BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1208

Length=806
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614718.1|  PREDICTED: uncharacterized protein At1g51745...    166   4e-43   Nicotiana tomentosiformis
ref|XP_009614713.1|  PREDICTED: uncharacterized protein At1g51745...    166   4e-43   Nicotiana tomentosiformis
ref|XP_009782512.1|  PREDICTED: uncharacterized protein At1g51745       165   7e-43   Nicotiana sylvestris
ref|XP_004236393.1|  PREDICTED: uncharacterized protein At1g51745...    155   3e-39   Solanum lycopersicum
ref|XP_006343014.1|  PREDICTED: uncharacterized protein At1g51745...    149   3e-37   Solanum tuberosum [potatoes]
emb|CDO97945.1|  unnamed protein product                                133   2e-31   Coffea canephora [robusta coffee]
ref|XP_011072468.1|  PREDICTED: uncharacterized protein At1g51745       118   4e-26   Sesamum indicum [beniseed]
ref|XP_010690078.1|  PREDICTED: uncharacterized protein At1g51745       105   6e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011080298.1|  PREDICTED: uncharacterized protein At1g51745       105   1e-21   Sesamum indicum [beniseed]
ref|XP_002304109.2|  hypothetical protein POPTR_0003s03970g           91.3    5e-17   
ref|XP_007135591.1|  hypothetical protein PHAVU_010G142200g           90.9    7e-17   Phaseolus vulgaris [French bean]
ref|XP_010062582.1|  PREDICTED: uncharacterized protein At1g51745     90.5    7e-17   Eucalyptus grandis [rose gum]
ref|XP_002515884.1|  conserved hypothetical protein                   90.1    1e-16   
gb|EYU45844.1|  hypothetical protein MIMGU_mgv1a004135mg              88.6    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_010088115.1|  hypothetical protein L484_001821                 89.0    3e-16   Morus notabilis
gb|KJB70319.1|  hypothetical protein B456_011G067800                  88.2    4e-16   Gossypium raimondii
gb|KHG23152.1|  hypothetical protein F383_01193                       88.2    4e-16   Gossypium arboreum [tree cotton]
gb|KJB70320.1|  hypothetical protein B456_011G067800                  88.2    5e-16   Gossypium raimondii
gb|KEH18280.1|  tudor/PWWP/MBT superfamily protein                    87.8    6e-16   Medicago truncatula
ref|XP_008228331.1|  PREDICTED: uncharacterized protein At1g51745...  87.8    7e-16   Prunus mume [ume]
ref|XP_008228332.1|  PREDICTED: uncharacterized protein At1g51745...  87.4    7e-16   Prunus mume [ume]
ref|XP_008462373.1|  PREDICTED: uncharacterized protein At1g51745...  87.0    1e-15   Cucumis melo [Oriental melon]
ref|XP_007217004.1|  hypothetical protein PRUPE_ppa002212mg           86.7    1e-15   
ref|XP_010654562.1|  PREDICTED: uncharacterized protein At1g51745...  87.0    1e-15   Vitis vinifera
ref|XP_012069023.1|  PREDICTED: uncharacterized protein At1g51745...  87.0    1e-15   
ref|XP_006426470.1|  hypothetical protein CICLE_v10027499mg           86.7    1e-15   Citrus clementina [clementine]
emb|CAN84040.1|  hypothetical protein VITISV_024170                   86.7    1e-15   Vitis vinifera
gb|KDO58660.1|  hypothetical protein CISIN_1g004313mg                 85.9    2e-15   Citrus sinensis [apfelsine]
ref|XP_006466092.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    2e-15   Citrus sinensis [apfelsine]
gb|KDO58662.1|  hypothetical protein CISIN_1g004313mg                 85.9    2e-15   Citrus sinensis [apfelsine]
gb|KDO58661.1|  hypothetical protein CISIN_1g004313mg                 85.9    2e-15   Citrus sinensis [apfelsine]
ref|XP_006466094.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    2e-15   Citrus sinensis [apfelsine]
ref|XP_006466093.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    2e-15   Citrus sinensis [apfelsine]
ref|XP_008380820.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    3e-15   
ref|XP_008380818.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    3e-15   
ref|XP_009367515.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_006466095.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    3e-15   Citrus sinensis [apfelsine]
ref|XP_009367513.1|  PREDICTED: uncharacterized protein At1g51745...  85.9    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_011659648.1|  PREDICTED: uncharacterized protein At1g51745     85.5    3e-15   Cucumis sativus [cucumbers]
gb|KHN39281.1|  Hypothetical protein glysoja_018053                   84.3    9e-15   Glycine soja [wild soybean]
ref|XP_003529739.1|  PREDICTED: uncharacterized protein At1g51745...  84.3    9e-15   Glycine max [soybeans]
ref|XP_004510340.1|  PREDICTED: uncharacterized protein At1g51745...  83.6    1e-14   
ref|XP_011652363.1|  PREDICTED: uncharacterized protein At1g51745     83.6    2e-14   Cucumis sativus [cucumbers]
gb|EYU21406.1|  hypothetical protein MIMGU_mgv1a002564mg              82.8    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_007024422.1|  Tudor/PWWP/MBT superfamily protein, putative...  81.3    8e-14   
ref|XP_011013034.1|  PREDICTED: uncharacterized protein At1g51745...  80.9    1e-13   Populus euphratica
ref|XP_011013035.1|  PREDICTED: uncharacterized protein At1g51745...  80.9    1e-13   Populus euphratica
gb|KHN11311.1|  Hypothetical protein glysoja_023375                   80.5    1e-13   Glycine soja [wild soybean]
ref|XP_008809885.1|  PREDICTED: uncharacterized protein At1g51745...  79.7    2e-13   
ref|XP_010924938.1|  PREDICTED: uncharacterized protein At1g51745...  78.2    7e-13   Elaeis guineensis
ref|XP_011463342.1|  PREDICTED: uncharacterized protein At1g51745...  77.4    1e-12   Fragaria vesca subsp. vesca
ref|XP_004297615.1|  PREDICTED: uncharacterized protein At1g51745...  77.4    1e-12   Fragaria vesca subsp. vesca
ref|XP_010267045.1|  PREDICTED: uncharacterized protein At1g51745...  76.3    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006369225.1|  hypothetical protein POPTR_0001s19480g           75.9    4e-12   
ref|XP_006369226.1|  hypothetical protein POPTR_0001s19480g           75.5    5e-12   
ref|XP_008447587.1|  PREDICTED: uncharacterized protein At1g51745...  74.7    1e-11   Cucumis melo [Oriental melon]
ref|XP_011015418.1|  PREDICTED: uncharacterized protein At1g51745...  74.7    1e-11   Populus euphratica
ref|XP_011011986.1|  PREDICTED: uncharacterized protein At1g51745...  74.3    1e-11   Populus euphratica
ref|XP_010911968.1|  PREDICTED: uncharacterized protein At1g51745...  74.3    1e-11   Elaeis guineensis
gb|KJB56861.1|  hypothetical protein B456_009G139300                  73.2    3e-11   Gossypium raimondii
gb|KJB56863.1|  hypothetical protein B456_009G139300                  72.8    4e-11   Gossypium raimondii
ref|XP_010545639.1|  PREDICTED: uncharacterized protein At1g51745...  72.8    4e-11   Tarenaya hassleriana [spider flower]
gb|KHG19697.1|  hypothetical protein F383_24275                       71.6    1e-10   Gossypium arboreum [tree cotton]
ref|XP_008797875.1|  PREDICTED: uncharacterized protein At1g51745...  71.2    1e-10   Phoenix dactylifera
ref|XP_009410801.1|  PREDICTED: uncharacterized protein At1g51745...  70.5    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007043473.1|  Tudor/PWWP/MBT superfamily protein               67.4    8e-10   
ref|XP_010500760.1|  PREDICTED: uncharacterized protein At1g51745...  67.8    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010500759.1|  PREDICTED: uncharacterized protein At1g51745...  67.8    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006304889.1|  hypothetical protein CARUB_v10012660mg           67.4    2e-09   Capsella rubella
ref|XP_006392999.1|  hypothetical protein EUTSA_v10011307mg           67.0    3e-09   Eutrema salsugineum [saltwater cress]
emb|CBI35984.3|  unnamed protein product                              64.7    5e-09   Vitis vinifera
ref|NP_001043335.1|  Os01g0558500                                     65.5    1e-08   
gb|EEE54805.1|  hypothetical protein OsJ_02221                        65.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646000.1|  PREDICTED: uncharacterized protein At1g51745...  65.5    1e-08   Oryza brachyantha
ref|XP_006406288.1|  hypothetical protein EUTSA_v10020246mg           64.7    2e-08   Eutrema salsugineum [saltwater cress]
emb|CDY33863.1|  BnaC06g04900D                                        64.3    3e-08   Brassica napus [oilseed rape]
gb|AFW83010.1|  hypothetical protein ZEAMMB73_581703                  63.9    4e-08   
ref|XP_008657775.1|  PREDICTED: uncharacterized protein At1g51745...  63.5    5e-08   
ref|XP_006297135.1|  hypothetical protein CARUB_v10013137mg           63.2    7e-08   Capsella rubella
ref|XP_010510070.1|  PREDICTED: uncharacterized protein At1g51745     62.8    7e-08   Camelina sativa [gold-of-pleasure]
dbj|BAJ91774.1|  predicted protein                                    61.2    3e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001078195.1|  uncharacterized protein                          60.5    5e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EMT19851.1|  hypothetical protein F775_09638                       60.5    5e-07   
ref|XP_002455796.1|  hypothetical protein SORBIDRAFT_03g025340        60.5    6e-07   Sorghum bicolor [broomcorn]
ref|XP_010535212.1|  PREDICTED: uncharacterized protein At1g51745     59.7    8e-07   Tarenaya hassleriana [spider flower]
gb|KJB35000.1|  hypothetical protein B456_006G096200                  59.7    8e-07   Gossypium raimondii
gb|KJB35001.1|  hypothetical protein B456_006G096200                  59.7    8e-07   Gossypium raimondii
ref|XP_003569211.1|  PREDICTED: uncharacterized protein LOC100833692  59.3    1e-06   Brachypodium distachyon [annual false brome]
emb|CDY22868.1|  BnaA06g02090D                                        58.9    2e-06   Brassica napus [oilseed rape]
ref|XP_009147732.1|  PREDICTED: uncharacterized protein At1g51745...  58.9    2e-06   Brassica rapa
ref|XP_004968966.1|  PREDICTED: uncharacterized protein At1g51745...  58.5    2e-06   Setaria italica
pir||D96556  hypothetical protein F19C24.5 [imported] - Arabidops...  58.5    3e-06
ref|XP_009144882.1|  PREDICTED: uncharacterized protein At1g51745     58.2    3e-06   Brassica rapa
emb|CDM83021.1|  unnamed protein product                              56.6    1e-05   Triticum aestivum [Canadian hard winter wheat]
gb|KHG25774.1|  hypothetical protein F383_10403                       55.5    2e-05   Gossypium arboreum [tree cotton]
emb|CDY43925.1|  BnaA05g15350D                                        54.7    4e-05   Brassica napus [oilseed rape]
gb|KFK39439.1|  hypothetical protein AALP_AA3G245000                  54.7    5e-05   Arabis alpina [alpine rockcress]
ref|XP_010488139.1|  PREDICTED: uncharacterized protein At1g51745...  52.8    2e-04   Camelina sativa [gold-of-pleasure]
tpg|DAA59003.1|  TPA: hypothetical protein ZEAMMB73_224631            52.4    3e-04   
ref|XP_008676390.1|  PREDICTED: uncharacterized protein At1g51745     52.4    3e-04   



>ref|XP_009614718.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Nicotiana tomentosiformis]
Length=726

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 117/161 (73%), Gaps = 16/161 (10%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH----DLDDD-----SAPKGVD  632
            YISLMSKLNGQPI GH L VEVLDDGFCD LLVS S C+    DLD+D     SA +G D
Sbjct  565  YISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSECYSSSYDLDEDHSENISALQGAD  624

Query  631  MVNKTKLSFGGRL-------QPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNP  473
            M  ++K S   R+       QPR S TKS K++K  +LSKK+R+LSSLTG  +QN+EK P
Sbjct  625  MDYESKPSLAARMSTRHRMVQPRDSPTKSPKTRKNGLLSKKIRKLSSLTGSHQQNKEKKP  684

Query  472  TVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  350
             V++LRGP +ACVPLK+VFSRI  ALNSS+RPAHR I PSI
Sbjct  685  VVEKLRGPAVACVPLKIVFSRINEALNSSVRPAHRSIIPSI  725



>ref|XP_009614713.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614714.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614715.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614716.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
Length=741

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 117/161 (73%), Gaps = 16/161 (10%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH----DLDDD-----SAPKGVD  632
            YISLMSKLNGQPI GH L VEVLDDGFCD LLVS S C+    DLD+D     SA +G D
Sbjct  580  YISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSECYSSSYDLDEDHSENISALQGAD  639

Query  631  MVNKTKLSFGGRL-------QPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNP  473
            M  ++K S   R+       QPR S TKS K++K  +LSKK+R+LSSLTG  +QN+EK P
Sbjct  640  MDYESKPSLAARMSTRHRMVQPRDSPTKSPKTRKNGLLSKKIRKLSSLTGSHQQNKEKKP  699

Query  472  TVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  350
             V++LRGP +ACVPLK+VFSRI  ALNSS+RPAHR I PSI
Sbjct  700  VVEKLRGPAVACVPLKIVFSRINEALNSSVRPAHRSIIPSI  740



>ref|XP_009782512.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782513.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782514.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782515.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
Length=726

 Score =   165 bits (417),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 117/161 (73%), Gaps = 16/161 (10%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH----DLDDD-----SAPKGVD  632
            YISLMSKLNGQPI GH L VEVLDDGFCD LLVS S C+    DLD+D     SA +G D
Sbjct  565  YISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSECYSSSYDLDEDHSENNSALQGAD  624

Query  631  MVNKTKLSFGGRL-------QPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNP  473
            M  ++K S   R+       QPR S TKS K++K  +LSKK+R+LSSLTG  +QN+EK P
Sbjct  625  MDYESKPSLAARISTRHHMVQPRGSPTKSPKTRKNGLLSKKIRKLSSLTGSHQQNKEKKP  684

Query  472  TVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  350
             V++L+GP +ACVPLK+VFSRI  ALNSS+RPAHR I PSI
Sbjct  685  VVEKLKGPAVACVPLKIVFSRINEALNSSVRPAHRSIIPSI  725



>ref|XP_004236393.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum lycopersicum]
 ref|XP_010318513.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum lycopersicum]
Length=703

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 16/161 (10%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS----NCHDLDDD-----SAPKGVD  632
            YISLMSKLNGQPI GH L VEVLDDGFCD LL+S S    + +DLD+D     S     +
Sbjct  542  YISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLLSGSEHYSSSYDLDEDHGENSSVLHSAN  601

Query  631  MVNKTKLSFGGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNP  473
            +V ++K S  GR       L+PR+S  KS K++K  +LSKK+R+LSSLTG  +QNREK P
Sbjct  602  IVYESKPSSAGRISTKHRMLKPRSSPAKSPKTRKNGLLSKKIRKLSSLTGSHQQNREKKP  661

Query  472  TVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  350
             V++L+GP +ACVPLK+VFSRI  ALN+SIRPAHR + PSI
Sbjct  662  VVEKLKGPAVACVPLKIVFSRISEALNNSIRPAHRSLVPSI  702



>ref|XP_006343014.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum tuberosum]
Length=700

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 116/161 (72%), Gaps = 16/161 (10%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH----DLDDD-----SAPKGVD  632
            YISLMSKLNGQPI GH L VEVLDDGFCD LLVS S  +    DLD+D     S     D
Sbjct  539  YISLMSKLNGQPIIGHPLTVEVLDDGFCDNLLVSGSEYYSSSYDLDEDHGENSSVLHSAD  598

Query  631  MVNKTKLSFGGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNP  473
            +V ++K S  GR       ++PR+S TKS K++K  +LSKK+R+LSSLTG  +QNREK P
Sbjct  599  IVYESKPSSAGRTSTKHRMVKPRSSPTKSPKTRKNGLLSKKIRKLSSLTGSHQQNREKKP  658

Query  472  TVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  350
             V++++GP +ACVPLK+VFSRI  ALN+SIRPAHR + PSI
Sbjct  659  VVEKVKGPAVACVPLKIVFSRISEALNNSIRPAHRSLVPSI  699



>emb|CDO97945.1| unnamed protein product [Coffea canephora]
Length=739

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 14/158 (9%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC---HDLDDDSAP-----KGVDM  629
            YISLMSKLNG+PI GH L V+VL+DG CDQL+ S+      ++LDDD A      +  DM
Sbjct  580  YISLMSKLNGRPIIGHPLTVDVLEDGSCDQLVSSSECHSSSYELDDDPAEDTYPLRSFDM  639

Query  628  VNKTKLSFGGR------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTV  467
            V + + + GGR      LQPR S  KS K+KK  +L KK+R+LSSLTG +  + +K P +
Sbjct  640  VYERRPNSGGRTNKHQALQPRVSPAKSPKAKKNGLLLKKIRKLSSLTGHKHCDVDKKPVM  699

Query  466  QQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            ++L+GP +ACVPLKVVFSRI AALNSS+R  HRL+ PS
Sbjct  700  EKLKGPAVACVPLKVVFSRINAALNSSMRSTHRLLPPS  737



>ref|XP_011072468.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
 ref|XP_011072469.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
Length=735

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 17/157 (11%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLL-------VSASNCHDLDDDSAPKGVDMV  626
            YISLMSKL+GQPI GH LAVEVL+ G CD LL        S+   H+L+  SA +G++MV
Sbjct  577  YISLMSKLHGQPIIGHPLAVEVLEAGSCDGLLGLTECYSSSSELDHNLNSVSALQGLNMV  636

Query  625  NKTKLSFGGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNRE-KNPT  470
             + +    GR       LQ  ++  K+ KS++  +LSKK+R+LSSLTG  KQ++E K P 
Sbjct  637  YERRPR--GRPPSKHRSLQAHSTRRKTPKSRRNGLLSKKIRKLSSLTGSHKQSQEDKKPV  694

Query  469  VQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIA  359
            V++L+GP+IAC+PL VVFSRI AALNSS+RP  R+ A
Sbjct  695  VEKLKGPSIACIPLNVVFSRINAALNSSMRPPPRMAA  731



>ref|XP_010690078.1| PREDICTED: uncharacterized protein At1g51745 [Beta vulgaris subsp. 
vulgaris]
Length=710

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 89/153 (58%), Gaps = 14/153 (9%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVS--ASNCHDLDDDSAPKGVDMVNKTK-  614
            YISLMSKL+G+PITGH +AVE L+DGFCD       AS   +LDD+       +  KTK 
Sbjct  551  YISLMSKLSGKPITGHPVAVEALEDGFCDLQTCDYPASGSCELDDEDTEMDFVIEPKTKH  610

Query  613  ----------LSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREK-NPTV  467
                         G + + +     S   K+    SKK R+LSSLTGP K N EK  P V
Sbjct  611  IKLQSHFPRRRGKGKKGKGKGKGKSSKSKKRHGSSSKKTRKLSSLTGPHKLNPEKRKPMV  670

Query  466  QQLRGPTIACVPLKVVFSRIKAALNSSIRPAHR  368
            Q  +GPT+ACVPLK+VFSRI  ALN S R AHR
Sbjct  671  QTSKGPTLACVPLKIVFSRINEALNGSTRSAHR  703



>ref|XP_011080298.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
 ref|XP_011080306.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
Length=709

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 94/148 (64%), Gaps = 4/148 (3%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSA---SNCHDLDDDSAPKGVDMVNKTK  614
            YISL+SKLNGQPI GH + VE LDDGFC+ L V +   S+  +LDD+     V      +
Sbjct  560  YISLVSKLNGQPIIGHPITVEALDDGFCNNLFVVSECRSSSSELDDEKHVGTVYQQRPHR  619

Query  613  LSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTV-QQLRGPTIAC  437
                      +   K  +SK+ S+LSKK+R+LSSLTG  + +RE+   V  +L+GP+IAC
Sbjct  620  RPHSKHRSAYSLPAKPPRSKRNSILSKKIRKLSSLTGSHRLSREEKKRVPDKLKGPSIAC  679

Query  436  VPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            VPL VVFSRI AAL SS+R   RLIA S
Sbjct  680  VPLNVVFSRINAALTSSVRYPPRLIATS  707



>ref|XP_002304109.2| hypothetical protein POPTR_0003s03970g [Populus trichocarpa]
 gb|EEE79088.2| hypothetical protein POPTR_0003s03970g [Populus trichocarpa]
Length=707

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS--NCHDLDDDS-APKGVDMVNKTKL  611
            +SLMSKLNG+ I GH L +E LDDG+ D +L S      H  + ++  P  V M N    
Sbjct  559  VSLMSKLNGKAIVGHPLTIENLDDGYSDLMLGSNERDTTHVTEGETPKPGYVAMRNIEAG  618

Query  610  SFGGR---LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIA  440
                R   ++PR+S  KS K +K  +LSKK+R+LSSLTG R ++R+  P V++  GP IA
Sbjct  619  RTPARRMTMKPRSSPRKSHKLRKCGLLSKKIRKLSSLTGKRVEDRK--PVVEKPEGPVIA  676

Query  439  CVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            C+PLK+VFSRI  A+N S R  HR +  S
Sbjct  677  CIPLKLVFSRINEAVNGSARQTHRALPSS  705



>ref|XP_007135591.1| hypothetical protein PHAVU_010G142200g [Phaseolus vulgaris]
 gb|ESW07585.1| hypothetical protein PHAVU_010G142200g [Phaseolus vulgaris]
Length=780

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 86/143 (60%), Gaps = 6/143 (4%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL+SKLNG+   GH L VEVL++G CD++L S S C     D     V  + K  L   
Sbjct  640  VSLVSKLNGKAFIGHPLTVEVLEEGHCDKML-SGSGC-----DMEAGDVFCMAKPNLVPR  693

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKV  422
                  +   KSSK KK  +++KK+R+LSSLTG R+   E+ P V +L+GP IAC+PLKV
Sbjct  694  RIHSKSSKRLKSSKMKKTGLMNKKIRKLSSLTGHRQSEEERKPVVDKLKGPVIACIPLKV  753

Query  421  VFSRIKAALNSSIRPAHRLIAPS  353
            VFSRI  A++   R  HR +  S
Sbjct  754  VFSRINEAVSGQARSTHRAVPTS  776



>ref|XP_010062582.1| PREDICTED: uncharacterized protein At1g51745 [Eucalyptus grandis]
 gb|KCW69713.1| hypothetical protein EUGRSUZ_F03102 [Eucalyptus grandis]
Length=770

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L+VEVLD G CD L V+  +C D ++ S   G  M +    S  
Sbjct  627  VSLMSKLNGKAIVGHPLSVEVLDGGHCDNL-VNTGSC-DANNLSTWGGSKMAHPVHRSSA  684

Query  601  G--RLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPL  428
               R     S  KSSK+KK   LSKK+R+LSSLTG ++        V++  GP IAC+PL
Sbjct  685  HVRRTGKSHSRKKSSKAKKSGQLSKKMRKLSSLTGHKRGEDMGKFAVEKPAGPVIACIPL  744

Query  427  KVVFSRIKAALNSSIRPAHRLI  362
            KVVFSRI  A+N S RP HR +
Sbjct  745  KVVFSRINEAVNGSARPTHRAL  766



>ref|XP_002515884.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46304.1| conserved hypothetical protein [Ricinus communis]
Length=786

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 91/150 (61%), Gaps = 15/150 (10%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I G  L +  L DG+CD ++VS+  C    D +    V+     + S  
Sbjct  643  VSLMSKLNGKAIIGRPLTIGHLADGYCD-VIVSSIEC----DPTRVYAVEAPQGVRNSES  697

Query  601  GR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
            GR       +QPR  S   S  +K  +LSKK+R+LSSLTG +++ R+  P V++L+GP I
Sbjct  698  GRIPAKHITMQPR-FSPSKSPKRKSGLLSKKIRKLSSLTGNKEEYRK--PVVEKLKGPVI  754

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PLKVVFSRI  A+N S R  HR +  S
Sbjct  755  ACIPLKVVFSRINEAVNGSARQTHRALTSS  784



>gb|EYU45844.1| hypothetical protein MIMGU_mgv1a004135mg [Erythranthe guttata]
Length=542

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 79/153 (52%), Gaps = 38/153 (25%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSF  605
            YISLMS+LN QPI GH LAVEVLDD  CD ++       D   ++  +G       K S 
Sbjct  413  YISLMSRLNRQPIVGHPLAVEVLDDSSCDDVI-------DFYGETKHRGRPTKKSKKNS-  464

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLR----------  455
             G+L  +                   R+LS+L+GP + +RE N    + +          
Sbjct  465  -GQLSKK------------------TRKLSALSGPHRLSREANKMKTKKKKKKPVMEKVK  505

Query  454  -GPTIACVPLKVVFSRIKAALNSSIRPAHRLIA  359
             GP IACVPL VVFSRI A+LN S RPA RL++
Sbjct  506  KGPCIACVPLNVVFSRISASLNGSGRPAPRLVS  538



>ref|XP_010088115.1| hypothetical protein L484_001821 [Morus notabilis]
 gb|EXB31785.1| hypothetical protein L484_001821 [Morus notabilis]
Length=775

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 15/145 (10%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKL+G+ I GH LAVE L+DG CD LL +A    + +D  A  G    NK +    
Sbjct  640  VSLMSKLHGKAIVGHPLAVESLEDGCCDSLLRTAEG--EFED--AHIGYVKRNKGR----  691

Query  601  GR------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIA  440
            GR      LQP+ S  KS+K+KK  +L KK+R+LSSLTG +K   E    V++ +GP IA
Sbjct  692  GRIPKHLLLQPQNSPHKSAKTKKSGLLPKKIRKLSSLTGSKKL-EEMKSVVEKPKGPVIA  750

Query  439  CVPLKVVFSRIKAALNSSIRPAHRL  365
            C+PLK+VFSRI  A+N   R  HR+
Sbjct  751  CIPLKLVFSRINEAVNGLARQTHRV  775



>gb|KJB70319.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
Length=632

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS-NCHDLDDDSAPKGVDMVNKTKLSF  605
            +SLMSKLNG+ I GH L VEVL+D + D     A+  C ++D          V +  +  
Sbjct  491  VSLMSKLNGKAIIGHPLTVEVLNDDYYDNPSQEAAMECTEVDHSLKQNSGGRVPRKHIKL  550

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  425
              +  PR    KS+K KK  +LSKK+R+LSSLTG +     + P  ++ +GP IAC+PLK
Sbjct  551  QSQFPPR----KSAKVKKSGLLSKKIRKLSSLTGQKLCVGFRKPVAEKPKGPVIACIPLK  606

Query  424  VVFSRIKAALNSSIRPAHRLIAPS  353
            +VFSRI  ALN S RP HR +  S
Sbjct  607  LVFSRINEALNGSARPTHRSLTSS  630



>gb|KHG23152.1| hypothetical protein F383_01193 [Gossypium arboreum]
Length=778

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS-NCHDLDDDSAPKGVDMVNKTKLSF  605
            +SLMSKLNG+ I GH L VEVL+D + D     A+  C ++D          V +  +  
Sbjct  637  VSLMSKLNGKAIIGHPLTVEVLNDDYYDNPSQEAAVECTEVDHSLKQNSGGRVPRKHIKL  696

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  425
              +  PR    KS+K KK  +LSKK+R+LSSLTG +     + P  ++ +GP IAC+PLK
Sbjct  697  QSQFPPR----KSAKVKKSGLLSKKIRKLSSLTGQKLGVGLRKPVAEKPKGPVIACIPLK  752

Query  424  VVFSRIKAALNSSIRPAHRLIAPS  353
            +VFSRI  ALN S RP HR +  S
Sbjct  753  LVFSRINEALNGSARPMHRSLTSS  776



>gb|KJB70320.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
 gb|KJB70321.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
 gb|KJB70322.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
 gb|KJB70323.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
Length=781

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS-NCHDLDDDSAPKGVDMVNKTKLSF  605
            +SLMSKLNG+ I GH L VEVL+D + D     A+  C ++D          V +  +  
Sbjct  640  VSLMSKLNGKAIIGHPLTVEVLNDDYYDNPSQEAAMECTEVDHSLKQNSGGRVPRKHIKL  699

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  425
              +  PR    KS+K KK  +LSKK+R+LSSLTG +     + P  ++ +GP IAC+PLK
Sbjct  700  QSQFPPR----KSAKVKKSGLLSKKIRKLSSLTGQKLCVGFRKPVAEKPKGPVIACIPLK  755

Query  424  VVFSRIKAALNSSIRPAHRLIAPS  353
            +VFSRI  ALN S RP HR +  S
Sbjct  756  LVFSRINEALNGSARPTHRSLTSS  779



>gb|KEH18280.1| tudor/PWWP/MBT superfamily protein [Medicago truncatula]
Length=782

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 84/143 (59%), Gaps = 8/143 (6%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL SKL+G+   GH L VEVL+DG CD++L       ++DD      +D V K K    
Sbjct  642  VSLASKLSGKAFIGHPLTVEVLEDGHCDKMLSGLRRDVEVDD------IDCVVKPKPVTT  695

Query  601  GRLQPRAsstksskskkesml--skKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPL  428
             R +  +  ++   SK +     +KK+R+LSSLTG R+   ++ P V +L+GP IAC+PL
Sbjct  696  RRPKRSSHFSRRKSSKSKKSGLLNKKIRKLSSLTGHRQSEEKRKPVVDKLKGPVIACIPL  755

Query  427  KVVFSRIKAALNSSIRPAHRLIA  359
             +VFSRI  AL+   R  HR ++
Sbjct  756  TIVFSRINEALSGQARSTHRAVS  778



>ref|XP_008228331.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Prunus mume]
Length=752

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 88/150 (59%), Gaps = 15/150 (10%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VE L DG CD +++S   C   D +    G  +  K ++   
Sbjct  609  VSLMSKLNGKAIVGHPLTVEALGDGCCD-IMLSKLEC---DREVGKIGYAIQPKAEI---  661

Query  601  GR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
            GR       LQP+ S  KS K+KK  +  KK R+LSSLTG  KQ+    P   + +GP I
Sbjct  662  GRNPGKHLALQPQNSPNKSPKTKKSGLQPKKTRKLSSLTG-HKQSEVTKPLAAKPQGPVI  720

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PLK+VFSRI  A+N   RP HR++  S
Sbjct  721  ACIPLKLVFSRINEAVNGLARPTHRVLKSS  750



>ref|XP_008228332.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Prunus mume]
Length=716

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 88/150 (59%), Gaps = 15/150 (10%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VE L DG CD +++S   C   D +    G  +  K ++   
Sbjct  573  VSLMSKLNGKAIVGHPLTVEALGDGCCD-IMLSKLEC---DREVGKIGYAIQPKAEI---  625

Query  601  GR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
            GR       LQP+ S  KS K+KK  +  KK R+LSSLTG  KQ+    P   + +GP I
Sbjct  626  GRNPGKHLALQPQNSPNKSPKTKKSGLQPKKTRKLSSLTG-HKQSEVTKPLAAKPQGPVI  684

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PLK+VFSRI  A+N   RP HR++  S
Sbjct  685  ACIPLKLVFSRINEAVNGLARPTHRVLKSS  714



>ref|XP_008462373.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis melo]
Length=828

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 84/143 (59%), Gaps = 4/143 (3%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVN---KTKL  611
            +SLMSKLNG+ I GH L VE+++DG CD LL  A +  + D+     G    N   + K 
Sbjct  686  VSLMSKLNGKAIVGHPLTVEIVEDGHCDSLLSRADSEREGDEHCYVTGKHSANARTQAKQ  745

Query  610  SFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVP  431
            S     QP  S +KS + KK   L KK+R+LSSLTG R QN+ K   VQ+     I C+P
Sbjct  746  SKQSPSQPCFSPSKSPRMKKSGHLCKKIRKLSSLTGNRHQNQPKR-MVQKSSDHVITCIP  804

Query  430  LKVVFSRIKAALNSSIRPAHRLI  362
            LKVVFSRI  A++   RP+H  +
Sbjct  805  LKVVFSRINEAVSGLARPSHHAL  827



>ref|XP_007217004.1| hypothetical protein PRUPE_ppa002212mg [Prunus persica]
 gb|EMJ18203.1| hypothetical protein PRUPE_ppa002212mg [Prunus persica]
Length=700

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 86/150 (57%), Gaps = 15/150 (10%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VE L DG CD +L       + D +    G  +  K ++   
Sbjct  557  VSLMSKLNGKAIVGHPLTVEALGDGCCDIMLCKL----ECDREVGKIGYAIQPKAEI---  609

Query  601  GR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
            GR       LQP+ S  KS K+KK  +  KK R+LSSLTG  KQ+    P   + +GP I
Sbjct  610  GRNPGKHLALQPQNSPNKSPKTKKSGLQPKKTRKLSSLTG-HKQSEVMKPLTAKPQGPVI  668

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PLK+VFSRI  A+N   RP HR++  S
Sbjct  669  ACIPLKLVFSRINEAVNGLARPTHRVLKSS  698



>ref|XP_010654562.1| PREDICTED: uncharacterized protein At1g51745-like [Vitis vinifera]
Length=755

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 12/152 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVLDD     L  S    +D    S  +G +M    K +  
Sbjct  605  VSLMSKLNGKAIVGHPLTVEVLDDLSDLLLSDSE---YDPTTMSVSEGDEMGYAVKRNSE  661

Query  601  GR--------LQPRAsstksskskkesmlskKVRRLSSLTGP-RKQNREKNPTVQQLRGP  449
             R        LQ R S +KS K KK  +LSKK+R+LSSLTG  +K++ E+ P V +L+GP
Sbjct  662  TRRLPTKHSTLQLRVSPSKSPKMKKGGLLSKKIRKLSSLTGSHKKRDEERKPVVDKLKGP  721

Query  448  TIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
             IAC+PLK+VFSR+  A+NSS RPAH  + PS
Sbjct  722  AIACIPLKLVFSRLNEAVNSSARPAHHALTPS  753



>ref|XP_012069023.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 ref|XP_012069024.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 ref|XP_012069025.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 ref|XP_012069026.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 gb|KDP40807.1| hypothetical protein JCGZ_24806 [Jatropha curcas]
Length=770

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 92/150 (61%), Gaps = 11/150 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKT-KLSF  605
            +SLMSKLNG+ I G  L VE +DDGFCD L++ ++ C D    SA    ++ +   + S 
Sbjct  623  VSLMSKLNGKAIIGRPLTVECVDDGFCD-LIIRSNEC-DPTRASALDAAELGHAAMRNSD  680

Query  604  GGRLQPRAsstksskskkesmlsk------KVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
             GR+  +  + ++  S  +S   K      K+R+LS+LTG +++ R+  P V++L+GP I
Sbjct  681  AGRIPAKHMTMQARFSPSKSPKRKCVLLPKKIRKLSTLTGNKEEYRK--PVVEKLKGPVI  738

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PLK+VFSRI  A+N S R  +R +  S
Sbjct  739  ACIPLKLVFSRINEAVNGSARQTNRALTSS  768



>ref|XP_006426470.1| hypothetical protein CICLE_v10027499mg [Citrus clementina]
 gb|ESR39710.1| hypothetical protein CICLE_v10027499mg [Citrus clementina]
Length=763

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  625  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEAGRN  682

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  683  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  738

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  739  PLKLVFSRINEAVNGSARPANRAL  762



>emb|CAN84040.1| hypothetical protein VITISV_024170 [Vitis vinifera]
Length=794

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 12/152 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVLDD     L  S    +D    S  +G +M    K +  
Sbjct  644  VSLMSKLNGKAIVGHPLTVEVLDDLSDLLLSDSE---YDPTTMSVSEGDEMGYAVKRNSE  700

Query  601  GR--------LQPRAsstksskskkesmlskKVRRLSSLTGP-RKQNREKNPTVQQLRGP  449
             R        LQ R S +KS K KK  +LSKK+R+LSSLTG  +K++ E+ P V +L+GP
Sbjct  701  TRRLPTKHSTLQLRVSPSKSPKMKKGGLLSKKIRKLSSLTGSHKKRDEERKPVVDKLKGP  760

Query  448  TIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
             IAC+PLK+VFSR+  A+NSS RPAH  + PS
Sbjct  761  AIACIPLKLVFSRLNEAVNSSARPAHHALTPS  792



>gb|KDO58660.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=762

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  624  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEPGRN  681

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  682  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  737

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  738  PLKLVFSRINEAVNGSARPANRAL  761



>ref|XP_006466092.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Citrus sinensis]
Length=763

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  625  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEPGRN  682

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  683  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  738

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  739  PLKLVFSRINEAVNGSARPANRAL  762



>gb|KDO58662.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=760

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  622  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEPGRN  679

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  680  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  735

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  736  PLKLVFSRINEAVNGSARPANRAL  759



>gb|KDO58661.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=751

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  613  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEPGRN  670

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  671  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  726

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  727  PLKLVFSRINEAVNGSARPANRAL  750



>ref|XP_006466094.1| PREDICTED: uncharacterized protein At1g51745-like isoform X3 
[Citrus sinensis]
Length=752

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  614  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEPGRN  671

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  672  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  727

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  728  PLKLVFSRINEAVNGSARPANRAL  751



>ref|XP_006466093.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Citrus sinensis]
Length=761

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  623  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEPGRN  680

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  681  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  736

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  737  PLKLVFSRINEAVNGSARPANRAL  760



>ref|XP_008380820.1| PREDICTED: uncharacterized protein At1g51745 isoform X3 [Malus 
domestica]
Length=702

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL--S  608
            +SLMSKLNG+ I GH L VEVL DG           C D + D     V    +     +
Sbjct  571  VSLMSKLNGKAIVGHPLTVEVLGDG-----------CSDXEVDKTGYAVKPEKEIGRIPA  619

Query  607  FGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPL  428
             G  +QPR S ++S K+KK  +  KK+R+LSSLTG  KQ+ E+ P V + +GP IAC+PL
Sbjct  620  KGLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HKQSEERKPLVPKQKGPVIACIPL  678

Query  427  KVVFSRIKAALNSSIRPAHRLIAPS  353
            KVVFSRI  A+    RP+HR++  S
Sbjct  679  KVVFSRINEAV---ARPSHRVLRSS  700



>ref|XP_008380818.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Malus 
domestica]
 ref|XP_008380819.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Malus 
domestica]
Length=738

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL--S  608
            +SLMSKLNG+ I GH L VEVL DG           C D + D     V    +     +
Sbjct  607  VSLMSKLNGKAIVGHPLTVEVLGDG-----------CSDXEVDKTGYAVKPEKEIGRIPA  655

Query  607  FGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPL  428
             G  +QPR S ++S K+KK  +  KK+R+LSSLTG  KQ+ E+ P V + +GP IAC+PL
Sbjct  656  KGLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HKQSEERKPLVPKQKGPVIACIPL  714

Query  427  KVVFSRIKAALNSSIRPAHRLIAPS  353
            KVVFSRI  A+    RP+HR++  S
Sbjct  715  KVVFSRINEAV---ARPSHRVLRSS  736



>ref|XP_009367515.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Pyrus x bretschneideri]
Length=705

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 86/150 (57%), Gaps = 24/150 (16%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLN + I GH   VEVLDDG           C D + D     V    +      
Sbjct  571  VSLMSKLNSKAIVGHPRTVEVLDDG-----------CSDWEVDKTGYAVKPEKEI-----  614

Query  601  GRL-------QPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
            GR+       QPR S ++S K+KK  +  KK+R+LSSLTG  KQ+ ++ P V + +GP I
Sbjct  615  GRIPAKVLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HKQSEDRKPLVPKPKGPVI  673

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PLK+VFSRI  A+N   RP+HR++  S
Sbjct  674  ACIPLKLVFSRINEAVNGLARPSHRVLRSS  703



>ref|XP_006466095.1| PREDICTED: uncharacterized protein At1g51745-like isoform X4 
[Citrus sinensis]
Length=750

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 10/144 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L VEVL DG+CD +   A+    ++  SAP G  +  K++    
Sbjct  612  VSLMSKLNGKAIIGHPLMVEVLGDGYCDGMESDATRVFVVE--SAPMGYPVKQKSEPGRN  669

Query  601  GRLQPRAsstksskskke----smlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
               + + SS  SS    +      LSKK+R+LSSLT       E+ P  Q+ +GP I+C+
Sbjct  670  SNKRKKLSSRYSSSKSLKSRKPESLSKKIRKLSSLT----SQVERKPAEQKPKGPVISCI  725

Query  433  PLKVVFSRIKAALNSSIRPAHRLI  362
            PLK+VFSRI  A+N S RPA+R +
Sbjct  726  PLKLVFSRINEAVNGSARPANRAL  749



>ref|XP_009367513.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009367514.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Pyrus x bretschneideri]
Length=741

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 86/150 (57%), Gaps = 24/150 (16%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLN + I GH   VEVLDDG           C D + D     V    +      
Sbjct  607  VSLMSKLNSKAIVGHPRTVEVLDDG-----------CSDWEVDKTGYAVKPEKEI-----  650

Query  601  GRL-------QPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
            GR+       QPR S ++S K+KK  +  KK+R+LSSLTG  KQ+ ++ P V + +GP I
Sbjct  651  GRIPAKVLAVQPRNSPSRSPKTKKSGLQPKKIRKLSSLTG-HKQSEDRKPLVPKPKGPVI  709

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PLK+VFSRI  A+N   RP+HR++  S
Sbjct  710  ACIPLKLVFSRINEAVNGLARPSHRVLRSS  739



>ref|XP_011659648.1| PREDICTED: uncharacterized protein At1g51745 [Cucumis sativus]
 gb|KGN45541.1| hypothetical protein Csa_7G451960 [Cucumis sativus]
Length=819

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 84/151 (56%), Gaps = 20/151 (13%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMV--------  626
            +SLMSKLNG+ I GH L VE+++DG CD LL  A        DS P+G +          
Sbjct  677  VSLMSKLNGKAIVGHPLTVEIVEDGHCDSLLTRA--------DSEPEGNEQCYVTGKHTA  728

Query  625  ---NKTKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLR  455
                + K S     QP  S ++S + KK   L KK+R+LSSLTG R QN+ K   VQ+  
Sbjct  729  PSRTQAKQSKQSPSQPCFSPSRSPRMKKSGHLCKKIRKLSSLTGNRHQNQPKR-MVQKSS  787

Query  454  GPTIACVPLKVVFSRIKAALNSSIRPAHRLI  362
               I C+PLKVVFSRI  A++   RP+H  +
Sbjct  788  DHVITCIPLKVVFSRINEAVSGLARPSHHAL  818



>gb|KHN39281.1| Hypothetical protein glysoja_018053 [Glycine soja]
Length=784

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL+SKLNG+   GH LAVEVL +G CD++L       ++ D       + V +   S  
Sbjct  642  VSLVSKLNGKAFIGHPLAVEVLVEGHCDKMLSDIGCDLEVGDVYCAAKPNSVTRRIHS--  699

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKV  422
             +   R S +KSSK KK  +L+KK+R+LSSLTG ++   E+ P V +L+GP IAC+PLKV
Sbjct  700  -KNLTRFSPSKSSKMKKTGLLNKKIRKLSSLTGHKQLEEERKPVVDKLKGPVIACIPLKV  758

Query  421  VFSRIKAALNSSIRPAHRLIAPS  353
            VFSRI  A++   R  +R +  S
Sbjct  759  VFSRINEAVSGQARSTYRALPTS  781



>ref|XP_003529739.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=784

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL+SKLNG+   GH LAVEVL +G CD++L       ++ D       + V +   S  
Sbjct  642  VSLVSKLNGKAFIGHPLAVEVLVEGHCDKMLSDIGCDLEVGDVYCAAKPNSVTRRIHS--  699

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKV  422
             +   R S +KSSK KK  +L+KK+R+LSSLTG ++   E+ P V +L+GP IAC+PLKV
Sbjct  700  -KNLTRFSPSKSSKMKKTGLLNKKIRKLSSLTGHKQLEEERKPVVDKLKGPVIACIPLKV  758

Query  421  VFSRIKAALNSSIRPAHRLIAPS  353
            VFSRI  A++   R  +R +  S
Sbjct  759  VFSRINEAVSGQARSTYRALPTS  781



>ref|XP_004510340.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Cicer arietinum]
 ref|XP_004510341.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Cicer arietinum]
Length=789

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDD----DSAPKGVDMVNKTK  614
            +SL+SKLNG+   GH L VEVL++G CD+LL       ++ D       P    +  +  
Sbjct  644  VSLVSKLNGKAFIGHPLTVEVLEEGHCDKLLSGIVGDMEVGDIYCEAEKPNSKSVTRRIP  703

Query  613  LSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
                     R S +KSSKSKK  +L+KK+R+LSSLTG R+   E+ P V +L+GP IAC+
Sbjct  704  SKK---KSSRFSRSKSSKSKKSGLLNKKIRKLSSLTGHRQSEDERKPVVDKLKGPVIACI  760

Query  433  PLKVVFSRIKAALNSSIRPAHRLIA  359
            PL VVFSRI  A++   R  HR ++
Sbjct  761  PLTVVFSRINEAVSGQARSTHRAVS  785



>ref|XP_011652363.1| PREDICTED: uncharacterized protein At1g51745 [Cucumis sativus]
 gb|KGN59837.1| hypothetical protein Csa_3G849930 [Cucumis sativus]
Length=729

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS--------NCHDLDDDSAPKGVDMV  626
            +SLMSKLN + + GH L VE LDDG CD LL            + H +  +S  KG  M+
Sbjct  582  VSLMSKLNCKAVVGHPLTVEALDDGHCDDLLSRTELDPQKIVESSHSVQSNSW-KG-KML  639

Query  625  NKTKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPT  446
             K +   G  +Q R S  K+SK+KK   LSKK R+LSSLT  ++   +  P V++ +G  
Sbjct  640  GKPR---GRAVQLRPSQGKASKAKKSGQLSKKTRKLSSLTVQKQFVDDSRPVVEKSKGSF  696

Query  445  IACVPLKVVFSRIKAALNSSIRPAHR  368
            IAC+PLKVVFSRI  A+N   RP HR
Sbjct  697  IACIPLKVVFSRINKAVNGLARPTHR  722



>gb|EYU21406.1| hypothetical protein MIMGU_mgv1a002564mg [Erythranthe guttata]
Length=659

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 91/146 (62%), Gaps = 6/146 (4%)
 Frame = -2

Query  784  YISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC--HDLDDDSAPKGVDMVNKTKL  611
            YISLMSK NG+PI GH L++EVL DG   +   S+S     +L   S  +G   V   + 
Sbjct  513  YISLMSKSNGRPIVGHPLSIEVLSDGHILECYSSSSEPARSNLKYVSGSRGGADVACGRK  572

Query  610  SFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPT---VQQL-RGPTI  443
              G       S  KS KSK+  +LSKK+R+LSSL+GP  ++ ++  T   V+++ +GP++
Sbjct  573  PRGSPAVRSRSLAKSRKSKRNGLLSKKIRKLSSLSGPHGESHQQYKTKTGVEKVSKGPSV  632

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRL  365
            ACVPL VVFSRI AALNSSIR A R 
Sbjct  633  ACVPLNVVFSRINAALNSSIRHAPRF  658



>ref|XP_007024422.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007024423.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27044.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27045.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=786

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 86/145 (59%), Gaps = 18/145 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS-NCHDLDDDSAPKGVDMVNKTKLSF  605
            +SLMSKLNG+ I GH L VEVL D +   L   A+  C +         + +V K + S 
Sbjct  641  LSLMSKLNGKAIIGHPLTVEVLSDDYYGSLTREAAMECTE---------IGLVVK-RNSE  690

Query  604  GGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPT  446
            GGR       L  R    KS+K+KK  +LSKK+R+LSSLTG +    ++   V++ +GP 
Sbjct  691  GGRVPTKHMKLHSRFLPRKSAKAKKSGLLSKKIRKLSSLTGQKLGLADRKLVVEKPKGPV  750

Query  445  IACVPLKVVFSRIKAALNSSIRPAH  371
            IACVPLK+VFSRI  ALN S RP H
Sbjct  751  IACVPLKLVFSRINEALNGSARPTH  775



>ref|XP_011013034.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Populus euphratica]
Length=778

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 91/151 (60%), Gaps = 12/151 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSF-  605
            +SLMSKLNG+ I GH L +E LDDG+ D +L   SN  D    +  +   + +    +  
Sbjct  630  VSLMSKLNGKAIVGHPLTIENLDDGYSDLML--GSNERDTTHFTGGETPKLGHAAMRNIE  687

Query  604  GGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPT  446
             GR       ++PR+S +KS K +K  +LSKK+R+LSSLTG R ++ +    V++  GP 
Sbjct  688  AGRTPARRMTVKPRSSPSKSHKLRKCGLLSKKIRKLSSLTGKRVEDSK--LVVEKPGGPV  745

Query  445  IACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            IAC+PLK+VFSRI  A+N S R  HR +  S
Sbjct  746  IACIPLKLVFSRINEAVNGSARQTHRALPSS  776



>ref|XP_011013035.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Populus euphratica]
Length=740

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 91/151 (60%), Gaps = 12/151 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSF-  605
            +SLMSKLNG+ I GH L +E LDDG+ D +L   SN  D    +  +   + +    +  
Sbjct  592  VSLMSKLNGKAIVGHPLTIENLDDGYSDLML--GSNERDTTHFTGGETPKLGHAAMRNIE  649

Query  604  GGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPT  446
             GR       ++PR+S +KS K +K  +LSKK+R+LSSLTG R ++ +    V++  GP 
Sbjct  650  AGRTPARRMTVKPRSSPSKSHKLRKCGLLSKKIRKLSSLTGKRVEDSK--LVVEKPGGPV  707

Query  445  IACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            IAC+PLK+VFSRI  A+N S R  HR +  S
Sbjct  708  IACIPLKLVFSRINEAVNGSARQTHRALPSS  738



>gb|KHN11311.1| Hypothetical protein glysoja_023375 [Glycine soja]
Length=784

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 91/150 (61%), Gaps = 15/150 (10%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL+SKLNG+   GH LAVEV+ +G CD++L       D+  D     V  V K   S  
Sbjct  640  VSLVSKLNGKAFIGHPLAVEVMVEGHCDKML------SDIGCDLEVGDVYCVAKPN-SVT  692

Query  601  GRLQP----RAsstksskskkesmlskKVRRLSSLTGPR---KQNREKNPTVQQLRGPTI  443
            GR+      R S +KSSK KK  +L+KK+R+LSSLTG R   ++ +EK P V + +GP I
Sbjct  693  GRIHSKNSTRFSPSKSSKMKKTGLLNKKIRKLSSLTGHRQSEEERKEKKPVVDK-KGPVI  751

Query  442  ACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            AC+PL+VVFSRI  A++   R  HR +  S
Sbjct  752  ACIPLQVVFSRINEAVSGQARSTHRALPTS  781



>ref|XP_008809885.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=777

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 84/161 (52%), Gaps = 30/161 (19%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL SKLNG+ I GH ++VEVL DG    L+     C  + +      +D   K +++  
Sbjct  621  VSLTSKLNGKAIVGHPISVEVLQDGATAALVTRNGWCPPISN------IDHSLKNRINII  674

Query  601  GRLQPRAsstksskskkesmlskK-----------------------VRRLSSLTGPRKQ  491
            G+L+P+  +T+S  + +                              +RRLSS+   RK 
Sbjct  675  GKLRPKGYTTQSHLNIQGKKADHTKVKSPLLKKKSSNNKKSGFSPRKIRRLSSIAVDRKD  734

Query  490  NRE-KNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  371
            N E + P V++++GP +ACVPL++VFSRI  AL+ S RPA+
Sbjct  735  NEEERKPMVEKIKGPAVACVPLRLVFSRINEALSCSARPAN  775



>ref|XP_010924938.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
 ref|XP_010924939.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
Length=830

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 81/157 (52%), Gaps = 26/157 (17%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +S MSKLNG+ I GH ++VEVL DG    L+     C  + +      +D   K +++  
Sbjct  678  VSFMSKLNGKAIVGHPISVEVLQDGAAAALVPRNVWCAPISN------IDHSLKNRINII  731

Query  601  GRLQPRAsstksskskkesmlskK-------------------VRRLSSLTGPRKQNRE-  482
            G+ QP+ S       K +    K                    +RRLSS+   RK  +E 
Sbjct  732  GKSQPKESHLNIQGKKADHTKVKSPLMKKKSSKNKRSGFSPRKIRRLSSIAVDRKDKKEE  791

Query  481  KNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  371
            + P V++++GP +ACVPL++VFSRI  AL+ S RPA+
Sbjct  792  RQPMVEKIKGPAVACVPLRLVFSRINEALSCSARPAN  828



>ref|XP_011463342.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=734

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 71/154 (46%), Gaps = 36/154 (23%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMV--------  626
            +SL SKLNG+ I GH + V+ LDDG+ D+L  S   C DL        V           
Sbjct  600  VSLTSKLNGKAIVGHPVTVKALDDGYSDRLFGSM-EC-DLRGGKLSYAVQQTAEIGKIPA  657

Query  625  ------NKTKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
                  N  K    G LQ +                   R+LSSLTG R+    K P  +
Sbjct  658  RHLGSPNSPKTKKSGLLQKK------------------TRKLSSLTGHRQSEERKLPVEK  699

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  362
               GP IAC+PLK+VFSRI  A+N   RP HR++
Sbjct  700  S--GPVIACIPLKLVFSRINEAVNGLARPTHRVL  731



>ref|XP_004297615.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=698

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 71/154 (46%), Gaps = 36/154 (23%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMV--------  626
            +SL SKLNG+ I GH + V+ LDDG+ D+L  S   C DL        V           
Sbjct  564  VSLTSKLNGKAIVGHPVTVKALDDGYSDRLFGSM-EC-DLRGGKLSYAVQQTAEIGKIPA  621

Query  625  ------NKTKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
                  N  K    G LQ +                   R+LSSLTG R+    K P  +
Sbjct  622  RHLGSPNSPKTKKSGLLQKK------------------TRKLSSLTGHRQSEERKLPVEK  663

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLI  362
               GP IAC+PLK+VFSRI  A+N   RP HR++
Sbjct  664  S--GPVIACIPLKLVFSRINEAVNGLARPTHRVL  695



>ref|XP_010267045.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
 ref|XP_010267046.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
Length=880

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 92/176 (52%), Gaps = 34/176 (19%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNC--------HDLDDD---------  653
            +SLMSKLNG+ I GH + VEVLD G+ D    + + C        +D+  +         
Sbjct  704  VSLMSKLNGKAIIGHPVTVEVLDTGYRDLQTSNTNYCAASSGTELYDISKENISDQSINV  763

Query  652  --SAP-------KGVDMVNKT-------KLSFGGRLQPRAsstksskskkesmlskKVRR  521
              S+P        GV++  +T        L+    +QP     KS K KK  +LSKK R+
Sbjct  764  SNSSPIPEEGDNAGVNLQAETVEPQSNQALAKHLTVQPTLLPKKSPKFKKSGLLSKKTRK  823

Query  520  LSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            LSSLT  +     + P V+   GP IACVPLKVVFSR+KAA+N S RP H + A +
Sbjct  824  LSSLTVSQDHREGRKPVVEN-SGPVIACVPLKVVFSRLKAAVNCSTRPVHHVSAST  878



>ref|XP_006369225.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
 gb|ERP65794.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
Length=698

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 88/145 (61%), Gaps = 12/145 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD---LDDDSAPKGV--DMVNKT  617
            +SLMSKLNG+ I GH L +E L DG+ D LL   SN  D   + +   PK V   M N  
Sbjct  550  VSLMSKLNGKAIVGHPLTIENLQDGYSDLLL--GSNEGDTVHVTEIETPKLVYAAMRNLE  607

Query  616  KLSFGGR---LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPT  446
                  R   ++P +S +KS K +K  +LSKK+R+LSSLTG + ++R+    V++ +GP 
Sbjct  608  AGRIPARHMTMKPLSSPSKSHKLRKCGLLSKKIRKLSSLTGKKVEDRK--LVVEKSKGPA  665

Query  445  IACVPLKVVFSRIKAALNSSIRPAH  371
            + C+PLK+VFSRI  A+N S R  H
Sbjct  666  VTCIPLKLVFSRINEAVNGSARQTH  690



>ref|XP_006369226.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
 gb|ERP65795.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
Length=737

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 88/145 (61%), Gaps = 12/145 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHD---LDDDSAPKGV--DMVNKT  617
            +SLMSKLNG+ I GH L +E L DG+ D LL   SN  D   + +   PK V   M N  
Sbjct  589  VSLMSKLNGKAIVGHPLTIENLQDGYSDLLL--GSNEGDTVHVTEIETPKLVYAAMRNLE  646

Query  616  KLSFGGR---LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPT  446
                  R   ++P +S +KS K +K  +LSKK+R+LSSLTG + ++R+    V++ +GP 
Sbjct  647  AGRIPARHMTMKPLSSPSKSHKLRKCGLLSKKIRKLSSLTGKKVEDRK--LVVEKSKGPA  704

Query  445  IACVPLKVVFSRIKAALNSSIRPAH  371
            + C+PLK+VFSRI  A+N S R  H
Sbjct  705  VTCIPLKLVFSRINEAVNGSARQTH  729



>ref|XP_008447587.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis melo]
Length=719

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 82/140 (59%), Gaps = 11/140 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMV--NKTKLS  608
            +SLMSKLN + + GH L VE LDDG CD LL  +    +LD     +   +V  N  K  
Sbjct  582  VSLMSKLNCKAVVGHPLTVEALDDGHCDDLLSRS----ELDLQKIVESSHLVQSNSWKGK  637

Query  607  FGGRLQPRA-----sstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
              G+ + RA     S  K+SK+KK   LSKK R+LSSLT  ++   +  P V++ +G  +
Sbjct  638  TLGKHRGRAVKLRPSQGKASKAKKSGQLSKKTRKLSSLTVQKQFVDDSRPVVEKFKGSFV  697

Query  442  ACVPLKVVFSRIKAALNSSI  383
            AC+PLKVVFSRI  A+N  I
Sbjct  698  ACIPLKVVFSRINEAVNGPI  717



>ref|XP_011015418.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=779

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 87/151 (58%), Gaps = 24/151 (16%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L +E L DG+ D LL S        ++     V  +   KL + 
Sbjct  631  VSLMSKLNGKAIVGHPLTIEHLQDGYSDLLLGS--------NEGDTVHVAEIEIPKLGYA  682

Query  601  -------GR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
                   GR       ++P +S +KS K +K  +LSKK+R+LSSLTG + ++R+    V+
Sbjct  683  AMRNLEAGRIPARHMTMKPLSSPSKSHKLRKCGLLSKKIRKLSSLTGKKVEDRK--LVVE  740

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIRPAH  371
            + +GP + C+PLK+VFSRI  A+N S R  H
Sbjct  741  KSKGPAVTCIPLKLVFSRINEAVNGSARHTH  771



>ref|XP_011011986.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=779

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 87/151 (58%), Gaps = 24/151 (16%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L +E L DG+ D LL S        ++     V  +   KL + 
Sbjct  631  VSLMSKLNGKAIVGHPLTIEHLQDGYSDLLLGS--------NEGDTVHVAEIEIPKLGYA  682

Query  601  -------GR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
                   GR       ++P +S +KS K +K  +LSKK+R+LSSLTG + ++R+    V+
Sbjct  683  AMRNLEAGRIPARHMTMKPLSSPSKSHKLRKCGLLSKKIRKLSSLTGKKVEDRK--LVVE  740

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIRPAH  371
            + +GP + C+PLK+VFSRI  A+N S R  H
Sbjct  741  KSKGPAVTCIPLKLVFSRINEAVNGSARHTH  771



>ref|XP_010911968.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
 ref|XP_010911976.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
Length=824

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 30/153 (20%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+PI GH ++VE L+DG    L+     C           +D   K ++S  
Sbjct  676  VSLMSKLNGKPIVGHPISVEALEDGAAVALVTRNGRC------PITSNIDRSLKNRISMI  729

Query  601  GRLQPRAsstksskskkesmls-----------------------kKVRRLSSLTGPRK-  494
             +LQPR   T+S+ + +    +                       +K+RRLSS+   +K 
Sbjct  730  DKLQPREYKTQSNLNIQGKKANHIKVKSPSMKKKSSKNKKSGFSPRKIRRLSSIAVDQKY  789

Query  493  QNREKNPTVQQLRGPTIACVPLKVVFSRIKAAL  395
            +  E+ P V++++GP +ACVPL++VFSRI  AL
Sbjct  790  KQEERKPMVEKIKGPAVACVPLRLVFSRINEAL  822



>gb|KJB56861.1| hypothetical protein B456_009G139300 [Gossypium raimondii]
 gb|KJB56862.1| hypothetical protein B456_009G139300 [Gossypium raimondii]
 gb|KJB56864.1| hypothetical protein B456_009G139300 [Gossypium raimondii]
Length=790

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 80/149 (54%), Gaps = 21/149 (14%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL---  611
            +SLMSKLNG+ I GH L V+VL D     L   AS           KG +      L   
Sbjct  645  VSLMSKLNGKAIIGHPLMVKVLSDDHYGNLTCEAS----------IKGTEKSEIGHLVKR  694

Query  610  -SFGGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLR  455
             S GGR       LQ      KS+K+KK  +LSKK R+LSSLTG +    ++ P   + +
Sbjct  695  KSGGGRVPRKHMKLQSHFPPRKSTKAKKSGLLSKKTRKLSSLTGQKIGVGDRKPVTGKPK  754

Query  454  GPTIACVPLKVVFSRIKAALNSSIRPAHR  368
            GP IACVP+K+VFSRI  A+N S R  HR
Sbjct  755  GPVIACVPIKLVFSRINEAVNGSARLTHR  783



>gb|KJB56863.1| hypothetical protein B456_009G139300 [Gossypium raimondii]
Length=640

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 80/149 (54%), Gaps = 21/149 (14%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL---  611
            +SLMSKLNG+ I GH L V+VL D     L   AS           KG +      L   
Sbjct  495  VSLMSKLNGKAIIGHPLMVKVLSDDHYGNLTCEAS----------IKGTEKSEIGHLVKR  544

Query  610  -SFGGR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLR  455
             S GGR       LQ      KS+K+KK  +LSKK R+LSSLTG +    ++ P   + +
Sbjct  545  KSGGGRVPRKHMKLQSHFPPRKSTKAKKSGLLSKKTRKLSSLTGQKIGVGDRKPVTGKPK  604

Query  454  GPTIACVPLKVVFSRIKAALNSSIRPAHR  368
            GP IACVP+K+VFSRI  A+N S R  HR
Sbjct  605  GPVIACVPIKLVFSRINEAVNGSARLTHR  633



>ref|XP_010545639.1| PREDICTED: uncharacterized protein At1g51745-like [Tarenaya hassleriana]
Length=717

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 75/143 (52%), Gaps = 9/143 (6%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQL-LVSASNCHDL-----DDDSAPKGVDMVNK  620
            +SLMSKLNG+ I GH L+VE L+DG CD   +V A +   +     DDD+        +K
Sbjct  567  VSLMSKLNGKAIVGHPLSVEPLEDGSCDHHHIVRAFDDVPMVDGGDDDDAHVNPKPSSSK  626

Query  619  TKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIA  440
             K      + PR  S     S          RRLS+LTG + + R K    ++ +G  +A
Sbjct  627  KKKKKKTNMPPRKPSKSKKPSSSLLKK---TRRLSALTGHKPRGRGKKEMEEKPKGQVVA  683

Query  439  CVPLKVVFSRIKAALNSSIRPAH  371
            C+PLK+VFSRI  A+ SS R  H
Sbjct  684  CIPLKLVFSRINEAVKSSTRQMH  706



>gb|KHG19697.1| hypothetical protein F383_24275 [Gossypium arboreum]
Length=791

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH L V+VL D     L      C      +    +  + K K S G
Sbjct  646  VSLMSKLNGKAIIGHPLMVKVLSDDHYGNL-----TCEAPIKGTEKSEIGHLVKRK-SAG  699

Query  601  GR-------LQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTI  443
            GR       LQ      KS+K+KK  +LSKK R+LSSLTG +    ++ P   + +GP I
Sbjct  700  GRVPRKHMKLQSHFPPRKSTKAKKSGLLSKKTRKLSSLTGQKIGVGDRKPVTGKPKGPVI  759

Query  442  ACVPLKVVFSRIKAALNSSIRPAHR  368
            ACVP+K+VFSRI  A+N S R  HR
Sbjct  760  ACVPIKLVFSRINEAVNGSARLTHR  784



>ref|XP_008797875.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=830

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 83/161 (52%), Gaps = 30/161 (19%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SLMSKLNG+ I GH ++VEVL DG     +     C                + ++S  
Sbjct  674  VSLMSKLNGKAIVGHPISVEVLQDGATVAPVTRNEWC------PITSNTGQSVRNRISGM  727

Query  601  GRLQPRAsstksskskkesmls-----------------------kKVRRLSSLTGPRK-  494
            G+LQP+  +T+S  + +    +                       +K+RRLSS+   +K 
Sbjct  728  GKLQPKEHTTQSHCNIQGKKTNHIKVKSPVMKKKSSKNKKSGFSPRKIRRLSSIAVDQKY  787

Query  493  QNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAH  371
            +  E+ P V++++GP +ACVPL++VFSRI  AL+ S RPA+
Sbjct  788  KQEERKPMVEKIKGPAVACVPLRLVFSRINEALSCSGRPAN  828



>ref|XP_009410801.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
Length=807

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 76/156 (49%), Gaps = 35/156 (22%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDD------DSAPK-------  641
            ISLMSK N + I GH + +EV++DG  D LL +      L D       S PK       
Sbjct  660  ISLMSKSNSKEIVGHPVPIEVVEDGLVDTLLTTRHIDQSLKDGGNSIGKSLPKRKSAQMY  719

Query  640  --------GVDMVNKTKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQ-N  488
                     V  V   K  +    +PR             +  +K+RRLSS+   +K+  
Sbjct  720  LNVVGINCEVTNVTSLKRKYSKNRKPR-------------LSPRKIRRLSSINVDQKEKG  766

Query  487  REKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  380
             E+ P V+++ GP +ACVPL++VFSRI  AL+SS R
Sbjct  767  EERKPVVEKMVGPAVACVPLRLVFSRITEALSSSTR  802



>ref|XP_007043473.1| Tudor/PWWP/MBT superfamily protein [Theobroma cacao]
 gb|EOX99304.1| Tudor/PWWP/MBT superfamily protein [Theobroma cacao]
Length=264

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 71/138 (51%), Gaps = 10/138 (7%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS-NCHDLD---DDSAPKGVDMVNKTK  614
            +SLMSKLNG+ I GH L V+VL D +   L   A+  C ++      ++  G   V  T 
Sbjct  119  VSLMSKLNGKAIIGHPLTVQVLSDDYYGSLPCEAAVECTEIGPAVKRNSEGG--RVPTTH  176

Query  613  LSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACV  434
            +    R  PR S+               +R+LSSLTG +    ++   V++ +GP  ACV
Sbjct  177  MRLHSRFPPRKSAKAKKSGLLSEK----IRKLSSLTGQKLGLADRKLVVEKPKGPVRACV  232

Query  433  PLKVVFSRIKAALNSSIR  380
             LK+VFSRI  ALN S R
Sbjct  233  LLKLVFSRIDEALNGSAR  250



>ref|XP_010500760.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
Length=644

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 73/144 (51%), Gaps = 17/144 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSF  605
            +S MS+LNG+ I GH + VE+L++G+C+ +++S                 +V KTK LS 
Sbjct  513  VSRMSELNGKAIVGHPITVEILEEGYCNGVVMSQ----------------VVVKTKSLSK  556

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  425
                + ++     +  KK S  S K RRLS+LT  R   + K     + +   +AC+PLK
Sbjct  557  KNGKKRKSRGASWNTKKKSSSQSIKTRRLSTLTSQRLTEKIKKQATGKAKETVVACIPLK  616

Query  424  VVFSRIKAALNSSIRPAHRLIAPS  353
            VVFSRI   L  S R       PS
Sbjct  617  VVFSRINQVLKGSARQTQHRALPS  640



>ref|XP_010500759.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
Length=645

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 73/144 (51%), Gaps = 17/144 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSF  605
            +S MS+LNG+ I GH + VE+L++G+C+ +++S                 +V KTK LS 
Sbjct  514  VSRMSELNGKAIVGHPITVEILEEGYCNGVVMSQ----------------VVVKTKSLSK  557

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  425
                + ++     +  KK S  S K RRLS+LT  R   + K     + +   +AC+PLK
Sbjct  558  KNGKKRKSRGASWNTKKKSSSQSIKTRRLSTLTSQRLTEKIKKQATGKAKETVVACIPLK  617

Query  424  VVFSRIKAALNSSIRPAHRLIAPS  353
            VVFSRI   L  S R       PS
Sbjct  618  VVFSRINQVLKGSARQTQHRALPS  641



>ref|XP_006304889.1| hypothetical protein CARUB_v10012660mg [Capsella rubella]
 gb|EOA37787.1| hypothetical protein CARUB_v10012660mg [Capsella rubella]
Length=643

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 72/144 (50%), Gaps = 17/144 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSF  605
            +S MS+LNG+ I GH L VE+L++ +C+ +++S                 +V KTK L  
Sbjct  512  VSRMSELNGKAIVGHPLTVEILEEDYCNGVVMSQ----------------VVVKTKSLPK  555

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  425
                + ++        KK S LS K RRLSSLT  R   R K  T  + +   +AC+PLK
Sbjct  556  KNGKKRKSRGACWKPKKKSSSLSIKTRRLSSLTSQRLTERSKKHTTGKAKQTVVACIPLK  615

Query  424  VVFSRIKAALNSSIRPAHRLIAPS  353
            VVFSRI   L  S R       PS
Sbjct  616  VVFSRINEVLKGSARQTQHRALPS  639



>ref|XP_006392999.1| hypothetical protein EUTSA_v10011307mg [Eutrema salsugineum]
 gb|ESQ30285.1| hypothetical protein EUTSA_v10011307mg [Eutrema salsugineum]
Length=643

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 72/143 (50%), Gaps = 12/143 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +S MS+LNG+ I GH L VEVL++G+C+ + +S               V+    +K    
Sbjct  509  VSRMSELNGKAIVGHPLTVEVLEEGYCNGMGMSQV------------IVNAKLLSKKKSK  556

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKV  422
             R    A    S  +KK S L KK RRLS+LT  R   R K  T ++ +   +AC+PLKV
Sbjct  557  KRKSHGALRKASKSNKKSSSLLKKTRRLSTLTSQRLTERSKKQTTEKAKETVVACIPLKV  616

Query  421  VFSRIKAALNSSIRPAHRLIAPS  353
            VFSRI   L  S R       PS
Sbjct  617  VFSRINQVLKGSARQTQHRALPS  639



>emb|CBI35984.3| unnamed protein product [Vitis vinifera]
Length=238

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  496  KQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPS  353
            K++ E+ P V +L+GP IAC+PLK+VFSR+  A+NSS RPAH  + PS
Sbjct  189  KRDEERKPVVDKLKGPAIACIPLKLVFSRLNEAVNSSARPAHHALTPS  236



>ref|NP_001043335.1| Os01g0558500 [Oryza sativa Japonica Group]
 dbj|BAB85386.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC00676.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05249.1| Os01g0558500 [Oryza sativa Japonica Group]
 gb|EAY74529.1| hypothetical protein OsI_02419 [Oryza sativa Indica Group]
Length=774

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (51%), Gaps = 14/148 (9%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFC----DQLLVSASNCHDLDDDSAPKGVDMVNKTK  614
            +SLMSK NG+PI G+ + VEVL D       + L  + S+ ++L   S P        + 
Sbjct  622  VSLMSKWNGKPIVGYPITVEVLKDSSSAASRNDLRPATSSLNNLLKRSEPAEPRQARSSH  681

Query  613  LSF-GGRLQPRAsstkssk---------skkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
             S    R +P      S           +KK +   +K+RRLSS    R+    + P V 
Sbjct  682  SSRPASRPKPSGKKKISEHDTDKSRRPHTKKSATSPRKMRRLSSFASSRRDGASRKPVVG  741

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIR  380
            ++ GPTIAC+PL++VFSRI  AL+  +R
Sbjct  742  KISGPTIACIPLRLVFSRINEALSFPVR  769



>gb|EEE54805.1| hypothetical protein OsJ_02221 [Oryza sativa Japonica Group]
Length=731

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (51%), Gaps = 14/148 (9%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFC----DQLLVSASNCHDLDDDSAPKGVDMVNKTK  614
            +SLMSK NG+PI G+ + VEVL D       + L  + S+ ++L   S P        + 
Sbjct  579  VSLMSKWNGKPIVGYPITVEVLKDSSSAASRNDLRPATSSLNNLLKRSEPAEPRQARSSH  638

Query  613  LSF-GGRLQPRAsstkssk---------skkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
             S    R +P      S           +KK +   +K+RRLSS    R+    + P V 
Sbjct  639  SSRPASRPKPSGKKKISEHDTDKSRRPHTKKSATSPRKMRRLSSFASSRRDGASRKPVVG  698

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIR  380
            ++ GPTIAC+PL++VFSRI  AL+  +R
Sbjct  699  KISGPTIACIPLRLVFSRINEALSFPVR  726



>ref|XP_006646000.1| PREDICTED: uncharacterized protein At1g51745-like, partial [Oryza 
brachyantha]
Length=724

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 75/158 (47%), Gaps = 33/158 (21%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDD---GFCDQLLVSASNCHDLDDDSA------------  647
            +SLMSK NG+PI G+ + VEVL+D      D L  + S+ + L   S             
Sbjct  573  VSLMSKWNGKPIVGYPVPVEVLEDSSRASQDDLHPATSSLNHLLKRSEPTEPRQARSSHS  632

Query  646  --------PKGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQ  491
                    P G   ++   +    R   +          K +   +K+RRLSS    R+ 
Sbjct  633  SRSASRPKPSGKKKISDHDMDKSWRPHTK----------KSASSPRKMRRLSSFASSRRD  682

Query  490  NREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRP  377
            +  + P V ++ GPTIAC+PL++VFSRI  AL+  +RP
Sbjct  683  STSRKPVVGKIGGPTIACIPLRLVFSRINEALSFPVRP  720



>ref|XP_006406288.1| hypothetical protein EUTSA_v10020246mg [Eutrema salsugineum]
 gb|ESQ47741.1| hypothetical protein EUTSA_v10020246mg [Eutrema salsugineum]
Length=655

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 80/143 (56%), Gaps = 8/143 (6%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAP--KGVDMVNKTKLS  608
            ISL SKLNG+ I GH L VEVL DG CD++L     C  +   + P   GV     T   
Sbjct  511  ISLRSKLNGEAIVGHPLTVEVLQDGSCDRIL-----CSHIKSLAVPMVDGVVKPKPTWKK  565

Query  607  FGGRLQPRAsstksskskkesmlskKVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVP  431
               + +P     KSSKSKK S LSKK R LS+L+G +   +  K   +++ +   +AC+P
Sbjct  566  KSKKKKPNIPPHKSSKSKKPSALSKKTRCLSALSGQKLTVSSNKKVMIEKTKERIVACIP  625

Query  430  LKVVFSRIKAALNSSIRPAHRLI  362
            LKVVFSRI  A+  S R  HR +
Sbjct  626  LKVVFSRINEAVKGSARQVHRAL  648



>emb|CDY33863.1| BnaC06g04900D [Brassica napus]
Length=911

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 73/146 (50%), Gaps = 22/146 (15%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSAS---NCHDLDDDSAPKGVDMVNKTKL  611
            +S MSKLNG+ I GH ++VE L++G+ +  +V +        L +    K      KT  
Sbjct  781  VSRMSKLNGKAIVGHPVSVEALEEGYYNGGVVKSQAVVKAKSLSEKKCKK-----RKTNG  835

Query  610  SFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVP  431
            +FG           S   KK S LS K RRLS+LT      R K  T+++L+   +AC+P
Sbjct  836  AFG---------KSSKSKKKSSSLSVKTRRLSTLT-----ERSKKQTIEKLKETVVACIP  881

Query  430  LKVVFSRIKAALNSSIRPAHRLIAPS  353
            LKVVFSRI   L  S R       PS
Sbjct  882  LKVVFSRINQVLKGSARQTQHRALPS  907



>gb|AFW83010.1| hypothetical protein ZEAMMB73_581703 [Zea mays]
Length=618

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 77/153 (50%), Gaps = 27/153 (18%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDD--------------GFCDQLLVSASNCHDLDDDSAP  644
            ISLMSK  G+PI G+ + +EVL D              G  D LL S          S P
Sbjct  469  ISLMSKWTGKPIVGYPVTLEVLKDSRHTTSRDEHRPVMGSLDSLLKSRV--------SEP  520

Query  643  KGVDMVNKTKLSFGGRLQPRAss-----tksskskkesmlskKVRRLSSLTGPRKQNREK  479
            +     + ++  F    + +A+      +    +KK +   +K+RRLSS  G R+++ ++
Sbjct  521  RQARSSHASRSKFKSSGRKKATEHDLDRSWWPHTKKPASSPRKMRRLSSFAGSRRESADQ  580

Query  478  NPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  380
             P V +  GP +ACVPL++VFSRI  AL+  +R
Sbjct  581  KPVVAKTGGPAVACVPLRLVFSRINEALSFPLR  613



>ref|XP_008657775.1| PREDICTED: uncharacterized protein At1g51745-like, partial [Zea 
mays]
Length=682

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 77/153 (50%), Gaps = 27/153 (18%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDD--------------GFCDQLLVSASNCHDLDDDSAP  644
            ISLMSK  G+PI G+ + +EVL D              G  D LL S          S P
Sbjct  533  ISLMSKWTGKPIVGYPVTLEVLKDSRHTTSRDEHRPVMGSLDSLLKSRV--------SEP  584

Query  643  KGVDMVNKTKLSFGGRLQPRAss-----tksskskkesmlskKVRRLSSLTGPRKQNREK  479
            +     + ++  F    + +A+      +    +KK +   +K+RRLSS  G R+++ ++
Sbjct  585  RQARSSHASRSKFKSSGRKKATEHDLDRSWWPHTKKPASSPRKMRRLSSFAGSRRESADQ  644

Query  478  NPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  380
             P V +  GP +ACVPL++VFSRI  AL+  +R
Sbjct  645  KPVVAKTGGPAVACVPLRLVFSRINEALSFPLR  677



>ref|XP_006297135.1| hypothetical protein CARUB_v10013137mg [Capsella rubella]
 gb|EOA30033.1| hypothetical protein CARUB_v10013137mg [Capsella rubella]
Length=669

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 77/139 (55%), Gaps = 5/139 (4%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            ISL SKLNG+ I GH   VEVL+DG CD+++ S  +   +  D   K      K      
Sbjct  527  ISLRSKLNGEAIVGHPSTVEVLEDGSCDRIVSSHLDPFAVPMDDDEKPKPSSKKKGKKKK  586

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLK  425
              + P     KSSKSKK S LS K R LS+L+G +   + +K   +++ +   +AC+PLK
Sbjct  587  SHIPP----YKSSKSKKSSSLSIKTRCLSTLSGQKLTASSKKKMMIEKTKDRIVACIPLK  642

Query  424  VVFSRIKAALNSSIRPAHR  368
            VVFSRI  AL  S R  HR
Sbjct  643  VVFSRINEALKGSTRQVHR  661



>ref|XP_010510070.1| PREDICTED: uncharacterized protein At1g51745 [Camelina sativa]
Length=650

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 81/150 (54%), Gaps = 16/150 (11%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            ISL SKLNG+ I GH   VEVL+DG CD ++ S  N         P GV MV+  K    
Sbjct  508  ISLRSKLNGEAIVGHPSTVEVLEDGSCDLIVSSHLN---------PLGVPMVDDAKPKPS  558

Query  601  GRLQPRAss-----tksskskkesmlskKVRRLSSLTGPR-KQNREKNPTVQQLRGPTIA  440
             + + +         KSSKS K   LS K R LS+L+G +   + +K   +++ +   +A
Sbjct  559  SKKKAKKKKSHFPPYKSSKSNKSLSLSIKTRCLSTLSGQKLTVSCKKKVMIEKTKERVVA  618

Query  439  CVPLKVVFSRIKAALNSSIRPAHRLIAPSI  350
            C+PLKV FSRI  AL  S R  HR + PS+
Sbjct  619  CIPLKVAFSRINEALKGSTRQVHRAL-PSV  647



>dbj|BAJ91774.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 12/145 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFC------DQLLVSASNCHDL--DDDSAPKGVDMV  626
            +SL SK N +P+ G  + V VLDD  C      +Q L   S  H L   + + P+     
Sbjct  621  VSLTSKWNRKPVMGFPVPVVVLDDS-CHVESRDNQHLAKNSLTHLLKRSEVAEPRQPRSS  679

Query  625  NKTKLSFGGRLQPRAsstkssk---skkesmlskKVRRLSSLTGPRKQNREKNPTVQQLR  455
            + +K   GGR +        S    +KK +   +K+RRLSS    R+++  KN  VQ++ 
Sbjct  680  HASKSKLGGRKKVSEHDMDKSWRPHTKKSASSPRKMRRLSSFGSSRRESTNKNTVVQKIG  739

Query  454  GPTIACVPLKVVFSRIKAALNSSIR  380
             PTIAC+P+++VFSRI  AL+  +R
Sbjct  740  RPTIACIPVRLVFSRINEALSFQVR  764



>ref|NP_001078195.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76489.1| uncharacterized protein AT3G21295 [Arabidopsis thaliana]
Length=645

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 75/139 (54%), Gaps = 13/139 (9%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            ISL SKLNG+ I GH   VEVL+DG C  ++ S    H +DD          +K K    
Sbjct  510  ISLRSKLNGEAIVGHPSVVEVLEDGSCGHIVSS----HRIDDAKPKPSSKKKSKKKKPH-  564

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPLK  425
                P+A     SKSKK S L+ K R LS+L+G +   + +K   ++  +   +AC+PLK
Sbjct  565  --FPPQA-----SKSKKSSSLAIKTRCLSALSGQKLTLSSKKKVMIESTKERIVACIPLK  617

Query  424  VVFSRIKAALNSSIRPAHR  368
            VVFSRI  A+  S R  HR
Sbjct  618  VVFSRINEAVKGSARQVHR  636



>gb|EMT19851.1| hypothetical protein F775_09638 [Aegilops tauschii]
Length=740

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 76/148 (51%), Gaps = 18/148 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDS-----------APKGV  635
            +SL SK N +P+ G  + V VLDD       V + + H L  +S            P+  
Sbjct  592  VSLTSKWNRKPVMGFPVPVVVLDD----SCPVESRDNHHLAKNSLTNLLKRSEVAEPRQP  647

Query  634  DMVNKTKLSFGGRLQPRAsstkssk---skkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
               + +K   GGR +        S    +KK +   +K+RRLSS    R+++  +N  V+
Sbjct  648  RSAHSSKSKLGGRKKVSEHDIDKSWRPHTKKSASSPRKMRRLSSFGSSRRESSNRNTVVR  707

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIR  380
            ++ GPTIAC+P+++VFSRI  AL+  +R
Sbjct  708  KIGGPTIACIPVRLVFSRINEALSFHVR  735



>ref|XP_002455796.1| hypothetical protein SORBIDRAFT_03g025340 [Sorghum bicolor]
 gb|EES00916.1| hypothetical protein SORBIDRAFT_03g025340 [Sorghum bicolor]
Length=737

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 72/155 (46%), Gaps = 31/155 (20%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDD--------------GFCDQLLVS-------ASNCHD  665
            +SLMSK  G+PI G+ + VEVL+D              G  D LL S       A + H 
Sbjct  588  VSLMSKWTGKPIVGYPVTVEVLEDSCPITSRDEHHPVKGSLDSLLKSKVAEPRQARSSHA  647

Query  664  LDDDSAPKGVDMVNKTKLSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNR  485
                S   G    ++  L    R   +            +   +K+RRLSS  G R++  
Sbjct  648  PRSKSKSSGRKKASEHDLDKSWRPHTKK----------PASSPRKMRRLSSFAGSRRECA  697

Query  484  EKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  380
            ++ P V +  GP +ACVPL++VFSRI  AL+  +R
Sbjct  698  DQKPVVAKTGGPAVACVPLRLVFSRINEALSFPLR  732



>ref|XP_010535212.1| PREDICTED: uncharacterized protein At1g51745 [Tarenaya hassleriana]
Length=660

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 81/165 (49%), Gaps = 37/165 (22%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL SKLNG+ I G+ LAVEVL DG       S+SN    DD      V MV+   +   
Sbjct  507  VSLRSKLNGKAIVGNPLAVEVLGDG-------SSSNIRAFDD------VPMVDDAVM---  550

Query  601  GRLQPRA---------------------sstksskskkesmlskKVRRLSSLTGPRKQNR  485
            G+L                         +   SSKSKK S LSKK RRLS+LTG +   R
Sbjct  551  GQLVKPKSSSSKRKSVKKKKKKKKPHIPTRKSSSKSKKTSSLSKKTRRLSALTGHKPGER  610

Query  484  EKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIRPAHRLIAPSI  350
             K    ++ +   +AC+PLKVVFSRI  A+  S R  H    PSI
Sbjct  611  GKKVMAEKPKEQVVACIPLKVVFSRINEAVKGSTRQLHHRPLPSI  655



>gb|KJB35000.1| hypothetical protein B456_006G096200 [Gossypium raimondii]
Length=657

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 20/141 (14%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH--DLDDDSAPKGVDMVNKTKLS  608
            +SL+SK+NG+ + GH L VEV           S+ +C+  DL  + A +  ++ +  K +
Sbjct  520  VSLVSKVNGKALIGHPLTVEV-----------SSDDCYYGDLTHEVAIECTEVGHLVKQN  568

Query  607  FGG-------RLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGP  449
             GG       +++ R    KS+K KK  + SKK R+LSSLTGP+    +     ++ +G 
Sbjct  569  PGGLISTRNMKMESRFPPRKSAKVKKTGLSSKKTRKLSSLTGPKPGVDDWKLVTEKFKGH  628

Query  448  TIACVPLKVVFSRIKAALNSS  386
             IACV +K+ FSRI  ALN+S
Sbjct  629  EIACVAVKLAFSRINEALNNS  649



>gb|KJB35001.1| hypothetical protein B456_006G096200 [Gossypium raimondii]
 gb|KJB35002.1| hypothetical protein B456_006G096200 [Gossypium raimondii]
Length=630

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 20/141 (14%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH--DLDDDSAPKGVDMVNKTKLS  608
            +SL+SK+NG+ + GH L VEV           S+ +C+  DL  + A +  ++ +  K +
Sbjct  493  VSLVSKVNGKALIGHPLTVEV-----------SSDDCYYGDLTHEVAIECTEVGHLVKQN  541

Query  607  FGG-------RLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGP  449
             GG       +++ R    KS+K KK  + SKK R+LSSLTGP+    +     ++ +G 
Sbjct  542  PGGLISTRNMKMESRFPPRKSAKVKKTGLSSKKTRKLSSLTGPKPGVDDWKLVTEKFKGH  601

Query  448  TIACVPLKVVFSRIKAALNSS  386
             IACV +K+ FSRI  ALN+S
Sbjct  602  EIACVAVKLAFSRINEALNNS  622



>ref|XP_003569211.1| PREDICTED: uncharacterized protein LOC100833692 [Brachypodium 
distachyon]
Length=760

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 77/154 (50%), Gaps = 29/154 (19%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +SL S+ NG+PI G  + V+VLDD  C      A+   D+D  +      ++  +K++  
Sbjct  598  VSLDSEWNGKPIVGLPVTVKVLDDS-C------AAESRDVDHPATSSLNHLLKGSKVA--  648

Query  601  GRLQPRAsstkss--------------------kskkesmlskKVRRLSSLTGPRKQNRE  482
               QPR+S    S                      +  +   KK+RRLSS    R++ + 
Sbjct  649  EPRQPRSSHASRSKHSGRKKISERDTDKSWRPHTKQSTTSSPKKMRRLSSFASSRRERKN  708

Query  481  KNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  380
            + P + ++ GPTIAC+PL++VFSRI  AL+  +R
Sbjct  709  RKPVLGKIGGPTIACIPLRLVFSRINEALSFPVR  742



>emb|CDY22868.1| BnaA06g02090D [Brassica napus]
Length=909

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 73/143 (51%), Gaps = 17/143 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +S MSKLNG+ I GH ++VE L++ + + +++S +    +   S  K      KT   FG
Sbjct  780  VSRMSKLNGKAIVGHPVSVEALEESYYNGMVMSQAV---VKAKSLSKKKSNKRKTTGPFG  836

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKV  422
                       S   KK S LS K RRLS+LT      R K  T+++L+   +AC+PLKV
Sbjct  837  ---------KSSKSKKKSSSLSVKTRRLSTLT-----ERSKKQTIEKLKETVVACIPLKV  882

Query  421  VFSRIKAALNSSIRPAHRLIAPS  353
            VFSRI   L  S R       PS
Sbjct  883  VFSRINQVLKGSARQTQHRALPS  905



>ref|XP_009147732.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
Length=607

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 73/143 (51%), Gaps = 17/143 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            +S MSKLNG+ I GH ++VE L++ + + +++S +    +   S  K      KT   FG
Sbjct  478  VSRMSKLNGKAIVGHPVSVEALEESYYNGMVMSQA---VVKAKSLSKKKSNKRKTTGPFG  534

Query  601  GRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKV  422
                       S   KK S LS K RRLS+LT      R K  T+++L+   +AC+PLKV
Sbjct  535  ---------KSSKSKKKSSSLSVKTRRLSTLT-----ERSKKQTIEKLKETVVACIPLKV  580

Query  421  VFSRIKAALNSSIRPAHRLIAPS  353
            VFSRI   L  S R       PS
Sbjct  581  VFSRINQVLKGSARQTQHRALPS  603



>ref|XP_004968966.1| PREDICTED: uncharacterized protein At1g51745-like [Setaria italica]
Length=717

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  529  VRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLKVVFSRIKAALNSSIR  380
            +RRLSS  G R+++ ++ P V +  GPT+ACVPL++VFSRI  AL+ S+R
Sbjct  663  MRRLSSFAGSRRESGDRKPVVVKTGGPTVACVPLRLVFSRINEALSFSVR  712



>pir||D96556 hypothetical protein F19C24.5 [imported] - Arabidopsis thaliana
 gb|AAG50888.1|AC025294_26 hypothetical protein [Arabidopsis thaliana]
Length=896

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 72/144 (50%), Gaps = 17/144 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTK-LSF  605
            +S MS+L+G+ I GH L+VE+L++ + + +++                  +V K K L  
Sbjct  765  VSRMSELSGKAIVGHPLSVEILEEDYSNGMVMPP----------------VVAKAKSLPK  808

Query  604  GGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVPLK  425
                + ++     +  KK S LS K RRLS+LT  R   R K  T ++ +   +AC+PLK
Sbjct  809  KNGKKKKSRGFSWNSKKKSSSLSVKTRRLSTLTSQRLTERSKKQTTEKAKETVVACIPLK  868

Query  424  VVFSRIKAALNSSIRPAHRLIAPS  353
            VVFSRI   L  S R       PS
Sbjct  869  VVFSRINEVLKGSARQTQHRALPS  892



>ref|XP_009144882.1| PREDICTED: uncharacterized protein At1g51745 [Brassica rapa]
Length=534

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 19/148 (13%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVL-DDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL--  611
            +S MS+LNG+ I GH ++VE L ++G+C+  L+S                D+V    L  
Sbjct  400  VSRMSELNGKAIVGHPVSVEALKEEGYCNGKLMSQ---------------DVVKAKPLLS  444

Query  610  SFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVP  431
                + +   ++   SK K  S +S K+RRLS+LT  +   R K  T  + +   +AC+P
Sbjct  445  EKKSKKRKSQAAFGKSKKKSSSSVSIKIRRLSTLTSQKLTGRSKMQTTGKAKETVVACIP  504

Query  430  LKVVFSRIKAALNSSIRPA-HRLIAPSI  350
            LKVVFSRI   L  S R   HR + PS+
Sbjct  505  LKVVFSRINQVLKGSARQTQHRPLPPSV  532



>emb|CDM83021.1| unnamed protein product [Triticum aestivum]
Length=759

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 75/148 (51%), Gaps = 18/148 (12%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDS-----------APKGV  635
            +SL SK N +P+ G  + V VLDD       V + + H L  +S            P+  
Sbjct  611  VSLTSKWNRKPVMGFPVPVVVLDD----SCPVESRDNHHLAKNSLTHLLKRSEVAEPRQP  666

Query  634  DMVNKTKLSFGGRLQPRAsstkssk---skkesmlskKVRRLSSLTGPRKQNREKNPTVQ  464
               + +K    GR +        S    +KK +   +K+RRLSS    R+++  +N  V+
Sbjct  667  RSSHSSKSKLCGRKKVSEHDMDKSWRPHTKKSASSPRKMRRLSSFGSSRRESANRNTVVR  726

Query  463  QLRGPTIACVPLKVVFSRIKAALNSSIR  380
            ++ GPTIAC+P+++VFSRI  AL+  +R
Sbjct  727  KIGGPTIACIPVRLVFSRINEALSFQVR  754



>gb|KHG25774.1| hypothetical protein F383_10403 [Gossypium arboreum]
Length=656

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 79/146 (54%), Gaps = 20/146 (14%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCH--DLDDDSAPKGVDMVNKTKLS  608
            +SL+SK+NG+ + GH L VEV           S+ +C+  DL  + A +  ++ +  K +
Sbjct  522  VSLVSKVNGKALIGHPLTVEV-----------SSDDCYYGDLTHEVAMECTEVGHLVKQN  570

Query  607  FGG-------RLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGP  449
             GG       +++ R  S KS+K KK  + SKK R+L SL  P+    +     ++ +G 
Sbjct  571  PGGLISTKHMKMESRFPSHKSAKVKKTGLSSKKTRKLISLNCPKPGVDDWKLVTKKFKGH  630

Query  448  TIACVPLKVVFSRIKAALNSSIRPAH  371
             IAC+ +K+ FSRI  ALN+S  P H
Sbjct  631  EIACIAVKLAFSRINEALNNSNTPRH  656



>emb|CDY43925.1| BnaA05g15350D [Brassica napus]
Length=530

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (51%), Gaps = 19/148 (13%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVL-DDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKL--  611
            +S MS+LNG+ I GH ++VE L ++G C+  ++S                D+V    L  
Sbjct  396  VSRMSELNGKAIVGHPVSVEALKEEGCCNGKVMSQ---------------DVVKAKPLLS  440

Query  610  SFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQNREKNPTVQQLRGPTIACVP  431
                + +   ++   SK K  S +S K RRLS+LT  +   R K  T  + +   +AC+P
Sbjct  441  EKKSKKRKSQAAFGKSKKKSSSSVSIKTRRLSTLTSQKLTGRSKMQTTGKAKETVVACIP  500

Query  430  LKVVFSRIKAALNSSIRPA-HRLIAPSI  350
            LKVVFSRI   L  S R   HR + PS+
Sbjct  501  LKVVFSRINQVLKGSARQTQHRPLPPSV  528



>gb|KFK39439.1| hypothetical protein AALP_AA3G245000 [Arabis alpina]
Length=664

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 79/146 (54%), Gaps = 16/146 (11%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDL----DDDSAPKGVDMVNKTK  614
            ISL SKL G+ I GH L VEVL+DG  D ++ S      +    DDD  PK        K
Sbjct  523  ISLRSKLYGEAIVGHPLTVEVLEDGSSDGIVSSHIKSLSVPMVDDDDVKPKPSWKNKSKK  582

Query  613  LSFGGRLQPRAsstksskskkesmlskKVRRLSSLTGPRKQ--NREKNPTVQQLRGPTIA  440
                    P      +SKSKK S LSKK R LS+LTG +    +++K  T +Q+    +A
Sbjct  583  KKP--HFPPH----NTSKSKKSSPLSKKTRCLSALTGQKLTVISKKKVMTKEQV----VA  632

Query  439  CVPLKVVFSRIKAALNSSIRPAHRLI  362
            C+PLK+VFSRI  A+  S R  HR++
Sbjct  633  CIPLKIVFSRINEAVKGSGRQVHRVL  658



>ref|XP_010488139.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
 ref|XP_010488140.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
 ref|XP_010488141.1| PREDICTED: uncharacterized protein At1g51745-like isoform X3 
[Camelina sativa]
Length=643

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 71/131 (54%), Gaps = 11/131 (8%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDLDDDSAPKGVDMVNKTKLSFG  602
            ISL SKLNG+ I GH   VEVL+DG CD ++    N         P GV MV+  K    
Sbjct  520  ISLRSKLNGEAIVGHPSTVEVLEDGSCDLIVSRHLN---------PLGVPMVDDAKPKPS  570

Query  601  GRLQPRAs-stksskskkesmlskKVRRLSSLTGPR-KQNREKNPTVQQLRGPTIACVPL  428
             + +       KSSKS K   LS K R LS+L+G +   + +K   +++ +   +AC+PL
Sbjct  571  SKKKASHFPPYKSSKSNKSLSLSIKTRCLSTLSGQKLTVSCKKKVMIEKTKERVVACIPL  630

Query  427  KVVFSRIKAAL  395
            KV FSRI  AL
Sbjct  631  KVAFSRINEAL  641



>tpg|DAA59003.1| TPA: hypothetical protein ZEAMMB73_224631 [Zea mays]
Length=693

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (50%), Gaps = 19/149 (13%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDL---DDDSAPKG---------  638
            +SL+SK  G+PI G+ + VEVL+    D    ++ N H        S PK          
Sbjct  544  VSLISKWTGKPIVGYPVTVEVLE----DSRPTTSRNEHRPPMGSLGSLPKSRVAEPRQAR  599

Query  637  VDMVNKTKLSFGGRLQPRAsstkssks---kkesmlskKVRRLSSLTGPRKQNREKNPTV  467
                +++K    GR +        S     KK +   +K+RRLSS  G R+++ ++ P V
Sbjct  600  SSPASRSKSKPSGRKKASEHDLDKSWRPHIKKPASSPRKMRRLSSFAGSRRESADQKPVV  659

Query  466  QQLRGPTIACVPLKVVFSRIKAALNSSIR  380
             +  GP +ACVPL++V SRI  AL+  +R
Sbjct  660  VKAGGPAVACVPLRLVLSRINEALSFPLR  688



>ref|XP_008676390.1| PREDICTED: uncharacterized protein At1g51745, partial [Zea mays]
Length=678

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (50%), Gaps = 19/149 (13%)
 Frame = -2

Query  781  ISLMSKLNGQPITGHRLAVEVLDDGFCDQLLVSASNCHDL---DDDSAPKG---------  638
            +SL+SK  G+PI G+ + VEVL+    D    ++ N H        S PK          
Sbjct  529  VSLISKWTGKPIVGYPVTVEVLE----DSRPTTSRNEHRPPMGSLGSLPKSRVAEPRQAR  584

Query  637  VDMVNKTKLSFGGRLQPRAsstkssks---kkesmlskKVRRLSSLTGPRKQNREKNPTV  467
                +++K    GR +        S     KK +   +K+RRLSS  G R+++ ++ P V
Sbjct  585  SSPASRSKSKPSGRKKASEHDLDKSWRPHIKKPASSPRKMRRLSSFAGSRRESADQKPVV  644

Query  466  QQLRGPTIACVPLKVVFSRIKAALNSSIR  380
             +  GP +ACVPL++V SRI  AL+  +R
Sbjct  645  VKAGGPAVACVPLRLVLSRINEALSFPLR  673



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1669417592084