ D EMV++NLDWRE++PHPDDRVEYE WTNSNDEC
Sbjct  141  EYVENITIPSALIEKSFADKLKRALSDNEMVNINLDWRESLPHPDDRVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSD-SD  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            +F  K+G LP  V+VDRGDC FALK WNAQNAGA+A+LVADD  E LITMDSPEED ++S
Sbjct  81   TFRRKSGGLPNVVLVDRGDCYFALKVWNAQNAGAAAVLVADDRTEPLITMDSPEEDSAAS  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             YVENITIPSALIEKSF +KLK+A+ D EMV++NLDWRE++PHPDDRVEYE WTNSNDEC
Sbjct  141  EYVENITIPSALIEKSFADKLKRALSDNEMVNINLDWRESLPHPDDRVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   I
Sbjct  21   GRFVVEKNSLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G LPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEED + +
Sbjct  81   SFKSRPGWLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDKVEPLITMDNPEEDDADA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI KS G+ +KKA+ +GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  AYLQNITIPSALISKSLGDSIKKAISNGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KCD
Sbjct  201  GPKCD  205



>gb|KDO64107.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
 gb|KDO64108.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
Length=410

 Score =   279 bits (713),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KC+
Sbjct  201  GPKCE  205



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ F  
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANKKACRNFAD  76

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G  PTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   FDISFKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADDKVEPLITMDTPEEES  136

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
              ++Y++NITIPSALI KSFG+ LKKA+++G+M++VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  GGADYLQNITIPSALISKSFGDNLKKALENGDMINVNLDWRESLPHPDERVEYEFWTNSN  196

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  197  DECGPKCD  204



>gb|KDO64106.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=411

 Score =   278 bits (712),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KC+
Sbjct  201  GPKCE  205



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   284 bits (727),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +++ Y++NITIPSALI KS G+ LKKA+  GEMV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKALNGGEMVNMNLDWRESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   284 bits (727),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +++ Y++NITIPSALI KS G+ LKKA+  GEMV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKALNGGEMVNMNLDWRESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PD+++GTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDALRGTYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K GS PTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G  +
Sbjct  85   SYKAKPGSFPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESG-RA  143

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +++ENITIPSALI KSFG++L+KAV +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  144  DHLENITIPSALITKSFGDRLRKAVNNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  203

Query  746  GYKCD  760
            G KCD
Sbjct  204  GPKCD  208



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  200  DECGPKCDAQIQ  211



>ref|XP_003623631.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AES79849.1| vacuolar sorting receptor [Medicago truncatula]
Length=625

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            E   GRF+VEKN+L++ SP S+KG+Y+ A+GNFG+PQYGG++ G+VVYP  N+KGCK F 
Sbjct  18   ECCFGRFLVEKNSLRITSPKSLKGSYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCKNFT  77

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-  550
             F  SF S  G+ PTFV+VDRGDC F LKAWNAQN GA+AILVADD EE LITMD+PEE 
Sbjct  78   DFSASFHSMPGNFPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDREETLITMDTPEEG  137

Query  551  DGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  730
            +  + +Y+E I IPSALI KS G+++KKA+ DGEMVH+NLDWREA+PHPDDRVEYELWTN
Sbjct  138  NVVNDDYIEKINIPSALISKSLGDRIKKALSDGEMVHINLDWREALPHPDDRVEYELWTN  197

Query  731  SNDECGYKCD  760
            SNDECG KCD
Sbjct  198  SNDECGPKCD  207



>ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              +SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEEN  136

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS++Y++NITIPSALI KSFG+ +KKA+ +G+M+++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  SSADYLQNITIPSALISKSFGDGIKKALSNGDMININLDWRESLPHPDERVEYEFWTNSN  196

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  197  DECGPKCD  204



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +
Sbjct  26   ARFVVEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDV  85

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF ++ G+LPTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G   
Sbjct  86   SFKARPGALPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDRDEPLITMDTPEESGRVE  145

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSALI KSFG++LKK + +GEMV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  146  -YLENITIPSALISKSFGDRLKKTIDNGEMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  204

Query  746  GYKCD  760
            G KCD
Sbjct  205  GPKCD  209



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            S ++Y++NITIPSAL+ +S G  +K A+  G+ VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  SDADYLQNITIPSALVSRSLGSAIKTAIAHGDPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  200  DECGSKCDAQIR  211



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F +SF SK G LPTFV++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED 
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNAQRAGAAAILVADNKVEPLITMDTPEEDN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + + Y++ ITIPSALI KS G+ +K A+  G MV++NLDW E+VPHPD+RVEYELWTNSN
Sbjct  138  ADAEYLDKITIPSALISKSLGDSIKSALSSGNMVNMNLDWTESVPHPDERVEYELWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  198  DECGKKCDTQIE  209



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F +SF SK G LPTFV++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED 
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNAQRAGAAAILVADNKVEPLITMDTPEEDN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + + Y++ ITIPSALI KS G+ +K A+  G MV++NLDW E+VPHPD+RVEYELWTNSN
Sbjct  138  ADAEYLDKITIPSALISKSLGDSIKSALSSGNMVNMNLDWTESVPHPDERVEYELWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  198  DECGKKCDTQIE  209



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              +SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEEN  136

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            SS++Y++NITIPSALI KSFG+ +KKA+ +G+M+++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  SSADYLQNITIPSALISKSFGDGIKKALSNGDMININLDWRESLPHPDERVEYEFWTNSN  196

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  197  DECGPKCD  204



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            S ++Y++NITIPSAL+ +S G  +K A+  G+ VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  SDADYLQNITIPSALVSRSLGSAIKTAIAHGDPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  200  DECGSKCDAQIR  211



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+ GRFVVEKN+LKV SP+S+KGT++ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  17   SSFGRFVVEKNSLKVTSPESLKGTHECAIGNFGVPQYGGTMVGIVSYPKANRKACKSFDD  76

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G  PTF+++DRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PE+  
Sbjct  77   FDISFKSKPGGFPTFLLLDRGDCYFTEKAWNAQNAGAAAILVADDKVENLITMDTPEQYS  136

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
               +Y++NITIPSALI KSFG+ LKKA+++G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  GGESYLQNITIPSALISKSFGDDLKKALENGDMVNVNLDWRESLPHPDERVEYEFWTNSN  196

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  197  DECGPKCD  204



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWR+A+PHP+DRV YELWTNSN
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWRKALPHPNDRVAYELWTNSN  199

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  200  DECGPKCDAQIQ  211



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKNNL+V SP+SI+G Y+ A+GNFG+PQYGGSMTG VV+PK N+KGC+ FD F I
Sbjct  23   GRFVVEKNNLRVTSPESIRGIYECAIGNFGVPQYGGSMTGEVVFPKANQKGCQSFDQFDI  82

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SFSSK G LPTFV+VDRGDC F LKAWNAQ AGA+ ILV D+  E LITMD+PEE+ + +
Sbjct  83   SFSSKPGGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVVDNRPEPLITMDAPEEETADA  142

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y++NITIPSAL+ KS G  +K A+  GE V ++LDWREA+PHPDDRV+YELWTNSNDEC
Sbjct  143  DYLQNITIPSALVSKSLGNAMKMAIAHGEPVRISLDWREALPHPDDRVQYELWTNSNDEC  202

Query  746  GYKCD  760
            G KCD
Sbjct  203  GPKCD  207



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   282 bits (722),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LK+ SP+S+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   I
Sbjct  21   GRFVVEKNSLKLTSPESLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G LPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEED + +
Sbjct  81   SFKSRPGGLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDKVEPLITMDNPEEDDADA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI KS G+ +KKA+ DGEMV++NLDW E++PHPD+RVEYE WTNSND C
Sbjct  141  AYLQNITIPSALISKSLGDSIKKALSDGEMVNMNLDWTESLPHPDERVEYEFWTNSNDAC  200

Query  746  GYKCD  760
            G KCD
Sbjct  201  GPKCD  205



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   284 bits (726),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  96   GRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI  155

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ +K GSLPTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G  +
Sbjct  156  SYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESG-RA  214

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITI SALI KSFG++L+KAV  G MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  215  DYLENITIASALITKSFGDRLRKAVDSGHMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  274

Query  746  GYKCD  760
            G KCD
Sbjct  275  GPKCD  279



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   282 bits (721),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+KGCK FD 
Sbjct  19   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKANQKGCKNFDD  78

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  79   FEISFRSRLAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  138

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            S ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV  ELWTNSN
Sbjct  139  SDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVADELWTNSN  198

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  199  DECGSKCDAQIQ  210



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L+V +P ++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +
Sbjct  43   ARFVVEKNSLRVTAPVALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDV  102

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF ++ G+LPTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G   
Sbjct  103  SFKARPGALPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDRDEPLITMDTPEESGRVE  162

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSALI KSFG++LKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  163  -YLENITIPSALISKSFGDRLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  221

Query  746  GYKCD  760
            G KCD
Sbjct  222  GPKCD  226



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N K CK FD 
Sbjct  22   SCTGRFVVEKNNLRVTSPESIRGIYECALGNFGVPQYGGSMSGAVVYPKANHKSCKNFDD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMDSPE++ 
Sbjct  82   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDSPEDET  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSAL+ +S G+ +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  142  ADADYLQNITIPSALVSRSLGDAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  201

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  202  DECGPKCDAQIR  213



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SPDS+KG ++ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD 
Sbjct  18   SCLGRFVVEKNSLRVTSPDSVKGIHECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDE  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VDISFKSKPGGLPTFLLADRGDCYFTLKAWNAQNGGAAAILVADDKLEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++ I IPSALI KS G+ +KKA+  GEMV++NLDW EA+PHPD+RVEYE WTNSN
Sbjct  138  ADADYLQKINIPSALITKSLGDSIKKALSGGEMVNINLDWTEALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCDMLM  769
            DECG KCD  M
Sbjct  198  DECGPKCDSQM  208



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG+M GTV+YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKVTSPEDLKGVYECAIGNFGVPQYGGTMIGTVIYPKANQKACKDFDE  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              +SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILV+DD  E LITMD+PEE+ 
Sbjct  78   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVSDDKVEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++YV+NI+IPSALI K+FG+++KK++  G+M+++NLDWREA+PHPD+RVEYELWTNSN
Sbjct  138  ARADYVQNISIPSALISKTFGDRIKKSLSMGDMININLDWREALPHPDERVEYELWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+   I
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEEDAQA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            NY++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  141  NYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KC+
Sbjct  201  GPKCE  205



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FD 
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDD  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  199

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  200  DECGPKCDAQIQ  211



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+   I
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEEDAQA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            NY++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  141  NYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KC+
Sbjct  201  GPKCE  205



>ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=631

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AAGRFVVEKN+L V SP  I+G +DSA+GNFGIPQYGGSM GTVVYPK N   C+ F   
Sbjct  25   AAGRFVVEKNSLMVTSPSDIRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNNYACEKFSAS  84

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             + F  K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  85   DL-FKPKPGALPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  143

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y++NITIPSALI+K+FGEKLKKA   GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  144  AAKYIQNITIPSALIDKNFGEKLKKAFHSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  203

Query  740  ECGYKCDMLM  769
            ECG KC+MLM
Sbjct  204  ECGPKCNMLM  213



>ref|XP_009421105.1| PREDICTED: vacuolar-sorting receptor 3-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = +2

Query  203  AGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFG  382
            AGRFVVEKN+L V SP  IKG +DSA+GNFGIPQYGGSM G VVYPK+N   C  F    
Sbjct  28   AGRFVVEKNSLMVISPSEIKGKHDSAIGNFGIPQYGGSMAGAVVYPKENAAACDEFSRPD  87

Query  383  ISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  562
            + F SK G+LP F+++DRGDC F  K WNAQNAGASA+LV DD +E LITMD P ED  S
Sbjct  88   L-FRSKVGALPNFLLIDRGDCLFTKKVWNAQNAGASAVLVVDDKDEPLITMDLPLEDDES  146

Query  563  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  742
            + Y++NITIPSALI+K FGE+LK AV+ GEMV+VNLDWREAVPHPD+RVEYELWTNSNDE
Sbjct  147  AKYIQNITIPSALIDKRFGEQLKTAVRSGEMVNVNLDWREAVPHPDERVEYELWTNSNDE  206

Query  743  CGYKCDMLM  769
            CG KCDMLM
Sbjct  207  CGAKCDMLM  215



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FG+SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             ++++Y+E I IPSALI KS G+ +K A+ DG MV++ LDW E+VPHPD+RVEYELWT+S
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAISDGNMVNMKLDWTESVPHPDERVEYELWTDS  194

Query  734  NDECGYKCDMLMK  772
            NDECG KCD  ++
Sbjct  195  NDECGKKCDTQIE  207



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FG+SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             ++++Y+E I IPSALI KS G+ +K A+ DG MV++ LDW E+VPHPD+RVEYELWT+S
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAISDGNMVNMKLDWTESVPHPDERVEYELWTDS  194

Query  734  NDECGYKCDMLMK  772
            NDECG KCD  ++
Sbjct  195  NDECGKKCDTQIE  207



>ref|XP_007033523.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
 gb|EOY04449.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
Length=515

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++VDRGDC F +KAWNAQ AGA+AILVAD+ +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTMKAWNAQKAGAAAILVADNKDEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +S+ YV NITIPSAL+ KS G+ +KKA+  GEMV++NLDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAEYVLNITIPSALVSKSLGDSIKKALSLGEMVNMNLDWTESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
              GRFVVEKN+LKV SP+S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F
Sbjct  19   CVGRFVVEKNSLKVTSPNSLKNVYECAIGNFGVPQYGGTLVGTVFYPKANQKACKGFEDF  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ +
Sbjct  79   DISFKSKPGGLPTFLLADRGDCYFTLKAWNAQNGGAAAILVADDRTEPLITMDTPEEENA  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++ I IPSALI KS G+ +KKA+ DGEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKIAIPSALISKSLGDSIKKALSDGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  740  ECGYKCD  760
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C+ FD 
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACQSFDD  76

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF  K G  PTF++VDRGDC F  KAW AQNAGA+AILVADD  E LITMD+P E+ 
Sbjct  77   FDISFKPKPGGFPTFLLVDRGDCFFTSKAWKAQNAGAAAILVADDKVEPLITMDTPGEES  136

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
              ++Y++NITIPSALI KSFG+ LKKA+++G+MV VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  137  GGADYLQNITIPSALISKSFGDNLKKALENGDMVSVNLDWRESLPHPDERVEYEFWTNSN  196

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  197  DECGPKCD  204



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF SK G LPTF++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNAQNAGAAAILVADDKIEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI KSFG+ +K A+  G+MV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  AHADYLQNITIPSALISKSFGDSIKNALSKGDMVNINLDWRESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_009388213.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   277 bits (709),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV SP+S+KG Y+SA+GNFG+PQYGG+M G V YPK N K C  F  F I
Sbjct  21   GRFVVEKNSLKVTSPNSLKGIYESAIGNFGVPQYGGTMVGIVAYPKVNWKACHNFKDFDI  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+ SK G  PTF++VDRGDC F  KAWNAQN+GA+A+LVAD+V E LITM++PEE+ S +
Sbjct  81   SYKSKPGGFPTFLLVDRGDCYFITKAWNAQNSGAAAVLVADNVAEPLITMNTPEEENSKA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y++NITIPSALI KSFG++LKKA+++G+MV VNLDW+E++PHPD+RVEYE WTN NDEC
Sbjct  141  DYLQNITIPSALISKSFGDRLKKAIENGDMVSVNLDWKESLPHPDNRVEYEFWTNCNDEC  200

Query  746  GYKCD  760
            G KCD
Sbjct  201  GPKCD  205



>ref|XP_003573873.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=629

 Score =   280 bits (715),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 155/189 (82%), Gaps = 2/189 (1%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L V SP +++G +DSA+GNFGIPQYGGSM G VVYPK N   C  FDG G  
Sbjct  24   RFVVEKNSLMVTSPTTLRGRHDSAIGNFGIPQYGGSMAGAVVYPKANTDACDSFDGGGKE  83

Query  389  --FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  562
              F +  G+LP+F+++DR +C FA K WNAQNAGASA+LV DD +E LITMD P ED  +
Sbjct  84   HIFRNNPGALPSFLLIDRRNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEA  143

Query  563  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  742
            + Y++NITIPSALI+K FGE+LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDE
Sbjct  144  AKYIQNITIPSALIDKKFGEQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDE  203

Query  743  CGYKCDMLM  769
            CG KCDML+
Sbjct  204  CGPKCDMLI  212



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            E   G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELTFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FG+SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             ++++Y+E I IPSALI KS G+ +K A+ DG MV++ LDW E+VPHPD+RVEYELWT+S
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAISDGNMVNMKLDWTESVPHPDERVEYELWTDS  194

Query  734  NDECGYKCDMLMK  772
            NDECG KCD  ++
Sbjct  195  NDECGKKCDTQIE  207



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFGIPQYGGSM+G V+YPK N+K CK F  
Sbjct  18   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGIPQYGGSMSGAVLYPKANQKACKNFAD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  78   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSAL+ +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  138  TDADYLQNITIPSALVSRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  198  DECGPKCDAQIQ  209



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKNNLKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK ++ F
Sbjct  20   ALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYNDF  79

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF SK G LPTFV++DRGDC F LKAW AQ AGA+AILVAD   E LITMD+PEED S
Sbjct  80   DISFKSKPGRLPTFVLIDRGDCFFTLKAWTAQQAGAAAILVADSKAEPLITMDTPEEDKS  139

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++NITIPSALI KS G+ +K A+  G+MV++ LDW E+VPHPD+RVEYELWTNSND
Sbjct  140  DADYLQNITIPSALITKSLGDSIKSALSGGDMVNMKLDWTESVPHPDERVEYELWTNSND  199

Query  740  ECGYKCD  760
             CG KCD
Sbjct  200  VCGKKCD  206



>ref|XP_006842496.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 ref|XP_011622665.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L+V SPDS+K TY+ A+GNFG+PQYGG+M GTV YPK N+K C+ +    I
Sbjct  20   GRFVVEKNSLRVTSPDSLKDTYECAIGNFGVPQYGGTMVGTVTYPKSNQKACREYKEVEI  79

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF SK G LPT V+ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ S +
Sbjct  80   SFKSKPGGLPTIVLADRGDCYFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEENSKA  139

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y++NITIPSALI KSFG+ +KKA+ +G+MV++NLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  140  DYLQNITIPSALISKSFGDSIKKALANGDMVNINLDWRESLPHPDERVEYEFWTNSNDEC  199

Query  746  GYKCDMLMK  772
            G KCD  ++
Sbjct  200  GPKCDTQIE  208



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF SK G LPTF++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNAQNAGAAAILVADDKIEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI KSFG+ +K A+  G+MV++NLDWRE++PHPD+RVEYE WTNSN
Sbjct  138  AHADYLQNITIPSALISKSFGDSIKNALSKGDMVNINLDWRESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis]
Length=633

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +2

Query  203  AGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFG  382
            AGRFVVEKN+L V SP  ++G +DSA+GNFGIPQYGGSM GTVVYPK N+  C+ F    
Sbjct  28   AGRFVVEKNSLMVTSPSELRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNKYVCEEFSDSD  87

Query  383  ISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  562
            + F  K G+LP F++VDRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +
Sbjct  88   L-FKPKPGALPNFLLVDRGECLFAKKVWNAQNAGASAVLVIDDKDEPLITMDLPREDDKA  146

Query  563  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  742
            + Y++NITIPSALI+K FGEKLKKAV  GEMV+VNLDWREAVPHPDDRVEYELWTNSNDE
Sbjct  147  AKYIQNITIPSALIDKKFGEKLKKAVLSGEMVNVNLDWREAVPHPDDRVEYELWTNSNDE  206

Query  743  CGYKCDMLM  769
            CG KC+MLM
Sbjct  207  CGPKCNMLM  215



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            G F+VEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  99   GGFLVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVTYPKANKKACKSFDDFDI  158

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            S+  K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G ++
Sbjct  159  SYKPKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG-NT  217

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  218  DYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDEC  277

Query  746  GYKCD  760
            G KCD
Sbjct  278  GPKCD  282



>ref|XP_007140077.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
 gb|ESW12071.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
Length=619

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 161/193 (83%), Gaps = 3/193 (2%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            E   GRFVVEKN+L+V +P S+KGTY+ A+GNFG+P+YGG++ G+VVYPK N+KGC  F 
Sbjct  17   ECTVGRFVVEKNSLRVTAPTSLKGTYECAIGNFGVPKYGGTLVGSVVYPKVNQKGCLNFT  76

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-  550
               ++F SK G  PTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE 
Sbjct  77   D--VNFQSKPGVFPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEG  134

Query  551  DGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  730
             G++ +YV+NI+IPSALI KSFG+ +KKA+ DG+MV++NLDWREA+PHPDDRVEYELWTN
Sbjct  135  KGTNDDYVDNISIPSALISKSFGDSIKKALSDGDMVNMNLDWREALPHPDDRVEYELWTN  194

Query  731  SNDECGYKCDMLM  769
            SNDECG KCD L+
Sbjct  195  SNDECGPKCDSLI  207



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 158/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  G FVVEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  51   ACRGGFVVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  110

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F IS+  K GSLPTF++VDRGDC F  KAWNAQ+AGA+AILVADD  E LITMD+PEE G
Sbjct  111  FDISYKPKPGSLPTFLLVDRGDCFFTKKAWNAQSAGAAAILVADDKTEPLITMDTPEESG  170

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
             +++Y+ENITIPSALI KSFG+KLKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSN
Sbjct  171  -NTDYLENITIPSALITKSFGDKLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSN  229

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  230  DECGPKCD  237



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDEC  200

Query  746  GYKCD  760
            G KC+
Sbjct  201  GPKCE  205



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++VDRGDC F +KAWNAQ AGA+AILVAD+ +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTMKAWNAQKAGAAAILVADNKDEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +S+ YV NITIPSAL+ KS G+ +KKA+  GEMV++NLDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAEYVLNITIPSALVSKSLGDSIKKALSLGEMVNMNLDWTESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S +GRFVVEKN+LK+ SPDS+K  Y+ A+GNFG+PQYGG+M GTVVYPK ++K CK FD 
Sbjct  22   SCSGRFVVEKNSLKITSPDSLKRVYECAIGNFGVPQYGGTMIGTVVYPKADQKACKSFDD  81

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF SK G  PTF++ DRGDC F LKAWNAQ AGA+AILVADD +E LITMD+PEE+ 
Sbjct  82   VDISFKSKPGGRPTFLLADRGDCYFTLKAWNAQKAGAAAILVADDRDEPLITMDNPEEED  141

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y+++ITIPSALI KS G+K+K  +  GEMV +NLDWREA+PHPDDRVEYE WTNSN
Sbjct  142  AQADYLQSITIPSALISKSLGDKIKNELSKGEMVSINLDWREALPHPDDRVEYEFWTNSN  201

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  202  DECGPKCE  209



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   276 bits (707),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +S+ Y++NITIPSALI KS G+ LKKA+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +S+ Y++NITIPSALI KS G+ LKKA+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=633

 Score =   277 bits (708),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AAGRFVVEKN+L V SP  ++G +DSA+GNFGIPQYGGSM G VVYPK NR  C+ F   
Sbjct  27   AAGRFVVEKNSLMVTSPSELRGKHDSAIGNFGIPQYGGSMAGMVVYPKTNRYACEKFSAS  86

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             + F  K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  87   DL-FRPKPGALPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  145

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
            ++ Y++NI IPSALI+K+FG+KLKK V  GEMV+VNLDWREAVPHPDDRVEYELWTNSND
Sbjct  146  AAKYIQNIMIPSALIDKNFGKKLKKVVLSGEMVNVNLDWREAVPHPDDRVEYELWTNSND  205

Query  740  ECGYKCDMLM  769
            ECG KC+MLM
Sbjct  206  ECGPKCNMLM  215



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   276 bits (707),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 157/192 (82%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +S+ Y++NITIPSALI KS G+ LKKA+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G VVYPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTMVGIVVYPKANQKSCKDFAD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGFD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKGFDDF  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             +SF SK G LPTF++VDRGDC F LKAWNAQ  GA+AILVAD+  E LITMD+PEE+ +
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKGGAAAILVADNRNEPLITMDTPEEENA  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++ ITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKSLGDSIKKSLSSGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  740  ECGYKCD  760
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CK FD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKSFDDF  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             +SF SK G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ +
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKGGAAAILVADDRNEPLITMDTPEEENA  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++ ITIPSALI KS G+ +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKSLGDSIKKSLSSGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  740  ECGYKCD  760
            ECG KCD
Sbjct  199  ECGPKCD  205



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+AILVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAILVADNQDESLITMDTPEEKN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +S+ Y++NITIPSALI KS G+ LK A+  GEMV ++LDW E++PHPD+RVEYE WTNSN
Sbjct  138  ASAEYLQNITIPSALISKSLGDSLKNAITFGEMVKISLDWTESLPHPDERVEYEFWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFTD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G++P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNAQRAGAGAILVADDRVEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISKSLGDSIKKELSRGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              ISF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI +S G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKKQLSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFAD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF SK G++P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNAQRAGAGAILVADDRVEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  AQADYLQNITIPSALISKSLGDSIKKELSRGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  198  DECGPKCE  205



>dbj|BAB64531.1| vacuolar sorting receptor [Vigna mungo]
Length=619

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 156/192 (81%), Gaps = 3/192 (2%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
               GRFVVEKN+L+V +P S+KGTY+ A+GNFG+P YGG++ G+V+YPK N+KGC  F  
Sbjct  18   CTVGRFVVEKNSLRVTAPSSLKGTYECAIGNFGVPMYGGTLVGSVLYPKVNQKGCLNFTD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-D  553
              ++F SK G  PTF++VDRGDC F LKAWNAQN GA+A+LVADD  E LITMD+PEE  
Sbjct  78   --VNFQSKPGGFPTFLLVDRGDCYFTLKAWNAQNGGAAAVLVADDKAETLITMDTPEEGK  135

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
            G+  +YVENI+IPS LI KS G+ +KKA+ DGEMV++NLDWREA+PHPDDRVEYELWTNS
Sbjct  136  GTDDDYVENISIPSVLISKSLGDSIKKALSDGEMVNMNLDWREALPHPDDRVEYELWTNS  195

Query  734  NDECGYKCDMLM  769
            NDECG KCD L+
Sbjct  196  NDECGQKCDSLI  207



>ref|XP_003552313.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=619

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    ++
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSD--VN  80

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G LPTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  81   FQSKPGGLPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  140

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            YV+ I+IPSALI KS G+ +K+A+ DGEMV++NLDWRE++PHPDDRVEYELWTNSNDECG
Sbjct  141  YVDKISIPSALISKSLGDSIKQALSDGEMVNINLDWRESLPHPDDRVEYELWTNSNDECG  200

Query  749  YKCDMLM  769
             KCD L+
Sbjct  201  PKCDSLI  207



>gb|KHN40635.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=618

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    ++
Sbjct  22   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSD--VN  79

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G LPTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  80   FQSKPGGLPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  139

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            YV+ I+IPSALI KS G+ +K+A+ DGEMV++NLDWRE++PHPDDRVEYELWTNSNDECG
Sbjct  140  YVDKISIPSALISKSLGDSIKQALSDGEMVNINLDWRESLPHPDDRVEYELWTNSNDECG  199

Query  749  YKCDMLM  769
             KCD L+
Sbjct  200  PKCDSLI  206



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   274 bits (701),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
               GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG++ GTVVYP+ N+K CK F+ 
Sbjct  20   CVVGRFVVEKNSLKVTSPNPLKGVYECAIGNFGVPQYGGTLVGTVVYPQANQKACKNFED  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F +SF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  80   FSVSFKSKPGGLPTFLLADRGDCFFTLKAWNAQNGGAAAILVADDKFEPLITMDNPEEEN  139

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++ ITIPSALI KS G+ ++KA+ D +MV++ LDW EA+PHPD+RVEYELWTNSN
Sbjct  140  ADADYLQKITIPSALISKSLGDSIRKALSDKDMVNIKLDWTEALPHPDERVEYELWTNSN  199

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  200  DECGPKCD  207



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   274 bits (701),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 155/192 (81%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  29   SCMGRFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  88

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  89   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  148

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + + Y++NITIPSAL+ +S G  +K A+  GE V ++LDWREA+PHP+DRV YELWTNSN
Sbjct  149  ADAEYLQNITIPSALLSRSLGSAIKTAIDQGEPVRISLDWREALPHPNDRVAYELWTNSN  208

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  209  DECGSKCDAQIR  220



>gb|AFW68893.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=587

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 152/188 (81%), Gaps = 15/188 (8%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN            
Sbjct  28   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDN------------  75

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
               +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  76   ---AKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  132

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y++NITIPSALI++ FG++LKKAVKDGEMV+VNLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct  133  KYIQNITIPSALIDEKFGDQLKKAVKDGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC  192

Query  746  GYKCDMLM  769
            G KCDMLM
Sbjct  193  GPKCDMLM  200



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 154/192 (80%), Gaps = 1/192 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
              GRFVVEKNNL+V SP++I+G Y+ ALGNFG+PQYGGSM G VVYPK N+K CK F+ F
Sbjct  22   CTGRFVVEKNNLRVTSPEAIRGVYECALGNFGVPQYGGSMAGAVVYPKANQKACKNFNDF  81

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ S
Sbjct  82   DISFRSRLAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDETS  141

Query  560  S-SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + + Y++NITIPSALI +S G  +K A+  GE VH++LDWREA+PHP+DRV YELWTNSN
Sbjct  142  TDAEYLQNITIPSALISRSLGSAIKTAIAHGEPVHISLDWREALPHPNDRVAYELWTNSN  201

Query  737  DECGYKCDMLMK  772
            DECG KCD  ++
Sbjct  202  DECGPKCDAQIR  213



>ref|XP_003534638.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
 gb|KHN29499.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=619

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 156/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    ++
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSD--VN  80

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F SK G  PTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  81   FQSKPGGFPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  140

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            YV+ I+IPSALI KS G+ +K+A+ DGEMV++NLDWRE++PHPDDRVEYELWTNSNDECG
Sbjct  141  YVDKISIPSALISKSLGDSIKQALSDGEMVNINLDWRESLPHPDDRVEYELWTNSNDECG  200

Query  749  YKCDMLM  769
             KCD L+
Sbjct  201  PKCDSLI  207



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SPDS+KG ++ A+GNFG+PQYGG++ G+V YPK N+K C  F  
Sbjct  18   SCFGRFVVEKNSLKVASPDSLKGLHECAIGNFGVPQYGGTLVGSVFYPKSNQKACTNFQD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              +SF +K G +P F++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VDLSFQTKPGGIPIFLLADRGDCYFTLKAWNAQNGGAAAILVADDRVEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI K  G+K+KK +  GEMV +NLDWREA+PHPD+RVEYELWTNSN
Sbjct  138  ARADYLQNITIPSALISKDLGDKIKKELSKGEMVSINLDWREALPHPDERVEYELWTNSN  197

Query  737  DECGYKCD  760
            DECG KCD
Sbjct  198  DECGPKCD  205



>ref|XP_006341299.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Solanum tuberosum]
Length=578

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  F I
Sbjct  19   GRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSDFDI  78

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
             + SK G +P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ + +
Sbjct  79   FYKSKPGGMPVFLLVDRGDCFFTLKAWNAQQAGAGAILVADDRVEPLITMDTPEEEDAKA  138

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+++ITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPDDRVEYE WTNSNDEC
Sbjct  139  DYLQDITIPSALISKSLGDSIKKELSKGEMVNINLDWREALPHPDDRVEYEFWTNSNDEC  198

Query  746  GYKCD  760
            G KC+
Sbjct  199  GPKCE  203



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            + A G+F+VEKNNLKV SP++IKG Y+ A+GNFGIP+YGG++ G VV+P  N K CK F 
Sbjct  17   QLALGKFLVEKNNLKVTSPETIKGVYECAIGNFGIPKYGGTLVGAVVHPVSNHKACKSFS  76

Query  374  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  553
             FG+SF S  G LPTF+++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED
Sbjct  77   EFGVSFKSTPGRLPTFLLIDRGDCYFTLKAWNAQQAGAAAILVADNKLEPLITMDTPEED  136

Query  554  GSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNS  733
             + ++Y++ ITIPSALI KS G+ +K A+ DG MV++NLDW E+VPHPD+RVEYELWT+S
Sbjct  137  NADADYLDKITIPSALISKSLGDSIKSALSDGNMVNMNLDWTESVPHPDERVEYELWTDS  196

Query  734  NDECGYKCDMLMK  772
            NDECG KCD  ++
Sbjct  197  NDECGKKCDTQIE  209



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
              GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F
Sbjct  19   CVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDF  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF  K G LPTF++VDRGDC F LKAWNAQ  G +AILVADD  E LITMD+PEE+ +
Sbjct  79   DESFKPKPGGLPTFLLVDRGDCYFTLKAWNAQKGGXAAILVADDRNEPLITMDNPEEENA  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++ ITIPSALI K  GE +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKELGESIKKSLSGGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  740  ECGYKCD  760
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
              GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F
Sbjct  19   CVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDF  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF  K G LPTF++VDRGDC F LKAWNAQ  G +AILVADD  E LITMD+PEE+ +
Sbjct  79   DESFKPKPGGLPTFLLVDRGDCYFTLKAWNAQKGGXAAILVADDRNEPLITMDNPEEENA  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++ ITIPSALI K  GE +KK++  GEMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQKITIPSALISKELGESIKKSLSGGEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  740  ECGYKCD  760
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_012091044.1| PREDICTED: vacuolar-sorting receptor 1-like [Jatropha curcas]
 gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SPDS++G Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTSPDSVRGIYECAIGNFGVPQYGGTLVGTVVYPKANQKACKEFDE  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
               SF SK G LPTFV+VDRGDC F  KAWNAQ  GA+AILV+DD  E LITMD+PEE+ 
Sbjct  78   ADGSFKSKPGGLPTFVLVDRGDCYFTSKAWNAQRGGAAAILVSDDKIEPLITMDTPEEEN  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + + Y++ I IPSALI KS G+ +KKA+  GEMV+VNLDW EA+PHPD+RVEYE WTNSN
Sbjct  138  ADAEYLQKINIPSALISKSLGDSIKKALAAGEMVNVNLDWTEALPHPDERVEYEFWTNSN  197

Query  737  DECGYKCDMLMK  772
            DECG KCD  M+
Sbjct  198  DECGPKCDSQME  209



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   277 bits (709),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = +2

Query  218  VEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGISFSS  397
            +EKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +SF +
Sbjct  330  LEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDEFDVSFKA  389

Query  398  KAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSNYVE  577
            + G+LPTF++VDRGDC FA KAWN QNAGA+AILVADD +E LITMD+PEE G    Y+E
Sbjct  390  RPGALPTFLLVDRGDCYFAKKAWNVQNAGAAAILVADDRDEPLITMDTPEESGRVE-YLE  448

Query  578  NITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECGYKC  757
            NITIPSALI KSFG++LKKA+ +G+MV+VNLDWRE++PHPD+RVEYE WTNSNDECG KC
Sbjct  449  NITIPSALISKSFGDRLKKAIDNGDMVNVNLDWRESLPHPDERVEYEFWTNSNDECGPKC  508

Query  758  D  760
            D
Sbjct  509  D  509



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   271 bits (694),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD F
Sbjct  20   AAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDDF  79

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             +SF  K G LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMDSPE  G 
Sbjct  80   DLSFKPKPGGLPVFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRLEPLITMDSPESSG-  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y+E IT+PSAL+ K FG+ LKKA+++G+MV+V LDWRE++PHPD+RVEYE WTNSND
Sbjct  139  -TDYIEKITVPSALVTKKFGDDLKKALENGDMVNVLLDWRESLPHPDERVEYEFWTNSND  197

Query  740  ECGYKCDMLM  769
            ECG KCDM M
Sbjct  198  ECGAKCDMQM  207



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD F
Sbjct  20   AAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDDF  79

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             +SF  K G LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMDSPE  G 
Sbjct  80   DLSFKPKPGGLPIFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRLEPLITMDSPESSG-  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y+E IT+PSAL+ K FG+ LKKA+++G+MV+V LDWRE++PHPD+RVEYE WTNSND
Sbjct  139  -TDYIEKITVPSALVTKKFGDDLKKALENGDMVNVLLDWRESLPHPDERVEYEFWTNSND  197

Query  740  ECGYKCDMLM  769
            ECG KCDM M
Sbjct  198  ECGAKCDMQM  207



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+LKV SPDS+K  Y+ A+GNFG+P YGGSM G+V YPK N K CK F  
Sbjct  18   SCLGRFVVEKNSLKVTSPDSLKDVYECAIGNFGVPDYGGSMAGSVFYPKSNEKACKNFQD  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F I+  +K G LP F++ DRG+C F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   FDIALKTKPGGLPIFLLADRGECFFTLKAWNAQNAGAAAILVADDRVEPLITMDTPEEED  137

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y++NITIPSALI K  G+K+KK +  GEMV++NLDWREA+PHPD+RVEYE WTNSN
Sbjct  138  ARADYLQNITIPSALISKDLGDKIKKELSKGEMVNINLDWREALPHPDERVEYEFWTNSN  197

Query  737  DECGYKC  757
            DECG KC
Sbjct  198  DECGPKC  204



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 151/186 (81%), Gaps = 1/186 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRF+VEKN+LK+ SP S+KGTY+ A+GNFG+PQYGG++ G+VVYP  N+KGC  F     
Sbjct  21   GRFLVEKNSLKITSPKSLKGTYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCDNFTDVNA  80

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-DGSS  562
            SF SK G  PTF++VDRGDC F LKAWNAQN GA+AILVAD+ EE LITMD+PEE + + 
Sbjct  81   SFQSKPGGFPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADNREEILITMDTPEEGNVAK  140

Query  563  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  742
             +Y+E I IPS LI KS G+ +KKA+ +GEMV +NLDWREA+PHPDDRVEYELWTNSNDE
Sbjct  141  DDYMEKINIPSTLISKSLGDSIKKALSNGEMVRINLDWREALPHPDDRVEYELWTNSNDE  200

Query  743  CGYKCD  760
            CG KCD
Sbjct  201  CGPKCD  206



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AAGRFV EKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK NRK CK FD F
Sbjct  24   AAGRFVGEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANRKACKAFDEF  83

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             +SF  K+G LP F++VDRGDC F  K WNAQ+AGA+A+LVADD  E LITMDSPE  G 
Sbjct  84   DLSFKPKSGGLPVFLLVDRGDCYFTTKGWNAQSAGAAAVLVADDRVEPLITMDSPESSG-  142

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y+E IT+PSAL+ K FG+ LKK++++G+MV+V LDWRE++PHPD+RVEYE WTNSND
Sbjct  143  -TDYIEKITVPSALVTKKFGDDLKKSLENGDMVNVLLDWRESLPHPDERVEYEFWTNSND  201

Query  740  ECGYKCDMLM  769
            ECG KCDM M
Sbjct  202  ECGAKCDMQM  211



>ref|XP_004959891.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=636

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            AA RFVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK N K CK F  F
Sbjct  30   AAARFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANGKACKPFADF  89

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
            G+SF  K G LP F++VDRGDC F  K WNAQN+GA+A+LVADD  E LITMDSPE  G+
Sbjct  90   GLSFKPKPGGLPVFLLVDRGDCYFTTKGWNAQNSGAAAVLVADDKVEPLITMDSPESSGT  149

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
               ++ENITIPSAL+ K FG+ L+KA+++G+MV+V LDWRE++PHPD+RVEYELWTNSND
Sbjct  150  E--HMENITIPSALVTKRFGDDLRKALQNGDMVNVLLDWRESLPHPDERVEYELWTNSND  207

Query  740  ECGYKCDMLM  769
            ECG KCDM M
Sbjct  208  ECGAKCDMQM  217



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+LKV SP S++G Y+ A+GNFG+PQYGG+M G V +PK N+KGCK F    I
Sbjct  25   GRFVVEKNSLKVTSPSSLRGVYECAIGNFGVPQYGGAMGGIVAFPKSNQKGCKPFSDDDI  84

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF  K G LP F++V+RG+C F LKAW+AQNAGA+A+LV DD  E LITMD+PEE G+  
Sbjct  85   SFKPKPGGLPVFLLVERGECFFTLKAWHAQNAGAAAVLVGDDRMEPLITMDTPEEGGAED  144

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +YV NITIPSAL+ KSFG+KLKK+V  G++V ++LDWRE VPHPDDRVEYE WTNSNDEC
Sbjct  145  DYVRNITIPSALVSKSFGDKLKKSVSKGDVVKISLDWRETVPHPDDRVEYEYWTNSNDEC  204

Query  746  GYKCD  760
            G KCD
Sbjct  205  GAKCD  209



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   269 bits (688),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSD  75

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F I + SK G +P F++VDR DC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  76   FDIFYKSKPGGMPVFLLVDRRDCFFTLKAWNAQQAGAGAILVADDRVEPLITMDTPEEED  135

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y+++ITIPSALI KS G+ +KK +  GEMV++NLDWREA+PHPDDRVEYE WTNSN
Sbjct  136  AKADYLQDITIPSALISKSLGDSIKKELSKGEMVNINLDWREALPHPDDRVEYEFWTNSN  195

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  196  DECGPKCE  203



>emb|CDY38157.1| BnaA07g02260D [Brassica napus]
Length=370

 Score =   262 bits (669),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  G FVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  45   SCMGMFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  104

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  105  FDISFISRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  164

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWRE----AVPHPDDRVEYELW  724
            + + Y+ NITIPSAL+ +S G  +K A+  G  V ++LDWRE    A+PHP+DRV YELW
Sbjct  165  ADAEYLLNITIPSALLSRSLGSTIKTAIDQGVPVRISLDWREIFFQALPHPNDRVAYELW  224

Query  725  TNSNDECGYKCDMLMK  772
            TNSNDECG KCD  ++
Sbjct  225  TNSNDECGSKCDAQIR  240



>ref|XP_004510100.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=629

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK NR GC  F+ 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKFNRNGCNKFND  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
               S +SK GS PTFV+VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  
Sbjct  80   GDTSLTSKPGSFPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDRIEPLITMDTPEEGN  139

Query  557  SSS--NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  730
             ++  +Y+E ITIPSALI KS G+ +K A+  G MV+VNLDWREA+PHPD+RVEYELWT+
Sbjct  140  GANDDDYIEKITIPSALISKSLGDNIKMALSSGAMVNVNLDWREALPHPDERVEYELWTS  199

Query  731  SNDECGYKCD  760
            SNDECG KC+
Sbjct  200  SNDECGPKCE  209



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK N+ GC  F+ 
Sbjct  18   SCMGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKLNKNGCTKFND  77

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
               S +SK GS PTFV+VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE  
Sbjct  78   ADTSLNSKPGSFPTFVLVDRGDCYFTLKAWNAQIGGAAAILVADDRVEPLITMDTPEEGN  137

Query  557  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  730
             ++N  YVE ITIPSALI KS G+ +KKA+  G MV+VNLDWREA+PHPD+RVEYELWT+
Sbjct  138  GATNDDYVEKITIPSALISKSVGDSIKKALSSGGMVNVNLDWREALPHPDERVEYELWTS  197

Query  731  SNDECGYKCD  760
            SNDECG KC+
Sbjct  198  SNDECGPKCE  207



>emb|CDX93144.1| BnaA03g38660D [Brassica napus]
Length=610

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 151/189 (80%), Gaps = 22/189 (12%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GT                   
Sbjct  28   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGT-------------------  68

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
               S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  69   ---SQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  125

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             Y+ENITIPSAL+ K+FGEKLKKA+  G+MV++NLDWREAVPHPD RVEYELWTNSNDEC
Sbjct  126  KYIENITIPSALVTKTFGEKLKKAISGGDMVNLNLDWREAVPHPDARVEYELWTNSNDEC  185

Query  746  GYKCDMLMK  772
            G KCDMLM+
Sbjct  186  GVKCDMLME  194



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVV+KN+LKV SP+S+KG ++ A+GNFG+PQYGG++ GTVVYP  N+  CK F  F +
Sbjct  27   GRFVVQKNSLKVTSPNSMKGAHECAIGNFGVPQYGGTLVGTVVYPSANQHACKEFREFDL  86

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF +K G LP FV+ DRGDC F LKAWNAQN GA+AILVADD EE LITMD PEE  + +
Sbjct  87   SFKTKPGGLPVFVLADRGDCYFTLKAWNAQNGGAAAILVADDREEPLITMDVPEEQKADA  146

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y+E ITIPSALI K+ G+ +KKA+  G MV++NLDW EA+PHPD+RVEYE WTNSNDEC
Sbjct  147  DYLEKITIPSALIRKNLGDSIKKALSGGNMVNLNLDWTEALPHPDERVEYEFWTNSNDEC  206

Query  746  GYKCD  760
            G KCD
Sbjct  207  GPKCD  211



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   266 bits (680),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 5/190 (3%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  79

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
               S SSK G+ PTFV+VDRGDC F LKAWNAQ  GA+AILVAD+ EE LITMD+PEE  
Sbjct  80   ---SLSSKPGTFPTFVLVDRGDCYFTLKAWNAQKGGAAAILVADNREEPLITMDTPEEGN  136

Query  557  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  730
             + +  Y+E I+IPSALI KS G+K+K+A+  G MV+VNLDWREA+PHPD+RVEYE WT+
Sbjct  137  GAKDDDYIEKISIPSALISKSLGDKIKQALSSGAMVNVNLDWREALPHPDERVEYEFWTS  196

Query  731  SNDECGYKCD  760
            SNDECG KC+
Sbjct  197  SNDECGPKCE  206



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKNNL+V SP S++G Y+ A+GNFG+PQYGG+M G+V YPK N+K C  F    I
Sbjct  28   GRFVVEKNNLRVTSPGSVRGIYECAIGNFGVPQYGGTMLGSVFYPKANQKACNTFQDSDI  87

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            ++ +K G +P F++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE  + +
Sbjct  88   TWKNKPGGIPIFLLADRGDCYFTLKAWNAQNAGAAAILVADDRIEPLITMDTPEETDAQA  147

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
            +Y++NI+IPSALI K  GE++KK +  GEMV +NLDWREA+PHPD+RVEYE WTNSNDEC
Sbjct  148  DYLQNISIPSALISKELGERMKKELSKGEMVSINLDWREALPHPDERVEYEFWTNSNDEC  207

Query  746  GYKCD  760
            G KC+
Sbjct  208  GPKCE  212



>gb|EPS72005.1| hypothetical protein M569_02753, partial [Genlisea aurea]
Length=557

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 149/191 (78%), Gaps = 0/191 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S   RFVVEKNNLKV SP+S+KG Y+ A+GNFG+PQYGG+M G+V YPK NR  C  F G
Sbjct  15   SCTARFVVEKNNLKVTSPESLKGLYECAIGNFGVPQYGGTMPGSVYYPKSNRHACSDFRG  74

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
              I++ +K G +P F++VDRG+C F LKAWN+Q AG +A+LV+DD  E LITMDSPEE  
Sbjct  75   SDITWRNKPGGIPAFLLVDRGECYFTLKAWNSQKAGVAAVLVSDDRIEPLITMDSPEESD  134

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            +  NY++NITIPSALI K  G+++K  +   +MV +NLDWRE++PHPDDRVEYELWTNSN
Sbjct  135  AQPNYLQNITIPSALITKQLGDRIKNELSRSQMVKLNLDWRESLPHPDDRVEYELWTNSN  194

Query  737  DECGYKCDMLM  769
            DECG KCD+ +
Sbjct  195  DECGPKCDIQL  205



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK N K CK F  FG+
Sbjct  36   GRFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANTKACKPFADFGL  95

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  565
            SF+ KAG LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMD+PE  G   
Sbjct  96   SFNPKAGGLPVFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRAEPLITMDTPESSGKE-  154

Query  566  NYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDEC  745
             ++ENIT+PSAL+ K FG+ LK A+++G+MV+V LDWRE++PHPD+RVEYE WTNSNDEC
Sbjct  155  -HLENITVPSALVSKRFGDDLKGALENGDMVNVLLDWRESLPHPDERVEYEFWTNSNDEC  213

Query  746  GYKCDMLM  769
            G KCDM M
Sbjct  214  GAKCDMQM  221



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = +2

Query  194  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  373
            ++AAGRFVVEKN+L+V SPDSIKG Y+ A+GNFG+PQYGG++ G V YPK NRK CK F+
Sbjct  20   DTAAGRFVVEKNSLRVTSPDSIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACKSFE  79

Query  374  GFGISF-SSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE  550
             F ISF S+++G  P FV++DRGDC F  KAWNAQNAGA+A+LVAD+  E LITMD+P++
Sbjct  80   DFDISFKSTRSGGRPKFVLIDRGDCYFTTKAWNAQNAGAAAVLVADNKLEPLITMDNPDD  139

Query  551  DGSSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  730
             G+   ++ENITIPS LI K  G+ LKK+ ++G+MV V LDWRE++PHPD+RVEYE WTN
Sbjct  140  AGTE--HLENITIPSVLITKELGDNLKKSAENGDMVSVLLDWRESLPHPDERVEYEFWTN  197

Query  731  SNDECGYKCDMLM  769
            SNDECG KCDM M
Sbjct  198  SNDECGPKCDMQM  210



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DISFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++NITIPSALI KS G+ LK A+  G+MV++ LDW E+VPHPD+RVEYELWTNSND
Sbjct  140  DADYLQNITIPSALITKSLGDSLKSALSKGDMVNMKLDWTESVPHPDERVEYELWTNSND  199

Query  740  ECGYKCDMLMK  772
            +CG KCD  ++
Sbjct  200  QCGTKCDTQIE  210



>ref|XP_002463394.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
 gb|EER99915.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
Length=636

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 2/186 (1%)
 Frame = +2

Query  212  FVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGISF  391
            FVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK + K C+ FD  G+SF
Sbjct  31   FVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKVDAKACRPFDASGLSF  90

Query  392  SSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSNY  571
              K+G LP F++VDRGDC F  K WNAQNAGA+A+LVADD  E LITMDSPE  G+   +
Sbjct  91   KPKSGGLPVFLLVDRGDCYFTTKGWNAQNAGAAAVLVADDKVEPLITMDSPESSGTE--H  148

Query  572  VENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECGY  751
            +ENITIPSAL+ K FG+ L+KA+++GEMV+V LDWRE++PHPD+RVEYE WTNSNDECG 
Sbjct  149  IENITIPSALVTKRFGDDLRKALQNGEMVNVLLDWRESLPHPDERVEYEFWTNSNDECGA  208

Query  752  KCDMLM  769
            KCDM M
Sbjct  209  KCDMQM  214



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G V+YPK N+K C  F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTLVGNVMYPKSNKKSCNNFSD  75

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F I + SK G  P F++VDRGDC F LKAWNAQ AGA AILVAD+  E LITMD+PEE+ 
Sbjct  76   FDIFYKSKPGGRPVFLLVDRGDCFFTLKAWNAQQAGAGAILVADNRVEPLITMDTPEEED  135

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSN  736
            + ++Y+++ITIPSALI KS G+ +K+ +  GE+V++NLDWREA+PHPDDRVEYE WTNSN
Sbjct  136  AKADYLQDITIPSALISKSLGDSIKRELSKGELVNINLDWREALPHPDDRVEYEFWTNSN  195

Query  737  DECGYKCD  760
            DECG KC+
Sbjct  196  DECGPKCE  203



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   264 bits (674),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKNNLKV SP+S++G Y+ A+GNFG+PQYGG M G+V YPK N+KGC  F    +
Sbjct  24   GRFVVEKNNLKVTSPESVRGVYECAIGNFGVPQYGGVMVGSVFYPKTNQKGCNTFQDSDL  83

Query  386  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-DGSS  562
            S  +K G +P FV+ DRG+C F LKAWNAQN GA+AILVADD  E LITMD+PEE D + 
Sbjct  84   SSKTKPGGIPLFVLADRGECYFTLKAWNAQNGGAAAILVADDRVEPLITMDTPEEADAAQ  143

Query  563  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  742
            +NY++NITIPSALI    G+++KK +  GEMV + LDWREA+PHPDDRVEYE WTNSNDE
Sbjct  144  ANYLQNITIPSALISNQLGDRIKKVLAKGEMVTIYLDWREALPHPDDRVEYEFWTNSNDE  203

Query  743  CGYKCD  760
            CG KC+
Sbjct  204  CGPKCE  209



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             I+F SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DITFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++NITIPSALI KS G+ LK A+  G+MV++ LDW E+VPHPD+RVEYELWTNSND
Sbjct  140  DADYLQNITIPSALIAKSLGDSLKSALSKGDMVNMKLDWTESVPHPDERVEYELWTNSND  199

Query  740  ECGYKCDMLMK  772
            +CG KCD  ++
Sbjct  200  QCGKKCDTQIE  210



>ref|XP_007134557.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
 gb|ESW06551.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
Length=625

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 5/190 (3%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  G FVVEKNNLK+ SP+S+KG Y+ A+GNFG+P+YGG+M G+VVYPK ++ GCK FD 
Sbjct  21   SCVGTFVVEKNNLKITSPNSLKGIYECAIGNFGVPKYGGTMIGSVVYPKTDQNGCKPFDS  80

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
               S SSK G+ P+FV++DRG+C F LKAWNAQ  GA+AILVADD  E LITMD+PEE  
Sbjct  81   ---SLSSKPGTFPSFVLIDRGECFFTLKAWNAQKGGAAAILVADDRTEPLITMDTPEEGN  137

Query  557  SSSN--YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTN  730
             +SN  Y+E I+IPSALI KS G+K+K A+  GEMV+VNLDWREA+PHPD+RVEYE WT+
Sbjct  138  GASNDDYIEKISIPSALISKSLGDKIKSALSSGEMVNVNLDWREALPHPDERVEYEFWTS  197

Query  731  SNDECGYKCD  760
            SNDECG KC+
Sbjct  198  SNDECGPKCE  207



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             I+F SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DITFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++NITIPSALI KS G+ LK A+  G+MV++ LDW E+VPHPD+RVEYELWTNSND
Sbjct  140  DADYLQNITIPSALITKSLGDSLKSALSKGDMVNMKLDWTESVPHPDERVEYELWTNSND  199

Query  740  ECGYKCDMLMK  772
            +CG KCD  ++
Sbjct  200  QCGKKCDTQIE  210



>ref|NP_001169232.1| hypothetical protein precursor [Zea mays]
 gb|ACN32039.1| unknown [Zea mays]
 gb|ACN34630.1| unknown [Zea mays]
 tpg|DAA64135.1| TPA: hypothetical protein ZEAMMB73_440222 [Zea mays]
Length=633

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 150/187 (80%), Gaps = 2/187 (1%)
 Frame = +2

Query  209  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  388
            RFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK + K C+ F   G+S
Sbjct  27   RFVVEKNSLRVTSPAVLRGVYECAIGNFGMPQYGGTMHGVVVYPKADAKACRPFADSGLS  86

Query  389  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  568
            F  ++G LP F++VDRGDC F  K WNAQNAGA+A+LVADD  E LITMDSPE  G+   
Sbjct  87   FKPRSGGLPVFLLVDRGDCYFTTKGWNAQNAGAAAVLVADDRVEPLITMDSPESSGTE--  144

Query  569  YVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDECG  748
            ++ENITIPSAL+ K FGE L+KA++ G+MV+V LDWRE++PHPD+RVEYELWTNSNDECG
Sbjct  145  HIENITIPSALVTKRFGEDLRKALQSGDMVNVLLDWRESLPHPDERVEYELWTNSNDECG  204

Query  749  YKCDMLM  769
             KCDM M
Sbjct  205  AKCDMQM  211



>gb|AAN60346.1| unknown [Arabidopsis thaliana]
Length=216

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
             ISF SK G LPTFV++DRGDC F LKAW AQ AGA+AILVAD   E LITMD+PEED S
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKS  136

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++NITIPSALI K+ G+ +K A+  G+MV++ LDW E+VPHPD+RV YELWTN +D
Sbjct  137  DADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHPDERVXYELWTNXHD  196

Query  740  ECGYKCD  760
             CG K D
Sbjct  197  XCGXKXD  203



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  197  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  376
            S  GRFVVEKN+L+V S + I+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  30   SCMGRFVVEKNSLRVTSAEFIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  89

Query  377  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  556
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  90   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  149

Query  557  SSSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWRE----AVPHPDDRVEYELW  724
            + + Y++NITIPSAL+ +S G  +K A+  GE V ++LDWRE    A+PHP+DRV YELW
Sbjct  150  ADAEYLQNITIPSALLSRSLGSAIKTAINQGEPVRISLDWREIFFQALPHPNDRVAYELW  209

Query  725  TNSNDECGYKCDMLMK  772
            TNSNDECG KCD  ++
Sbjct  210  TNSNDECGSKCDAQIR  225



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 149/189 (79%), Gaps = 4/189 (2%)
 Frame = +2

Query  206  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  385
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YPK NRK C+ FD F I
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  386  SFSSK-AGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  562
            SF  K AG  PTFV+VDRG+C F  KAWNAQNAGA+A+LV DD  E LITMD+PEE    
Sbjct  84   SFKPKQAGGRPTFVLVDRGECFFTTKAWNAQNAGAAAVLVVDDKSEPLITMDNPEE---G  140

Query  563  SNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSNDE  742
              ++ENITIPS LI K  GE LKK+V++G+M+ V LDWRE++PHPD+RVEYE WTNSNDE
Sbjct  141  KEHLENITIPSVLITKKLGESLKKSVENGDMLSVLLDWRESLPHPDERVEYEFWTNSNDE  200

Query  743  CGYKCDMLM  769
            CG KCDM M
Sbjct  201  CGPKCDMQM  209



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
               RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+  
Sbjct  19   CVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDT  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF  K G LPTFV+VDRGDC F LKAWNAQ  GA+AILV D+  E+LITMD+PE++ +
Sbjct  79   DESFKPKPGGLPTFVLVDRGDCYFTLKAWNAQKGGAAAILVVDNKNEQLITMDTPEQEDA  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++NITIPSALI K  G+ +KK++   EMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQNITIPSALISKELGDSIKKSLSGDEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  740  ECGYKCD  760
            ECG KCD
Sbjct  199  ECGPKCD  205



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  200  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  379
               RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+  
Sbjct  19   CVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDT  78

Query  380  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  559
              SF  K G LPTFV+VDRGDC F LKAWNAQ  GA+AILV D+  E+LITMD+PE++ +
Sbjct  79   DESFKPKPGGLPTFVLVDRGDCYFTLKAWNAQKGGAAAILVVDNKNEQLITMDTPEQEDA  138

Query  560  SSNYVENITIPSALIEKSFGEKLKKAVKDGEMVHVNLDWREAVPHPDDRVEYELWTNSND  739
             ++Y++NITIPSALI K  G+ +KK++   EMV++NLDW EA+PHPD+RVEYE WTNSND
Sbjct  139  DADYLQNITIPSALISKELGDSIKKSLSGDEMVNINLDWTEALPHPDERVEYEFWTNSND  198

Query  740  ECGYKCD  760
            ECG KCD
Sbjct  199  ECGPKCD  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1538697559425