BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12108

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615358.1|  PREDICTED: nephrocystin-3                          134   4e-33   Nicotiana tomentosiformis
ref|XP_009802725.1|  PREDICTED: nephrocystin-3                          134   4e-33   Nicotiana sylvestris
ref|NP_001266207.1|  kinesin light chain I2I isoform                    118   4e-27   Solanum lycopersicum
ref|XP_006343812.1|  PREDICTED: nephrocystin-3-like                     114   1e-25   Solanum tuberosum [potatoes]
emb|CDP12192.1|  unnamed protein product                                113   2e-25   Coffea canephora [robusta coffee]
ref|XP_006352234.1|  PREDICTED: nephrocystin-3-like                     112   6e-25   Solanum tuberosum [potatoes]
gb|EYU33495.1|  hypothetical protein MIMGU_mgv1a003155mg                102   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_011070356.1|  PREDICTED: nephrocystin-3                          101   3e-21   Sesamum indicum [beniseed]
gb|EPS61693.1|  hypothetical protein M569_13098                         100   1e-20   Genlisea aurea
ref|XP_002264247.1|  PREDICTED: uncharacterized protein LOC100267266  95.5    3e-19   Vitis vinifera
ref|XP_010267540.1|  PREDICTED: uncharacterized protein LOC104604745  88.6    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_002263593.1|  PREDICTED: kinesin light chain 4                 80.5    4e-14   
ref|XP_007040594.1|  Tetratricopeptide repeat (TPR)-like superfam...  79.0    2e-13   
ref|XP_010266592.1|  PREDICTED: uncharacterized protein LOC104604058  76.3    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010107265.1|  hypothetical protein L484_007826                 75.9    2e-12   Morus notabilis
ref|XP_008795621.1|  PREDICTED: kinesin light chain 1-like isofor...  75.5    2e-12   
ref|XP_012086672.1|  PREDICTED: nephrocystin-3                        75.1    3e-12   Jatropha curcas
ref|XP_008795620.1|  PREDICTED: kinesin light chain 4-like isofor...  75.1    3e-12   Phoenix dactylifera
ref|XP_010915164.1|  PREDICTED: kinesin light chain-like              74.3    5e-12   Elaeis guineensis
ref|XP_002518863.1|  kinesin light chain, putative                    73.2    1e-11   Ricinus communis
ref|XP_007160195.1|  hypothetical protein PHAVU_002G301000g           72.8    2e-11   Phaseolus vulgaris [French bean]
ref|XP_008451914.1|  PREDICTED: LOW QUALITY PROTEIN: nephrocystin...  71.6    4e-11   
ref|XP_007051512.1|  Tetratricopeptide repeat (TPR)-like superfam...  70.9    7e-11   
gb|KHG17048.1|  Nephrocystin-3                                        70.9    7e-11   Gossypium arboreum [tree cotton]
ref|XP_006396997.1|  hypothetical protein EUTSA_v10028519mg           70.9    8e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009358646.1|  PREDICTED: uncharacterized protein LOC103949...  69.7    2e-10   
ref|XP_009358645.1|  PREDICTED: uncharacterized protein LOC103949...  69.7    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_011026834.1|  PREDICTED: nephrocystin-3-like                   69.3    3e-10   Populus euphratica
ref|NP_974530.1|  protein KINESIN LIGHT CHAIN-RELATED 1               68.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007210269.1|  hypothetical protein PRUPE_ppa003147mg           68.9    3e-10   Prunus persica
ref|NP_192822.1|  protein KINESIN LIGHT CHAIN-RELATED 1               68.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63491.1|  putative kinesin light chain                          68.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002297964.2|  hypothetical protein POPTR_0001s10980g           68.9    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008367901.1|  PREDICTED: nephrocystin-3-like                   68.6    5e-10   
ref|XP_006287252.1|  hypothetical protein CARUB_v10000441mg           68.2    5e-10   
ref|XP_004300493.1|  PREDICTED: nephrocystin-3                        68.2    5e-10   Fragaria vesca subsp. vesca
emb|CDY05122.1|  BnaC03g29200D                                        67.8    6e-10   
gb|KJB09631.1|  hypothetical protein B456_001G153600                  67.8    7e-10   Gossypium raimondii
ref|XP_004148984.1|  PREDICTED: kinesin light chain                   67.4    1e-09   Cucumis sativus [cucumbers]
gb|KDO86517.1|  hypothetical protein CISIN_1g007930mg                 67.0    1e-09   Citrus sinensis [apfelsine]
ref|XP_006491305.1|  PREDICTED: nephrocystin-3-like                   67.0    1e-09   Citrus sinensis [apfelsine]
ref|XP_006444813.1|  hypothetical protein CICLE_v10019438mg           67.0    1e-09   Citrus clementina [clementine]
ref|XP_010455474.1|  PREDICTED: kinesin light chain-like isoform X1   66.2    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011022457.1|  PREDICTED: uncharacterized protein LOC105124230  65.9    3e-09   Populus euphratica
gb|KFK31862.1|  hypothetical protein AALP_AA6G167900                  65.9    3e-09   Arabis alpina [alpine rockcress]
ref|XP_002304567.2|  hypothetical protein POPTR_0003s14320g           65.5    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010422007.1|  PREDICTED: uncharacterized protein LOC104707372  65.1    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010436694.1|  PREDICTED: uncharacterized protein LOC104720497  65.1    5e-09   Camelina sativa [gold-of-pleasure]
emb|CDX90788.1|  BnaA03g24680D                                        64.7    8e-09   
ref|XP_008795853.1|  PREDICTED: kinesin light chain 4-like            64.3    9e-09   Phoenix dactylifera
ref|XP_010676242.1|  PREDICTED: kinesin light chain                   63.9    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002872538.1|  hypothetical protein ARALYDRAFT_489926           63.5    2e-08   
ref|XP_010324680.1|  PREDICTED: kinesin light chain 4-like            63.2    2e-08   
gb|KDO76619.1|  hypothetical protein CISIN_1g011858mg                 62.8    3e-08   Citrus sinensis [apfelsine]
ref|XP_009134209.1|  PREDICTED: nephrocystin-3                        62.4    4e-08   Brassica rapa
ref|XP_006476340.1|  PREDICTED: nephrocystin-3-like                   62.4    4e-08   Citrus sinensis [apfelsine]
ref|XP_006439287.1|  hypothetical protein CICLE_v10019420mg           62.4    4e-08   Citrus clementina [clementine]
ref|XP_009344036.1|  PREDICTED: kinesin light chain-like              62.0    6e-08   Pyrus x bretschneideri [bai li]
ref|XP_009334359.1|  PREDICTED: nephrocystin-3-like isoform X2        60.8    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_012083176.1|  PREDICTED: nephrocystin-3-like isoform X3        60.8    1e-07   Jatropha curcas
ref|XP_009334358.1|  PREDICTED: nephrocystin-3-like isoform X1        60.8    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_012083173.1|  PREDICTED: nephrocystin-3-like isoform X1        60.8    1e-07   
ref|XP_012083175.1|  PREDICTED: nephrocystin-3-like isoform X2        60.8    1e-07   Jatropha curcas
ref|XP_008376154.1|  PREDICTED: nephrocystin-3-like                   60.5    2e-07   Malus domestica [apple tree]
ref|XP_009421472.1|  PREDICTED: uncharacterized protein LOC104001021  60.5    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004308296.1|  PREDICTED: nephrocystin-3-like                   60.5    2e-07   Fragaria vesca subsp. vesca
gb|KEH18621.1|  kinesin light chain                                   59.3    4e-07   Medicago truncatula
ref|XP_010924445.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin ligh...  59.3    5e-07   Elaeis guineensis
ref|XP_009375418.1|  PREDICTED: nephrocystin-3-like                   58.9    6e-07   Pyrus x bretschneideri [bai li]
gb|KEH21270.1|  kinesin light chain                                   56.2    5e-06   Medicago truncatula
ref|XP_004503588.1|  PREDICTED: nephrocystin-3-like                   55.8    5e-06   Cicer arietinum [garbanzo]
ref|XP_008239183.1|  PREDICTED: nephrocystin-3                        55.8    6e-06   
ref|XP_003548412.1|  PREDICTED: nephrocystin-3-like                   55.5    8e-06   Glycine max [soybeans]
ref|XP_008337561.1|  PREDICTED: nephrocystin-3-like                   55.5    8e-06   
ref|XP_007220647.1|  hypothetical protein PRUPE_ppa003486mg           54.7    1e-05   
ref|XP_007135270.1|  hypothetical protein PHAVU_010G115100g           54.3    2e-05   Phaseolus vulgaris [French bean]
ref|XP_002302642.2|  hypothetical protein POPTR_0002s17420g           53.1    2e-05   
ref|XP_008233119.1|  PREDICTED: nephrocystin-3-like                   53.9    2e-05   Prunus mume [ume]
ref|XP_003530449.1|  PREDICTED: nephrocystin-3-like                   53.9    2e-05   Glycine max [soybeans]
gb|KHN16719.1|  Nephrocystin-3                                        53.9    2e-05   Glycine soja [wild soybean]
ref|XP_003525334.1|  PREDICTED: nephrocystin-3-like                   53.5    3e-05   Glycine max [soybeans]
ref|XP_010541795.1|  PREDICTED: kinesin light chain-like              53.5    4e-05   Tarenaya hassleriana [spider flower]
gb|KCW77343.1|  hypothetical protein EUGRSUZ_D01704                   52.4    8e-05   Eucalyptus grandis [rose gum]
gb|KJB37462.1|  hypothetical protein B456_006G206300                  52.4    9e-05   Gossypium raimondii
ref|XP_010053096.1|  PREDICTED: kinesin light chain 4                 52.4    1e-04   Eucalyptus grandis [rose gum]
gb|KHG14140.1|  Nephrocystin-3                                        52.0    1e-04   Gossypium arboreum [tree cotton]
gb|KJB37463.1|  hypothetical protein B456_006G206300                  52.0    1e-04   Gossypium raimondii
ref|XP_011038461.1|  PREDICTED: nephrocystin-3-like isoform X3        50.8    3e-04   Populus euphratica
ref|XP_002523319.1|  kinesin light chain, putative                    50.4    3e-04   
ref|XP_011038453.1|  PREDICTED: nephrocystin-3-like isoform X2        50.4    3e-04   Populus euphratica
ref|XP_002320874.1|  hypothetical protein POPTR_0014s09590g           50.4    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011038446.1|  PREDICTED: kinesin light chain 4-like isofor...  50.4    4e-04   Populus euphratica
ref|XP_003571751.1|  PREDICTED: nephrocystin-3                        50.1    5e-04   Brachypodium distachyon [annual false brome]
ref|NP_001045645.1|  Os02g0109800                                     49.7    8e-04   
dbj|BAK04667.1|  predicted protein                                    49.3    0.001   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU17664.1|  hypothetical protein MIMGU_mgv1a002285mg              49.3    0.001   Erythranthe guttata [common monkey flower]



>ref|XP_009615358.1| PREDICTED: nephrocystin-3 [Nicotiana tomentosiformis]
Length=605

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPGIVSVKTPPEA PLRI+VPDES G++GA+S RSE VN K +SPAPRRPPSPSPSTSRA
Sbjct  1    MPGIVSVKTPPEAQPLRISVPDESNGRVGASSERSEPVNPKSNSPAPRRPPSPSPSTSRA  60

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSPDR SGKKKSPPEK VIDESSLDNPDLGPFLLKLARDTIASGEG
Sbjct  61   KPSPDRSSGKKKSPPEKIVIDESSLDNPDLGPFLLKLARDTIASGEG  107



>ref|XP_009802725.1| PREDICTED: nephrocystin-3 [Nicotiana sylvestris]
Length=605

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPGIVSVKTPPEA PLRI+VPDES G++GA+S RSE VN K +SPAPRRPPSPSPSTSRA
Sbjct  1    MPGIVSVKTPPEAQPLRISVPDESNGRVGASSERSEPVNPKSNSPAPRRPPSPSPSTSRA  60

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSPDR SGKKKSPPEK VIDESSLDNPDLGPFLLKLARDTIASGEG
Sbjct  61   KPSPDRSSGKKKSPPEKIVIDESSLDNPDLGPFLLKLARDTIASGEG  107



>ref|NP_001266207.1| kinesin light chain I2I isoform [Solanum lycopersicum]
 gb|AEW69782.1| Hop-interacting protein THI007 [Solanum lycopersicum]
Length=605

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPPE   LRI+V DE+ G+  + SSRSE VN K +SPAPRRPPSPS S ++ 
Sbjct  1    MPGLVSVKTPPETPALRISVSDENHGRNASGSSRSEQVNPKTNSPAPRRPPSPSTSRAKP  60

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
             P  DRGSGKKKSPPEK  IDESSLDNPDLGPFLLKLARDTIASGEG
Sbjct  61   SP--DRGSGKKKSPPEKVEIDESSLDNPDLGPFLLKLARDTIASGEG  105



>ref|XP_006343812.1| PREDICTED: nephrocystin-3-like [Solanum tuberosum]
Length=601

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 93/107 (87%), Gaps = 4/107 (4%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPGIVSVKTPPEA PLRI+V +E+ G++     RSE V  K +SPAPRRPPSPSPSTSRA
Sbjct  1    MPGIVSVKTPPEAPPLRISVSEETNGRV----DRSEPVIPKSNSPAPRRPPSPSPSTSRA  56

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSPDR SGKKKSPPEK VIDESSLDNPDLGPFLLKLARDTIASGEG
Sbjct  57   KPSPDRSSGKKKSPPEKVVIDESSLDNPDLGPFLLKLARDTIASGEG  103



>emb|CDP12192.1| unnamed protein product [Coffea canephora]
Length=605

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPPEA PLRI VP +S GQ      RSE  + K ++PA RRPPSPSPSTSRA
Sbjct  1    MPGLVSVKTPPEAPPLRIMVPQDSNGQTRPVPERSEPGSVKTNTPAQRRPPSPSPSTSRA  60

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSPDR SGKKKSPPEK VIDE+SLDNPDLGPFLLKLARDTIASGEG
Sbjct  61   KPSPDRSSGKKKSPPEKTVIDETSLDNPDLGPFLLKLARDTIASGEG  107



>ref|XP_006352234.1| PREDICTED: nephrocystin-3-like [Solanum tuberosum]
Length=605

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VS+KTPPE   LRI++ DE+ G+ G  SSRSE VN K +SPAPRRPPSPS S ++ 
Sbjct  1    MPGLVSIKTPPETPALRISISDENHGRNGPGSSRSEQVNPKTNSPAPRRPPSPSTSRAKP  60

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
             P  DR SGKKKS PEK  IDESSLDNPDLGPFLLKLARDTIASGEG
Sbjct  61   SP--DRSSGKKKSSPEKVEIDESSLDNPDLGPFLLKLARDTIASGEG  105



>gb|EYU33495.1| hypothetical protein MIMGU_mgv1a003155mg [Erythranthe guttata]
Length=604

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDES-QGQIGANSSRSENVNtkpsspaprrppspspstsr  467
            MPG+VSVKTPP+A PLRI VP+E     I   + RSE    K SSPA RRPPSPSPSTSR
Sbjct  1    MPGLVSVKTPPDAPPLRIAVPEEPPHTPIRPETVRSE---AKSSSPATRRPPSPSPSTSR  57

Query  468  akpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            AKPSPDRGS KKKSPPEK +I+ESSLDNPDLGPFLLKLARDTIASGEG
Sbjct  58   AKPSPDRGSAKKKSPPEKTLINESSLDNPDLGPFLLKLARDTIASGEG  105



>ref|XP_011070356.1| PREDICTED: nephrocystin-3 [Sesamum indicum]
Length=603

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 93/108 (86%), Gaps = 4/108 (4%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDES-QGQIGANSSRSENVNtkpsspaprrppspspstsr  467
            MPG+VSVKTPP+A P+RITVP+E  +  +   ++RSE    + +SPA RRPPSPSPSTSR
Sbjct  1    MPGLVSVKTPPDAPPIRITVPEEPPRTPVPPEATRSE---PRTNSPATRRPPSPSPSTSR  57

Query  468  akpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            AKPSPDRGS KKKSPPEK++I+ESSLDNPDLGPFLLKLARDTIASGEG
Sbjct  58   AKPSPDRGSAKKKSPPEKSLINESSLDNPDLGPFLLKLARDTIASGEG  105



>gb|EPS61693.1| hypothetical protein M569_13098 [Genlisea aurea]
Length=610

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 6/110 (5%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDES-QGQIGANSSRSENVNtkpsspaprrppspspstsr  467
            MPG+VSVKTPPEATPLRI+VPD   Q  +   SSRSE    K +SPA RRPPSPSPS+SR
Sbjct  1    MPGLVSVKTPPEATPLRISVPDARPQTPVQPGSSRSE---LKSNSPARRRPPSPSPSSSR  57

Query  468  akpspDRGS--GKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
             KPSPDRGS   KKKSPPEK +I+ESSL+NPDLGPFLLKL+RDTIA GEG
Sbjct  58   VKPSPDRGSLLVKKKSPPEKLLINESSLENPDLGPFLLKLSRDTIAGGEG  107



>ref|XP_002264247.1| PREDICTED: uncharacterized protein LOC100267266 [Vitis vinifera]
 emb|CBI40572.3| unnamed protein product [Vitis vinifera]
Length=596

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 78/106 (74%), Gaps = 8/106 (8%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP  +TPLRI +P+ SQ     + SR    N  P        PSPS STSRA
Sbjct  1    MPGLVSVKTPRASTPLRIFLPENSQ----CDGSR----NGSPQVQRRMASPSPSTSTSRA  52

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            +PSPDRGSG+KK+ PEK  IDESSLDNPDLGPFLLK+ARDTIASG+
Sbjct  53   RPSPDRGSGRKKTTPEKTTIDESSLDNPDLGPFLLKMARDTIASGD  98



>ref|XP_010267540.1| PREDICTED: uncharacterized protein LOC104604745 [Nelumbo nucifera]
Length=601

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 77/106 (73%), Gaps = 4/106 (4%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VS+KTPPEATPLR+ VPD    Q  ++    EN+N K  SP P+R PSPS S +  
Sbjct  1    MPGLVSLKTPPEATPLRVLVPDGDH-QFQSHEVELENLNPKTRSPIPKRTPSPSTSRATP  59

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
             P   R SGKKK+P EK  IDESSLDN DLGPFLLKLARDTIASG+
Sbjct  60   SP--GRSSGKKKTP-EKPKIDESSLDNSDLGPFLLKLARDTIASGD  102



>ref|XP_002263593.1| PREDICTED: kinesin light chain 4 [Vitis vinifera]
Length=591

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 75/107 (70%), Gaps = 14/107 (13%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A+PL I+V +          S SE+ N+K +S  P++ PSPS S SR 
Sbjct  1    MPGLVSVKTPPDASPLTISVTE--------AGSVSESRNSKFASSTPKKTPSPSTSRSRP  52

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
             P  DR    KK PPE  V+DESSLDNPDLGPFLLKLARD IASG+G
Sbjct  53   SP--DR----KKKPPESPVLDESSLDNPDLGPFLLKLARDAIASGDG  93



>ref|XP_007040594.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY25095.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=588

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 65/107 (61%), Gaps = 17/107 (16%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVK+PP+A PLRI+VPD++      N  R+ N                 PS S +
Sbjct  1    MPGLVSVKSPPDAPPLRISVPDQAPPH---NPPRTPN--------------KRVPSPSPS  43

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            +  P      KK PPE    D+SSLDNPDLGPFLLKLARDTIASGEG
Sbjct  44   RSKPSPARSAKKPPPESPNPDDSSLDNPDLGPFLLKLARDTIASGEG  90



>ref|XP_010266592.1| PREDICTED: uncharacterized protein LOC104604058 [Nelumbo nucifera]
Length=604

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 81/107 (76%), Gaps = 3/107 (3%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP ++  LR+ VPD    Q+  +   SE  N K  SP P+R PSPSPSTSR 
Sbjct  1    MPGLVSVKTPQDSPSLRVLVPD-GDPQVQNHDMGSETPNPKTKSPIPKRAPSPSPSTSRG  59

Query  471  kpsp-DRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            +PSP DR SGKKK+P EK  +DESSLDNPDLGPFLLKLARDTIASG+
Sbjct  60   RPSPPDRSSGKKKTP-EKPKLDESSLDNPDLGPFLLKLARDTIASGD  105



>ref|XP_010107265.1| hypothetical protein L484_007826 [Morus notabilis]
 gb|EXC14459.1| hypothetical protein L484_007826 [Morus notabilis]
Length=605

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A PLRI+V +         + RSE    K  SP P+R PSPSPS SR+
Sbjct  1    MPGLVSVKTPPDAPPLRISVSEAQTPTSTTQAQRSEPGIPKTPSPHPKRLPSPSPSNSRS  60

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSPDR S K +S     ++ E SLDNPDLGPFLLKLARDTIASG+G
Sbjct  61   KPSPDRRSKKPQSDSPNQILSEMSLDNPDLGPFLLKLARDTIASGDG  107



>ref|XP_008795621.1| PREDICTED: kinesin light chain 1-like isoform X2 [Phoenix dactylifera]
Length=559

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 68/107 (64%), Gaps = 3/107 (3%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+V+   PP+A PLRI VPD+   QI   S     +  K S+P+P       PS  R 
Sbjct  1    MPGLVA---PPDAPPLRIAVPDDGDTQIRRPSDIRSPIPKKASTPSPSSSSRARPSPDRK  57

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            K +P   S +K+ PP  A  DE++LDNPDLGPFLLKLARDTIASGEG
Sbjct  58   KRTPGSSSAEKQRPPTVAAADEAALDNPDLGPFLLKLARDTIASGEG  104



>ref|XP_012086672.1| PREDICTED: nephrocystin-3 [Jatropha curcas]
 gb|KDP25259.1| hypothetical protein JCGZ_20415 [Jatropha curcas]
Length=601

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPPEA PLRI+VP+        + +R E V        PR P    PS S +
Sbjct  1    MPGLVSVKTPPEAPPLRISVPEIQSQAQQQSQTRPEPV-------VPRTPNKKPPSPSPS  53

Query  471  kpspDRGSGKKKSPPEK---AVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            +  P      KK PP+     ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  54   RSKPSPTRSAKKPPPDSPNPLLLADASLDNPDLGPFLLKLARDTIASGEG  103



>ref|XP_008795620.1| PREDICTED: kinesin light chain 4-like isoform X1 [Phoenix dactylifera]
Length=601

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 68/107 (64%), Gaps = 3/107 (3%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+V+   PP+A PLRI VPD+   QI   S     +  K S+P+P       PS  R 
Sbjct  1    MPGLVA---PPDAPPLRIAVPDDGDTQIRRPSDIRSPIPKKASTPSPSSSSRARPSPDRK  57

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            K +P   S +K+ PP  A  DE++LDNPDLGPFLLKLARDTIASGEG
Sbjct  58   KRTPGSSSAEKQRPPTVAAADEAALDNPDLGPFLLKLARDTIASGEG  104



>ref|XP_010915164.1| PREDICTED: kinesin light chain-like [Elaeis guineensis]
Length=601

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 63/111 (57%), Gaps = 11/111 (10%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+V+   PP+ATPLRI VPD+   QI     R   V +     A    PS S     +
Sbjct  1    MPGLVA---PPDATPLRIAVPDDGDTQI----RRPGEVRSPMPKKASTPSPSSSSRARPS  53

Query  471  kpspDR----GSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                 R     S +K+  P  A  DE++LDNPDLGPFLLKLARDTIASGEG
Sbjct  54   PDRKKRTPGSSSAEKQRAPTMAAADEAALDNPDLGPFLLKLARDTIASGEG  104



>ref|XP_002518863.1| kinesin light chain, putative [Ricinus communis]
 gb|EEF43396.1| kinesin light chain, putative [Ricinus communis]
Length=605

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 72/110 (65%), Gaps = 6/110 (5%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A PLRI+VP E Q Q  A +       +            PSPS SR+
Sbjct  1    MPGLVSVKTPPDAPPLRISVP-EIQPQTQAQTPPQARPESSVLRTPTPNKKPPSPSPSRS  59

Query  471  kpspDRGSGKKKSPPEK---AVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSP R +  KK PP+     ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  60   KPSPTRSA--KKPPPDSLNPLLLADASLDNPDLGPFLLKLARDTIASGEG  107



>ref|XP_007160195.1| hypothetical protein PHAVU_002G301000g [Phaseolus vulgaris]
 gb|ESW32189.1| hypothetical protein PHAVU_002G301000g [Phaseolus vulgaris]
Length=592

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 13/107 (12%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPPEA PLRI+VP+    +  AN     N N K  SP P++PPSPSPS S  
Sbjct  1    MPGLVSVKTPPEAQPLRISVPNTPTQRSEAN-----NANNKTPSPLPKKPPSPSPSRSSK  55

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            K +P+         P   ++ ++SLDNPDLGPFLLKLARDTIASG+G
Sbjct  56   KKTPE--------TPTNPILSDASLDNPDLGPFLLKLARDTIASGDG  94



>ref|XP_008451914.1| PREDICTED: LOW QUALITY PROTEIN: nephrocystin-3-like [Cucumis 
melo]
Length=593

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 64/111 (58%), Gaps = 20/111 (18%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A PLRI+VPD++     A + R  +            P S    +   
Sbjct  1    MPGLVSVKTPPDAPPLRISVPDDTP----ATNHRPPS------------PLSKKQPSPSP  44

Query  471  kpspDRGSGKKKSPPEKAVIDE----SSLDNPDLGPFLLKLARDTIASGEG  611
              S    +GKKK  PE     +    SSLDNPDLGPFLLKLARDTIASG+G
Sbjct  45   SRSKPSPNGKKKLQPESPTSAQFPPDSSLDNPDLGPFLLKLARDTIASGDG  95



>ref|XP_007051512.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOX95669.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=576

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 56/106 (53%), Gaps = 26/106 (25%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG++S+KTPP ATPL I +  +  G     S R+ + +   S                 
Sbjct  1    MPGLLSIKTPPNATPLSILLAGKENG---GGSKRTPSPSPSVSR----------------  41

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
                   S   K  P+K  IDE SLDNPDLGPFLLKLARDTIASG+
Sbjct  42   -------SKPTKRTPDKTHIDECSLDNPDLGPFLLKLARDTIASGD  80



>gb|KHG17048.1| Nephrocystin-3 [Gossypium arboreum]
Length=569

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 54/106 (51%), Gaps = 25/106 (24%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+ SVKTPP ATPLR+ +     G  G     S + +                     
Sbjct  1    MPGLFSVKTPPNATPLRVLIAATENGAGGTRRPPSPSPSVSR------------------  42

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
                   +   K  P+K+ IDE SL+NPDLGPFLLKLARDTIASG+
Sbjct  43   -------TKPTKKTPDKSGIDEYSLENPDLGPFLLKLARDTIASGD  81



>ref|XP_006396997.1| hypothetical protein EUTSA_v10028519mg [Eutrema salsugineum]
 gb|ESQ38450.1| hypothetical protein EUTSA_v10028519mg [Eutrema salsugineum]
Length=610

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 63/111 (57%), Gaps = 16/111 (14%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPGIVSVKTP +  PLR+ VPD         ++RSE  N   +        +PS S    
Sbjct  4    MPGIVSVKTPADTPPLRVAVPD-------TQTTRSELSNPPRTPMKKTPSSTPSRSKPSP  56

Query  471  kpspDRGSGKKKSP--PEKAVI--DESSLDNPDLGPFLLKLARDTIASGEG  611
                   SGKK SP     AV+  D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  57   GR-----SGKKDSPGVSSAAVVDADDPSLDNPDLGPFLLKLARDAIASGEG  102



>ref|XP_009358646.1| PREDICTED: uncharacterized protein LOC103949268 isoform X2 [Pyrus 
x bretschneideri]
Length=598

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 9/107 (8%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+++P+RITVPD           RSE      +     + P     +   
Sbjct  1    MPGLVSVKTPPDSSPIRITVPD-------PQPHRSEPAPVSKTPSPHTKKPPSPSPSRSK  53

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                     +  SP    ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  54   PSPARSKKTQPASP--DPILADASLDNPDLGPFLLKLARDTIASGEG  98



>ref|XP_009358645.1| PREDICTED: uncharacterized protein LOC103949268 isoform X1 [Pyrus 
x bretschneideri]
Length=598

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 9/107 (8%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+++P+RITVPD           RSE      +     + P     +   
Sbjct  1    MPGLVSVKTPPDSSPIRITVPD-------PQPHRSEPAPVSKTPSPHTKKPPSPSPSRSK  53

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                     +  SP    ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  54   PSPARSKKTQPASP--DPILADASLDNPDLGPFLLKLARDTIASGEG  98



>ref|XP_011026834.1| PREDICTED: nephrocystin-3-like [Populus euphratica]
Length=596

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 65/114 (57%), Gaps = 22/114 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPD---ESQGQIGANSSRSENVNtkpsspaprrppspspst  461
            MPG+VSVKTPP+A PL ++VP+   ES       S+RSE   T      P   PS S  +
Sbjct  1    MPGLVSVKTPPDAPPLNVSVPEIRPES-------STRSEQPRTPTPKKPPSPSPSRSKPS  53

Query  462  srakpspDRGSGKKKSPPE----KAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                         KK PP+      ++ + SLDNPDLGPFLLKLARDTIASGEG
Sbjct  54   P--------ARSAKKPPPDSPNPNTLLSDPSLDNPDLGPFLLKLARDTIASGEG  99



>ref|NP_974530.1| protein KINESIN LIGHT CHAIN-RELATED 1 [Arabidopsis thaliana]
 gb|AEE82934.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=531

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 70/113 (62%), Gaps = 21/113 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +  PLR+ VPD    Q  +N  R+                +PS + SR+
Sbjct  4    MPGLVSVKTPSDTPPLRVAVPDT---QPLSNPPRT------------PMKKTPSSTPSRS  48

Query  471  kpspDRGSGKKKSPP----EKAVID--ESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSP+R +GKK SP       AVID  + SLDNPDLGPFLLKLARD IASGEG
Sbjct  49   KPSPNRSTGKKDSPTVSSSTAAVIDVDDPSLDNPDLGPFLLKLARDAIASGEG  101



>ref|XP_007210269.1| hypothetical protein PRUPE_ppa003147mg [Prunus persica]
 gb|EMJ11468.1| hypothetical protein PRUPE_ppa003147mg [Prunus persica]
Length=598

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 62/108 (57%), Gaps = 9/108 (8%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPD-ESQGQIGANSSRSENVNtkpsspaprrppspspstsr  467
            MPG+VSVKTPP++ PLRI+VPD + Q Q      RSE      +     + P     +  
Sbjct  1    MPGLVSVKTPPDSAPLRISVPDPQPQPQ------RSEPAPISKTPSPHHKKPPSPSPSRS  54

Query  468  akpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                      +  SP    ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  55   KPSPTRSKKPQPASP--DPILADASLDNPDLGPFLLKLARDTIASGEG  100



>ref|NP_192822.1| protein KINESIN LIGHT CHAIN-RELATED 1 [Arabidopsis thaliana]
 gb|AAC33943.1| contains similarity to TPR domains (Pfam: TPR.hmm: score: 11.15) 
and kinesin motor domains (Pfam: kinesin2.hmm, score: 17.49, 
20.52 and 10.94) [Arabidopsis thaliana]
 emb|CAB40052.1| putative protein [Arabidopsis thaliana]
 emb|CAB81185.1| putative protein [Arabidopsis thaliana]
 gb|AAL59992.1| unknown protein [Arabidopsis thaliana]
 gb|AAL91265.1| AT4g10840/F25I24_50 [Arabidopsis thaliana]
 gb|AAN41387.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82933.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=609

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 70/113 (62%), Gaps = 21/113 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +  PLR+ VPD    Q  +N  R+                +PS + SR+
Sbjct  4    MPGLVSVKTPSDTPPLRVAVPDT---QPLSNPPRT------------PMKKTPSSTPSRS  48

Query  471  kpspDRGSGKKKSPP----EKAVID--ESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSP+R +GKK SP       AVID  + SLDNPDLGPFLLKLARD IASGEG
Sbjct  49   KPSPNRSTGKKDSPTVSSSTAAVIDVDDPSLDNPDLGPFLLKLARDAIASGEG  101



>gb|AAM63491.1| putative kinesin light chain [Arabidopsis thaliana]
Length=606

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 70/113 (62%), Gaps = 21/113 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +  PLR+ VPD    Q  +N  R+                +PS + SR+
Sbjct  1    MPGLVSVKTPSDTPPLRVAVPDT---QPLSNPPRT------------PMKKTPSSTPSRS  45

Query  471  kpspDRGSGKKKSPP----EKAVID--ESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSP+R +GKK SP       AVID  + SLDNPDLGPFLLKLARD IASGEG
Sbjct  46   KPSPNRSTGKKDSPTVSSSTAAVIDVDDPSLDNPDLGPFLLKLARDAIASGEG  98



>ref|XP_002297964.2| hypothetical protein POPTR_0001s10980g [Populus trichocarpa]
 gb|EEE82769.2| hypothetical protein POPTR_0001s10980g [Populus trichocarpa]
Length=597

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 66/113 (58%), Gaps = 19/113 (17%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPD---ESQGQIGANSSRSENVNtkpsspaprrppspspst  461
            MPG+VSVKTPP+A PL I++P+   ES       S+RSE     P+   P  P       
Sbjct  1    MPGLVSVKTPPDAPPLNISLPEIRPES-------STRSEQQPRTPTPKKPPSPSPSRSKP  53

Query  462  srakpspDRGSGKK---KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            S A+      S KK    SP    ++ + SLDNPDLGPFLLKLARDTIASGEG
Sbjct  54   SPAR------SAKKPPPDSPNSNTLLSDPSLDNPDLGPFLLKLARDTIASGEG  100



>ref|XP_008367901.1| PREDICTED: nephrocystin-3-like [Malus domestica]
Length=598

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 64/109 (59%), Gaps = 13/109 (12%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPD-ESQGQIGANSSRSENVNtkpsspaprrppspspstsr  467
            MPG+VSVKTPP++TP RI VPD + Q    A  SR+ +                 PS S 
Sbjct  1    MPGLVSVKTPPDSTPPRIAVPDPQPQQSEPAPVSRTPS-----------PQTKKPPSPSP  49

Query  468  akpspDRGSGKKKSPPE-KAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            ++  P     KK  P     ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  50   SRSKPSPARSKKHQPASPDPILADASLDNPDLGPFLLKLARDTIASGEG  98



>ref|XP_006287252.1| hypothetical protein CARUB_v10000441mg, partial [Capsella rubella]
 gb|EOA20150.1| hypothetical protein CARUB_v10000441mg, partial [Capsella rubella]
Length=640

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 69/115 (60%), Gaps = 23/115 (20%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +A PLR+ VPD    Q  +N  R+                +PS + SR+
Sbjct  33   MPGLVSVKTPADAPPLRVAVPDT---QPLSNPPRT------------PMKKTPSSTPSRS  77

Query  471  kpspDRGSGKKKSPPEKAV--------IDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSP R SGKK SP   +         +D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  78   KPSPGRSSGKKDSPNISSSAAAAAVPDVDDPSLDNPDLGPFLLKLARDAIASGEG  132



>ref|XP_004300493.1| PREDICTED: nephrocystin-3 [Fragaria vesca subsp. vesca]
Length=603

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 3/107 (3%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP++ PL+I+VP+ +  Q    SS +               PS S S SR+
Sbjct  1    MPGLVSVKTPPDSVPLQISVPESASSQ-PQRSSPAGPSKPPSPLARKTPSPSASASASRS  59

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            +PSP+R   K   P  + ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  60   RPSPNRLKSKSLQP--EPILADASLDNPDLGPFLLKLARDTIASGEG  104



>emb|CDY05122.1| BnaC03g29200D [Brassica napus]
Length=607

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 58/113 (51%), Gaps = 23/113 (20%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP  A PLR++VPD  Q Q      +    +T   S                
Sbjct  4    MPGLVSVKTPANAPPLRVSVPDTQQQQPPRTPMKKTPSSTPSRSKPSPGR----------  53

Query  471  kpspDRGSGKKKSPPEKA------VIDESSLDNPDLGPFLLKLARDTIASGEG  611
                   S KK SP   +      V+D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  54   -------SAKKDSPGVSSAAAAVPVVDDPSLDNPDLGPFLLKLARDAIASGEG  99



>gb|KJB09631.1| hypothetical protein B456_001G153600 [Gossypium raimondii]
Length=569

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 53/106 (50%), Gaps = 25/106 (24%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+ SVKTP  ATPLR+ +     G  G     S + +                     
Sbjct  1    MPGLFSVKTPSNATPLRVLIAATENGAGGTRRPPSPSPSVSR------------------  42

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
                   +   K  P+K+ IDESSL+NPDLGPFLLKLARDTIA G+
Sbjct  43   -------TKPTKKTPDKSGIDESSLENPDLGPFLLKLARDTIAFGD  81



>ref|XP_004148984.1| PREDICTED: kinesin light chain [Cucumis sativus]
 gb|KGN53436.1| hypothetical protein Csa_4G055310 [Cucumis sativus]
Length=593

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 63/111 (57%), Gaps = 20/111 (18%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A PLRI+VP+       A++ R  +            P +    +   
Sbjct  1    MPGLVSVKTPPDAPPLRISVPETPP----ASNHRPPS------------PLTKKQPSPSP  44

Query  471  kpspDRGSGKKKSPPEKAVIDE----SSLDNPDLGPFLLKLARDTIASGEG  611
              S    +GKKK  PE     +    SSLDNPDLGPFLLKLARDTIASG+G
Sbjct  45   SRSKPSPNGKKKLQPESPTSAQFPPDSSLDNPDLGPFLLKLARDTIASGDG  95



>gb|KDO86517.1| hypothetical protein CISIN_1g007930mg [Citrus sinensis]
Length=584

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 58/106 (55%), Gaps = 20/106 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MP ++SVKTPP  TPL I +P    G    N+ RS +                     + 
Sbjct  1    MPSLISVKTPPNTTPLNILIPAIQNG--STNNLRSPS------------------PLRKR  40

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
             PSP   + + K   EK  IDESSLDNPDLGPFLLKLAR+TI+SG+
Sbjct  41   FPSPSPSNSRAKRTSEKVTIDESSLDNPDLGPFLLKLARETISSGD  86



>ref|XP_006491305.1| PREDICTED: nephrocystin-3-like [Citrus sinensis]
Length=584

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 58/106 (55%), Gaps = 20/106 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MP ++SVKTPP  TPL I +P    G    N+ RS +                     + 
Sbjct  1    MPSLISVKTPPNTTPLNILIPAIQNG--STNNLRSPS------------------PLRKR  40

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
             PSP   + + K   EK  IDESSLDNPDLGPFLLKLAR+TI+SG+
Sbjct  41   FPSPSPSNSRAKRTSEKVTIDESSLDNPDLGPFLLKLARETISSGD  86



>ref|XP_006444813.1| hypothetical protein CICLE_v10019438mg [Citrus clementina]
 gb|ESR58053.1| hypothetical protein CICLE_v10019438mg [Citrus clementina]
Length=584

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 58/106 (55%), Gaps = 20/106 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MP ++SVKTPP  TPL I +P    G    N+ RS +                     + 
Sbjct  1    MPSLISVKTPPNTTPLNILIPAIQNG--STNNLRSPS------------------PLRKR  40

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
             PSP   + + K   EK  IDESSLDNPDLGPFLLKLAR+TI+SG+
Sbjct  41   FPSPSPSNSRAKRTSEKVTIDESSLDNPDLGPFLLKLARETISSGD  86



>ref|XP_010455474.1| PREDICTED: kinesin light chain-like isoform X1 [Camelina sativa]
 ref|XP_010455475.1| PREDICTED: kinesin light chain-like isoform X2 [Camelina sativa]
Length=610

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 70/114 (61%), Gaps = 22/114 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +A PLR++VPD    Q  +N  R+                +PS ++SR+
Sbjct  4    MPGLVSVKTPADAPPLRVSVPDT---QPLSNPPRT------------PMKKTPSSTSSRS  48

Query  471  kpspDRGSGKKKSP-------PEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSP R SGKK SP            +D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  49   KPSPGRSSGKKDSPNLSSSAAAAVVDVDDPSLDNPDLGPFLLKLARDAIASGEG  102



>ref|XP_011022457.1| PREDICTED: uncharacterized protein LOC105124230 [Populus euphratica]
Length=599

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 5/107 (5%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A PL I+VP+   G    +S+R E     P +P P++PPSPSPS S+ 
Sbjct  1    MPGLVSVKTPPDAPPLHISVPEILPG----SSTRPEQ-QQPPRTPTPKKPPSPSPSRSKP  55

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
             P+         SP   +++ + SLDNPDLGPFLLKLARDTIASGEG
Sbjct  56   SPARSTKKPPPDSPNPNSLLSDPSLDNPDLGPFLLKLARDTIASGEG  102



>gb|KFK31862.1| hypothetical protein AALP_AA6G167900 [Arabis alpina]
Length=610

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 60/111 (54%), Gaps = 16/111 (14%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +A  LR+ VPD           RSE  N   +        +PS S    
Sbjct  4    MPGLVSVKTPADAPSLRVAVPD-------TQPPRSELTNPPRTPLKKTPSSTPSRSKPSP  56

Query  471  kpspDRGSGKKKSPPEKAV----IDESSLDNPDLGPFLLKLARDTIASGEG  611
                   SGKK SP   +     +D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  57   GR-----SGKKDSPGVSSAXVIDVDDPSLDNPDLGPFLLKLARDAIASGEG  102



>ref|XP_002304567.2| hypothetical protein POPTR_0003s14320g [Populus trichocarpa]
 gb|EEE79546.2| hypothetical protein POPTR_0003s14320g [Populus trichocarpa]
Length=599

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 5/107 (5%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A PL I+VP+   G    +S+R E     P +P P++PPSPSPS S+ 
Sbjct  1    MPGLVSVKTPPDAPPLHISVPEILPG----SSTRPEQ-QPPPRTPTPKKPPSPSPSRSKP  55

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
             P+         SP   +++ + SLDNPDLGPFLLKLARDTIASGEG
Sbjct  56   SPARSTKKPPPDSPNPNSLLSDPSLDNPDLGPFLLKLARDTIASGEG  102



>ref|XP_010422007.1| PREDICTED: uncharacterized protein LOC104707372 [Camelina sativa]
Length=610

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 68/114 (60%), Gaps = 22/114 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +A PLR++VPD    Q  +N  R+                +PS + SR+
Sbjct  4    MPGLVSVKTPADAPPLRVSVPDT---QPLSNPPRT------------PMKKTPSSTPSRS  48

Query  471  kpspDRGSGKKKSPPEKAVIDES-------SLDNPDLGPFLLKLARDTIASGEG  611
            KPSP R SGKK SP   +    +       SLDNPDLGPFLLKLARD IASGEG
Sbjct  49   KPSPGRSSGKKDSPSLSSSAAAAVVDVDDPSLDNPDLGPFLLKLARDAIASGEG  102



>ref|XP_010436694.1| PREDICTED: uncharacterized protein LOC104720497 [Camelina sativa]
Length=610

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 69/114 (61%), Gaps = 22/114 (19%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +A PLR++VPD    Q  +N  R+                +PS + SR+
Sbjct  4    MPGLVSVKTPADAPPLRVSVPDT---QPLSNPPRT------------PMKKTPSSTPSRS  48

Query  471  kpspDRGSGKKKSP-------PEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            KPSP R SGKK SP            +D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  49   KPSPGRSSGKKDSPNLSSSAAAAVVDVDDPSLDNPDLGPFLLKLARDAIASGEG  102



>emb|CDX90788.1| BnaA03g24680D [Brassica napus]
Length=606

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 61/113 (54%), Gaps = 24/113 (21%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP  A PLR++VPD  Q        ++ +     S P+P R           
Sbjct  4    MPGLVSVKTPANAPPLRVSVPDTQQQPPRTPMKKTPSSTPSRSKPSPGR-----------  52

Query  471  kpspDRGSGKKKSP----PEKAV--IDESSLDNPDLGPFLLKLARDTIASGEG  611
                   S KK SP       AV  +D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  53   -------SAKKDSPGVSSSAAAVPDVDDPSLDNPDLGPFLLKLARDAIASGEG  98



>ref|XP_008795853.1| PREDICTED: kinesin light chain 4-like [Phoenix dactylifera]
Length=598

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 61/111 (55%), Gaps = 13/111 (12%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+V+   PP+  PLRI VP++   QI     R   V +          PS S     +
Sbjct  1    MPGLVA---PPDTPPLRIAVPNDGDSQI----RRPGEVRSPMPKKFSTPSPSLSSRARPS  53

Query  471  kpspDR----GSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                 R     S +K+ PP  A  DE++LDNPDLGPFLLKLARDTIASGEG
Sbjct  54   PDRKKRTPGSSSAEKQRPPTAA--DEAALDNPDLGPFLLKLARDTIASGEG  102



>ref|XP_010676242.1| PREDICTED: kinesin light chain [Beta vulgaris subsp. vulgaris]
Length=602

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +3

Query  483  DRGSGKKK----SPPEKA--VIDESSLDNPDLGPFLLKLARDTIASGEG  611
            DR SGKKK    S P K    +DESSLDNPDLGPFLLKLARDTIASG+G
Sbjct  56   DRSSGKKKPSPSSDPTKLGLNLDESSLDNPDLGPFLLKLARDTIASGDG  104



>ref|XP_002872538.1| hypothetical protein ARALYDRAFT_489926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48797.1| hypothetical protein ARALYDRAFT_489926 [Arabidopsis lyrata subsp. 
lyrata]
Length=608

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 66/115 (57%), Gaps = 23/115 (20%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP +  PLR+ VPD    Q  +N  R+                +PS + SR+
Sbjct  1    MPGLVSVKTPADTPPLRVAVPDT---QPLSNPPRT------------PMKKTPSSTPSRS  45

Query  471  kpspDRGSGKKKSPPEKAVIDES--------SLDNPDLGPFLLKLARDTIASGEG  611
            KPSP R SGKK SP   +    +        SLDNPDLGPFLLKLARD IASGEG
Sbjct  46   KPSPGRSSGKKDSPTVSSSAAAAAVIDVDDPSLDNPDLGPFLLKLARDAIASGEG  100



>ref|XP_010324680.1| PREDICTED: kinesin light chain 4-like [Solanum lycopersicum]
Length=476

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPPE   LRI+V DE+ G+  + SSRSE VN  P + +P     PSPSTSRA
Sbjct  1    MPGLVSVKTPPETPALRISVSDENHGRNASGSSRSEQVN--PKTNSPAPRRPPSPSTSRA  58

Query  471  kpspDRGSGKKKSPPEK  521
            KPSPDRGSGKKKSPPEK
Sbjct  59   KPSPDRGSGKKKSPPEK  75



>gb|KDO76619.1| hypothetical protein CISIN_1g011858mg [Citrus sinensis]
Length=476

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 60/107 (56%), Gaps = 16/107 (15%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A P RITVP+           R +  +  PSS +   P          
Sbjct  1    MPGLVSVKTPPDAPPPRITVPEPRPEPPTTPVPRPKPPSPSPSSRSKATPSPTQ------  54

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                   S  KK PP+     ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  55   -------SRNKKPPPD---FTDASLDNPDLGPFLLKLARDTIASGEG  91



>ref|XP_009134209.1| PREDICTED: nephrocystin-3 [Brassica rapa]
Length=608

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 60/112 (54%), Gaps = 20/112 (18%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTP  A PLR++VPD  Q Q     +  +   +   S +   P          
Sbjct  4    MPGLVSVKTPANAPPLRVSVPDTQQQQQQPPRTPMKKTPSSTPSRSKPSPGR--------  55

Query  471  kpspDRGSGKKKSP---PEKAV--IDESSLDNPDLGPFLLKLARDTIASGEG  611
                   S KK SP      AV  +D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  56   -------SAKKDSPGVSSAAAVPDVDDPSLDNPDLGPFLLKLARDAIASGEG  100



>ref|XP_006476340.1| PREDICTED: nephrocystin-3-like [Citrus sinensis]
Length=590

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 60/107 (56%), Gaps = 16/107 (15%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A P RITVP+           R +  +  PSS +   P          
Sbjct  1    MPGLVSVKTPPDAPPPRITVPEPRPEPPTTPVPRPKPPSPSPSSRSKATPSPTQ------  54

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                   S  KK PP+     ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  55   -------SRNKKPPPD---FTDASLDNPDLGPFLLKLARDTIASGEG  91



>ref|XP_006439287.1| hypothetical protein CICLE_v10019420mg [Citrus clementina]
 gb|ESR52527.1| hypothetical protein CICLE_v10019420mg [Citrus clementina]
Length=590

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 60/107 (56%), Gaps = 16/107 (15%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+VSVKTPP+A P RITVP+           R +  +  PSS +   P          
Sbjct  1    MPGLVSVKTPPDAPPPRITVPEPRPEPPTTPVPRPKPPSPSPSSRSKATPSPTQ------  54

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                   S  KK PP+     ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  55   -------SRNKKPPPD---FTDASLDNPDLGPFLLKLARDTIASGEG  91



>ref|XP_009344036.1| PREDICTED: kinesin light chain-like [Pyrus x bretschneideri]
 ref|XP_009347911.1| PREDICTED: kinesin light chain-like [Pyrus x bretschneideri]
Length=597

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 63/109 (58%), Gaps = 13/109 (12%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPD-ESQGQIGANSSRSENVNtkpsspaprrppspspstsr  467
            MPG+VSVKTPP++   RI VP+ + Q    A  SR+ + +TK         P PSP    
Sbjct  1    MPGLVSVKTPPDSASPRIAVPEPQPQQSEPAPVSRTPSPHTKKPPSPSPSRPKPSP----  56

Query  468  akpspDRGSGKKKSPPE-KAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                      KK  P     ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  57   -------ARSKKPQPASPDTILADASLDNPDLGPFLLKLARDTIASGEG  98



>ref|XP_009334359.1| PREDICTED: nephrocystin-3-like isoform X2 [Pyrus x bretschneideri]
Length=503

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PEK  IDE+SLDNPDLGPFLLKLARDTI SGE
Sbjct  49   KRAPEKLPIDETSLDNPDLGPFLLKLARDTIGSGE  83



>ref|XP_012083176.1| PREDICTED: nephrocystin-3-like isoform X3 [Jatropha curcas]
Length=523

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PEK  +DESS DNPDLGPFLLKLARDTI+SG+
Sbjct  48   KKTPEKLTVDESSFDNPDLGPFLLKLARDTISSGD  82



>ref|XP_009334358.1| PREDICTED: nephrocystin-3-like isoform X1 [Pyrus x bretschneideri]
Length=579

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PEK  IDE+SLDNPDLGPFLLKLARDTI SGE
Sbjct  49   KRAPEKLPIDETSLDNPDLGPFLLKLARDTIGSGE  83



>ref|XP_012083173.1| PREDICTED: nephrocystin-3-like isoform X1 [Jatropha curcas]
 ref|XP_012083174.1| PREDICTED: nephrocystin-3-like isoform X1 [Jatropha curcas]
Length=599

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PEK  +DESS DNPDLGPFLLKLARDTI+SG+
Sbjct  48   KKTPEKLTVDESSFDNPDLGPFLLKLARDTISSGD  82



>ref|XP_012083175.1| PREDICTED: nephrocystin-3-like isoform X2 [Jatropha curcas]
 ref|XP_012083178.1| PREDICTED: nephrocystin-3-like isoform X4 [Jatropha curcas]
 gb|KDP28468.1| hypothetical protein JCGZ_14239 [Jatropha curcas]
Length=578

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PEK  +DESS DNPDLGPFLLKLARDTI+SG+
Sbjct  48   KKTPEKLTVDESSFDNPDLGPFLLKLARDTISSGD  82



>ref|XP_008376154.1| PREDICTED: nephrocystin-3-like [Malus domestica]
Length=579

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 53/107 (50%), Gaps = 25/107 (23%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLR-ITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsr  467
            MPG+VS K  P   P   I VPD +     +N +++ ++ T                   
Sbjct  1    MPGLVSPKNSPLGAPSPPIFVPDPTHRTEHSNGTKTPSLTTT------------------  42

Query  468  akpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
                  R     K   EK +IDE+SLDNPDLGPFLLKLARDTI SGE
Sbjct  43   ------RTRAAIKGALEKLLIDETSLDNPDLGPFLLKLARDTIGSGE  83



>ref|XP_009421472.1| PREDICTED: uncharacterized protein LOC104001021 [Musa acuminata 
subsp. malaccensis]
Length=620

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 63/126 (50%), Gaps = 22/126 (17%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+V+   PPEA PLR+ VPD+   QI   +   +       +    +        S  
Sbjct  1    MPGLVA---PPEAPPLRVDVPDDGASQIRRTADDPDPPREPRVASPGPKKTPSPTPGSSR  57

Query  471  kpspDRGS---GKKKSPPEK----------------AVIDESSLDNPDLGPFLLKLARDT  593
              S +RGS   GK++   E+                AV+DE++LDNPDLGPFLLKLAR  
Sbjct  58   VRSAERGSSSAGKRRLSLERPGSAASAAGSALRDLPAVMDETALDNPDLGPFLLKLARGA  117

Query  594  IASGEG  611
            I SGEG
Sbjct  118  IVSGEG  123



>ref|XP_004308296.1| PREDICTED: nephrocystin-3-like [Fragaria vesca subsp. vesca]
Length=566

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +3

Query  495  GKKKSPPEKA-VIDESSLDNPDLGPFLLKLARDTIASGE  608
            GKK +PPEK  +IDE++LDNPDLGPFLLKLAR+ + SGE
Sbjct  31   GKKTAPPEKQPMIDEANLDNPDLGPFLLKLAREAVGSGE  69



>gb|KEH18621.1| kinesin light chain [Medicago truncatula]
Length=572

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  501  KKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            +K+  +  +IDESSL+NPDLGPFLLK+ARDTIASGE
Sbjct  41   RKTIKKTIIIDESSLENPDLGPFLLKMARDTIASGE  76



>ref|XP_010924445.1| PREDICTED: LOW QUALITY PROTEIN: kinesin light chain 4-like [Elaeis 
guineensis]
Length=598

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 60/111 (54%), Gaps = 13/111 (12%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MPG+V+    P   PLRITVP++   QI     R  +V +          PSPS     +
Sbjct  1    MPGLVA---RPNGPPLRITVPNDGDTQI----RRPGDVRSPIPKKFSTPSPSPSFRARPS  53

Query  471  kpspDR----GSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
                 R     S  K+ PP     DE++LDNPDLGPFLLKLARDTIASGEG
Sbjct  54   PDRKKRTPGSSSAGKQRPP--TATDEAALDNPDLGPFLLKLARDTIASGEG  102



>ref|XP_009375418.1| PREDICTED: nephrocystin-3-like [Pyrus x bretschneideri]
Length=579

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  501  KKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            KK   EK  IDE+SLDNPDLGPFLLKLARDTI SGE
Sbjct  48   KKPASEKLPIDETSLDNPDLGPFLLKLARDTIGSGE  83



>gb|KEH21270.1| kinesin light chain [Medicago truncatula]
Length=588

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            ++P   +++ E+SLDNPDLGPFLLK+ARDTIASG+G
Sbjct  55   ETPTTNSLLSEASLDNPDLGPFLLKVARDTIASGDG  90



>ref|XP_004503588.1| PREDICTED: nephrocystin-3-like [Cicer arietinum]
Length=590

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  513  PEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            P    + ESSLDNPDLGPFLLK+ARDTIASG+G
Sbjct  60   PTNTFLSESSLDNPDLGPFLLKVARDTIASGDG  92



>ref|XP_008239183.1| PREDICTED: nephrocystin-3, partial [Prunus mume]
Length=557

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  525  VIDESSLDNPDLGPFLLKLARDTIASGEG  611
            ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  31   ILADASLDNPDLGPFLLKLARDTIASGEG  59



>ref|XP_003548412.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=554

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +3

Query  525  VIDESSLDNPDLGPFLLKLARDTIASGE  608
            +++ESSLDNPDLGPFLLK+AR+TIASGE
Sbjct  30   IVEESSLDNPDLGPFLLKMARETIASGE  57



>ref|XP_008337561.1| PREDICTED: nephrocystin-3-like [Malus domestica]
Length=598

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  525  VIDESSLDNPDLGPFLLKLARDTIASGEG  611
            ++ ++SLDNPDLGPFLLKLARDTIASGEG
Sbjct  70   ILADASLDNPDLGPFLLKLARDTIASGEG  98



>ref|XP_007220647.1| hypothetical protein PRUPE_ppa003486mg [Prunus persica]
 gb|EMJ21846.1| hypothetical protein PRUPE_ppa003486mg [Prunus persica]
Length=571

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 4/41 (10%)
 Frame = +3

Query  486  RGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            R    +K+ P    +DE+SLDNPDLGPFLLKLARDT  SGE
Sbjct  38   RTKASRKTQP----VDETSLDNPDLGPFLLKLARDTFGSGE  74



>ref|XP_007135270.1| hypothetical protein PHAVU_010G115100g [Phaseolus vulgaris]
 gb|ESW07264.1| hypothetical protein PHAVU_010G115100g [Phaseolus vulgaris]
Length=561

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 6/43 (14%)
 Frame = +3

Query  498  KKKSPP------EKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            ++++PP      +  V+++SSLDNPDLGPFLLK+AR+TIASGE
Sbjct  22   ERRTPPLNRTVKKTLVVEDSSLDNPDLGPFLLKMARETIASGE  64



>ref|XP_002302642.2| hypothetical protein POPTR_0002s17420g, partial [Populus trichocarpa]
 gb|EEE81915.2| hypothetical protein POPTR_0002s17420g, partial [Populus trichocarpa]
Length=216

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  528  IDESSLDNPDLGPFLLKLARDTIASGE  608
            IDESSLDNPDLGPFLLKLA DTIASG+
Sbjct  74   IDESSLDNPDLGPFLLKLAIDTIASGD  100



>ref|XP_008233119.1| PREDICTED: nephrocystin-3-like [Prunus mume]
Length=571

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  528  IDESSLDNPDLGPFLLKLARDTIASGE  608
            +DE+SLDNPDLGPFLLKLARDT  SGE
Sbjct  48   VDETSLDNPDLGPFLLKLARDTFGSGE  74



>ref|XP_003530449.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=578

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 3/36 (8%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            ++PP   ++ ++SLDNPDLGPFLLKLARDTIASG+G
Sbjct  48   ETPP---LLSDASLDNPDLGPFLLKLARDTIASGDG  80



>gb|KHN16719.1| Nephrocystin-3 [Glycine soja]
Length=523

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 3/36 (8%)
 Frame = +3

Query  504  KSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            ++PP   ++ ++SLDNPDLGPFLLKLARDTIASG+G
Sbjct  48   ETPP---LLSDASLDNPDLGPFLLKLARDTIASGDG  80



>ref|XP_003525334.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=563

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  525  VIDESSLDNPDLGPFLLKLARDTIASGEG  611
            ++ ++SLDNPDLGPFLLKLARDTIASG+G
Sbjct  37   LLSDASLDNPDLGPFLLKLARDTIASGDG  65



>ref|XP_010541795.1| PREDICTED: kinesin light chain-like [Tarenaya hassleriana]
Length=613

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  528  IDESSLDNPDLGPFLLKLARDTIASGEG  611
            +D+ SLDNPDLGPFLLKLARD IASGEG
Sbjct  77   MDDPSLDNPDLGPFLLKLARDAIASGEG  104



>gb|KCW77343.1| hypothetical protein EUGRSUZ_D01704 [Eucalyptus grandis]
Length=571

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  534  ESSLDNPDLGPFLLKLARDTIASGEG  611
            ++SLDNPDLGPFLLKLARDTIASG+G
Sbjct  87   DASLDNPDLGPFLLKLARDTIASGDG  112



>gb|KJB37462.1| hypothetical protein B456_006G206300 [Gossypium raimondii]
Length=507

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  543  LDNPDLGPFLLKLARDTIASGEG  611
            LDNPDLGPFLLKLARDTIASGEG
Sbjct  64   LDNPDLGPFLLKLARDTIASGEG  86



>ref|XP_010053096.1| PREDICTED: kinesin light chain 4 [Eucalyptus grandis]
 gb|KCW77342.1| hypothetical protein EUGRSUZ_D01704 [Eucalyptus grandis]
Length=610

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  534  ESSLDNPDLGPFLLKLARDTIASGEG  611
            ++SLDNPDLGPFLLKLARDTIASG+G
Sbjct  87   DASLDNPDLGPFLLKLARDTIASGDG  112



>gb|KHG14140.1| Nephrocystin-3 [Gossypium arboreum]
Length=582

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  543  LDNPDLGPFLLKLARDTIASGEG  611
            LDNPDLGPFLLKLARDTIASGEG
Sbjct  64   LDNPDLGPFLLKLARDTIASGEG  86



>gb|KJB37463.1| hypothetical protein B456_006G206300 [Gossypium raimondii]
Length=582

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  543  LDNPDLGPFLLKLARDTIASGEG  611
            LDNPDLGPFLLKLARDTIASGEG
Sbjct  64   LDNPDLGPFLLKLARDTIASGEG  86



>ref|XP_011038461.1| PREDICTED: nephrocystin-3-like isoform X3 [Populus euphratica]
Length=538

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = +3

Query  501  KKSPPEKAV----IDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PP K +      ESSLDNPDLGPFLLKLA DT+ASG+
Sbjct  51   KIKPPNKTLQELRTHESSLDNPDLGPFLLKLAIDTVASGD  90



>ref|XP_002523319.1| kinesin light chain, putative [Ricinus communis]
 gb|EEF39035.1| kinesin light chain, putative [Ricinus communis]
Length=382

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 27/106 (25%)
 Frame = +3

Query  291  MPGIVSVKTPPEATPLRITVPDESQGQIGANSSRSENVNtkpsspaprrppspspstsra  470
            MP +VSVKTP + TPL  ++P ++  QI  N  ++ +                       
Sbjct  1    MPALVSVKTPSKTTPLHSSLP-QNDDQIYKNDIKTPS---------------------PL  38

Query  471  kpspDRGSGKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
                   S  KK+P  K  +DE    NPDLGPF LKLARDTIASG+
Sbjct  39   LKRTPSPSSSKKTP-NKLPVDE----NPDLGPFFLKLARDTIASGD  79



>ref|XP_011038453.1| PREDICTED: nephrocystin-3-like isoform X2 [Populus euphratica]
Length=564

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = +3

Query  501  KKSPPEKAV----IDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PP K +      ESSLDNPDLGPFLLKLA DT+ASG+
Sbjct  51   KIKPPNKTLQELRTHESSLDNPDLGPFLLKLAIDTVASGD  90



>ref|XP_002320874.1| hypothetical protein POPTR_0014s09590g [Populus trichocarpa]
 gb|EEE99189.1| hypothetical protein POPTR_0014s09590g [Populus trichocarpa]
Length=568

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = +3

Query  501  KKSPPEKAV----IDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PP K +      ESSLDNPDLGPFLLKLA DT+ASG+
Sbjct  51   KIKPPNKTLQELRTHESSLDNPDLGPFLLKLAIDTVASGD  90



>ref|XP_011038446.1| PREDICTED: kinesin light chain 4-like isoform X1 [Populus euphratica]
Length=568

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 4/40 (10%)
 Frame = +3

Query  501  KKSPPEKAV----IDESSLDNPDLGPFLLKLARDTIASGE  608
            K  PP K +      ESSLDNPDLGPFLLKLA DT+ASG+
Sbjct  51   KIKPPNKTLQELRTHESSLDNPDLGPFLLKLAIDTVASGD  90



>ref|XP_003571751.1| PREDICTED: nephrocystin-3 [Brachypodium distachyon]
Length=618

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 3/39 (8%)
 Frame = +3

Query  495  GKKKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGEG  611
            G++++ PE    DE++LDNPDLGPFLLK ARD + SGEG
Sbjct  53   GQQQAGPET---DEAALDNPDLGPFLLKQARDAMVSGEG  88



>ref|NP_001045645.1| Os02g0109800 [Oryza sativa Japonica Group]
 dbj|BAD07830.1| kinesin light chain-like protein [Oryza sativa Japonica Group]
 dbj|BAD27945.1| kinesin light chain-like protein [Oryza sativa Japonica Group]
 dbj|BAF07559.1| Os02g0109800 [Oryza sativa Japonica Group]
 dbj|BAG91212.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72331.1| hypothetical protein OsI_05534 [Oryza sativa Indica Group]
Length=599

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  531  DESSLDNPDLGPFLLKLARDTIASGEG  611
            DE++LDNPDLGPFLLK ARD + SGEG
Sbjct  54   DEAALDNPDLGPFLLKQARDAMVSGEG  80



>dbj|BAK04667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=609

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  531  DESSLDNPDLGPFLLKLARDTIASGEG  611
            DE++LDNPDLGPFLLK ARD + SGEG
Sbjct  60   DEAALDNPDLGPFLLKQARDAMVSGEG  86



>gb|EYU17664.1| hypothetical protein MIMGU_mgv1a002285mg [Erythranthe guttata]
Length=691

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  501  KKSPPEKAVIDESSLDNPDLGPFLLKLARDTIASGE  608
            KK+P    V  ES LDNPDLGPFLLK ARD ++SG+
Sbjct  162  KKTPTRGVVQSESGLDNPDLGPFLLKQARDLMSSGD  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 861523889999