BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12007

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776620.1|  PREDICTED: serine/threonine-protein phosphat...    360   6e-118   Nicotiana sylvestris
ref|XP_009621929.1|  PREDICTED: serine/threonine-protein phosphat...    357   8e-117   
ref|XP_004241625.1|  PREDICTED: serine/threonine-protein phosphat...    354   1e-115   
ref|XP_006354729.1|  PREDICTED: serine/threonine-protein phosphat...    354   1e-115   Solanum tuberosum [potatoes]
ref|XP_003637402.1|  Protein phosphatase 2A regulatory subunit A        343   1e-115   
gb|KDO70006.1|  hypothetical protein CISIN_1g0068982mg                  337   4e-114   Citrus sinensis [apfelsine]
gb|KJB39314.1|  hypothetical protein B456_007G006100                    343   5e-112   Gossypium raimondii
ref|XP_006279157.1|  hypothetical protein CARUB_v100079670mg            335   5e-112   
ref|XP_002276180.1|  PREDICTED: serine/threonine-protein phosphat...    345   8e-112   Vitis vinifera
ref|XP_007036503.1|  Serine/threonine-protein phosphatase 2A 65 k...    339   9e-112   
emb|CDO98444.1|  unnamed protein product                                344   9e-112   Coffea canephora [robusta coffee]
gb|KHG03474.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    344   1e-111   Gossypium arboreum [tree cotton]
ref|XP_010265183.1|  PREDICTED: serine/threonine-protein phosphat...    344   2e-111   Nelumbo nucifera [Indian lotus]
gb|KJB39317.1|  hypothetical protein B456_007G006100                    343   2e-111   Gossypium raimondii
gb|KJB39313.1|  hypothetical protein B456_007G006100                    343   2e-111   Gossypium raimondii
emb|CBI15438.3|  unnamed protein product                                345   2e-111   Vitis vinifera
gb|KEH44250.1|  serine/threonine protein phosphatase 2A regulator...    343   2e-111   Medicago truncatula
gb|EPS62738.1|  hypothetical protein M569_12049                         343   2e-111   Genlisea aurea
gb|KDO39435.1|  hypothetical protein CISIN_1g039154mg                   330   2e-111   Citrus sinensis [apfelsine]
ref|XP_008361732.1|  PREDICTED: serine/threonine-protein phosphat...    343   2e-111   
ref|XP_011077133.1|  PREDICTED: serine/threonine-protein phosphat...    343   4e-111   Sesamum indicum [beniseed]
ref|XP_008339694.1|  PREDICTED: serine/threonine-protein phosphat...    342   5e-111   
ref|XP_010102836.1|  Serine/threonine-protein phosphatase 2A 65 k...    335   5e-111   
ref|XP_009356482.1|  PREDICTED: serine/threonine-protein phosphat...    342   5e-111   Pyrus x bretschneideri [bai li]
emb|CDY69424.1|  BnaAnng30450D                                          340   6e-111   Brassica napus [oilseed rape]
ref|XP_007225550.1|  hypothetical protein PRUPE_ppa003299m2g            342   6e-111   Prunus persica
ref|XP_008446576.1|  PREDICTED: serine/threonine-protein phosphat...    342   7e-111   Cucumis melo [Oriental melon]
ref|XP_008243199.1|  PREDICTED: serine/threonine-protein phosphat...    342   7e-111   Prunus mume [ume]
ref|XP_012082057.1|  PREDICTED: serine/threonine-protein phosphat...    342   1e-110   Jatropha curcas
ref|XP_002312385.1|  hypothetical protein POPTR_0008s11730g             342   1e-110   
ref|XP_002511958.1|  serine/threonine protein phosphatase 2a regu...    342   1e-110   Ricinus communis
ref|XP_010263329.1|  PREDICTED: serine/threonine-protein phosphat...    342   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_007152779.1|  hypothetical protein PHAVU_004G159000g             341   1e-110   Phaseolus vulgaris [French bean]
ref|XP_006854054.1|  PREDICTED: serine/threonine-protein phosphat...    341   1e-110   Amborella trichopoda
ref|XP_004956389.1|  PREDICTED: serine/threonine-protein phosphat...    341   1e-110   Setaria italica
ref|XP_004956390.1|  PREDICTED: serine/threonine-protein phosphat...    341   1e-110   Setaria italica
ref|XP_009388386.1|  PREDICTED: serine/threonine-protein phosphat...    333   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009336593.1|  PREDICTED: serine/threonine-protein phosphat...    341   2e-110   Pyrus x bretschneideri [bai li]
gb|AAG29594.1|AF196287_1  Ser/Thr specific protein phosphatase 2A...    341   2e-110   Medicago sativa subsp. x varia
ref|XP_006583401.1|  PREDICTED: serine/threonine-protein phosphat...    341   2e-110   Glycine max [soybeans]
ref|XP_010094777.1|  hypothetical protein L484_019987                   341   2e-110   
gb|AAG29593.1|AF196286_1  Ser/Thr specific protein phosphatase 2A...    341   2e-110   Medicago sativa subsp. x varia
ref|XP_009152111.1|  PREDICTED: serine/threonine-protein phosphat...    341   2e-110   Brassica rapa
ref|XP_002314877.1|  hypothetical protein POPTR_0010s13760g             341   2e-110   
gb|KDO41973.1|  hypothetical protein CISIN_1g007863mg                   339   3e-110   Citrus sinensis [apfelsine]
gb|KDO41974.1|  hypothetical protein CISIN_1g007863mg                   338   3e-110   Citrus sinensis [apfelsine]
ref|XP_006376763.1|  hypothetical protein POPTR_0012s06210g             334   3e-110   
emb|CDY13586.1|  BnaA06g33370D                                          341   3e-110   Brassica napus [oilseed rape]
gb|KJB52972.1|  hypothetical protein B456_008G286100                    340   3e-110   Gossypium raimondii
ref|XP_010044277.1|  PREDICTED: serine/threonine-protein phosphat...    340   3e-110   Eucalyptus grandis [rose gum]
gb|KJB23733.1|  hypothetical protein B456_004G112500                    337   4e-110   Gossypium raimondii
ref|XP_007036502.1|  Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1     340   4e-110   Theobroma cacao [chocolate]
ref|XP_002529138.1|  serine/threonine protein phosphatase 2a regu...    340   5e-110   Ricinus communis
ref|XP_011008279.1|  PREDICTED: serine/threonine-protein phosphat...    340   5e-110   Populus euphratica
ref|XP_007046273.1|  Phosphatase 2A subunit A2, 65,PP2AA2               340   5e-110   
ref|XP_011070821.1|  PREDICTED: serine/threonine-protein phosphat...    339   7e-110   Sesamum indicum [beniseed]
ref|XP_006485775.1|  PREDICTED: serine/threonine-protein phosphat...    339   7e-110   Citrus sinensis [apfelsine]
ref|XP_004497109.1|  PREDICTED: serine/threonine-protein phosphat...    339   9e-110   Cicer arietinum [garbanzo]
gb|KJB23732.1|  hypothetical protein B456_004G112500                    339   1e-109   Gossypium raimondii
gb|KDO41972.1|  hypothetical protein CISIN_1g007863mg                   339   1e-109   Citrus sinensis [apfelsine]
ref|NP_001062674.1|  Os09g0249700                                       339   1e-109   
ref|XP_004297127.1|  PREDICTED: serine/threonine-protein phosphat...    339   1e-109   Fragaria vesca subsp. vesca
gb|KEH27050.1|  serine/threonine protein phosphatase 2A regulator...    339   1e-109   Medicago truncatula
gb|KJB50734.1|  hypothetical protein B456_008G184500                    339   1e-109   Gossypium raimondii
ref|XP_006484434.1|  PREDICTED: serine/threonine-protein phosphat...    339   1e-109   Citrus sinensis [apfelsine]
ref|XP_006437703.1|  hypothetical protein CICLE_v10031047mg             339   1e-109   Citrus clementina [clementine]
ref|XP_008374745.1|  PREDICTED: serine/threonine-protein phosphat...    339   1e-109   Malus domestica [apple tree]
ref|XP_010681587.1|  PREDICTED: serine/threonine-protein phosphat...    338   1e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007210261.1|  hypothetical protein PRUPE_ppa003291mg             338   2e-109   Prunus persica
gb|KJB23731.1|  hypothetical protein B456_004G112500                    339   2e-109   Gossypium raimondii
gb|KJB23730.1|  hypothetical protein B456_004G112500                    339   2e-109   Gossypium raimondii
ref|XP_010495219.1|  PREDICTED: serine/threonine-protein phosphat...    338   2e-109   Camelina sativa [gold-of-pleasure]
gb|AEQ75494.1|  serine/threonine protein phosphatase 2a regulator...    338   2e-109   Rosa multiflora [Japanese rose]
ref|XP_003555890.1|  PREDICTED: serine/threonine-protein phosphat...    338   2e-109   Glycine max [soybeans]
gb|ACL54598.1|  unknown                                                 338   2e-109   Zea mays [maize]
ref|XP_009347000.1|  PREDICTED: serine/threonine-protein phosphat...    338   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_011021847.1|  PREDICTED: serine/threonine-protein phosphat...    338   2e-109   Populus euphratica
ref|XP_010458784.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    338   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010476329.1|  PREDICTED: serine/threonine-protein phosphat...    338   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_008648330.1|  PREDICTED: LOC732740 isoform X1                    338   3e-109   Zea mays [maize]
ref|XP_002876929.1|  hypothetical protein ARALYDRAFT_904748             338   3e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_008240282.1|  PREDICTED: serine/threonine-protein phosphat...    338   3e-109   Prunus mume [ume]
ref|XP_006297363.1|  hypothetical protein CARUB_v10013383mg             337   4e-109   
ref|XP_010554238.1|  PREDICTED: serine/threonine-protein phosphat...    337   4e-109   Tarenaya hassleriana [spider flower]
ref|NP_001105839.1|  LOC732740                                          337   4e-109   Zea mays [maize]
ref|XP_008350866.1|  PREDICTED: serine/threonine-protein phosphat...    337   5e-109   
ref|XP_004238945.1|  PREDICTED: serine/threonine-protein phosphat...    337   5e-109   Solanum lycopersicum
ref|XP_009606530.1|  PREDICTED: serine/threonine-protein phosphat...    337   5e-109   Nicotiana tomentosiformis
ref|XP_003536691.1|  PREDICTED: serine/threonine-protein phosphat...    337   5e-109   Glycine max [soybeans]
ref|XP_009766514.1|  PREDICTED: serine/threonine-protein phosphat...    337   6e-109   Nicotiana sylvestris
emb|CDP00596.1|  unnamed protein product                                338   6e-109   Coffea canephora [robusta coffee]
ref|XP_006362557.1|  PREDICTED: serine/threonine-protein phosphat...    337   6e-109   Solanum tuberosum [potatoes]
ref|XP_010528048.1|  PREDICTED: serine/threonine-protein phosphat...    337   6e-109   Tarenaya hassleriana [spider flower]
ref|XP_006660451.1|  PREDICTED: serine/threonine-protein phosphat...    337   7e-109   Oryza brachyantha
ref|XP_008659344.1|  PREDICTED: serine/threonine-protein phosphat...    337   8e-109   Zea mays [maize]
ref|XP_008659343.1|  PREDICTED: serine/threonine-protein phosphat...    337   8e-109   
gb|AFW75382.1|  hypothetical protein ZEAMMB73_324274                    338   9e-109   
gb|ERN07361.1|  hypothetical protein AMTR_s00019p00236090               337   9e-109   Amborella trichopoda
ref|XP_006660452.1|  PREDICTED: serine/threonine-protein phosphat...    336   1e-108   Oryza brachyantha
ref|XP_007153361.1|  hypothetical protein PHAVU_003G029000g             337   1e-108   Phaseolus vulgaris [French bean]
ref|XP_006395624.1|  hypothetical protein EUTSA_v10003886mg             337   1e-108   Eutrema salsugineum [saltwater cress]
ref|XP_006307029.1|  hypothetical protein CARUB_v10008615mg             337   1e-108   
ref|XP_009396282.1|  PREDICTED: serine/threonine-protein phosphat...    336   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008659342.1|  PREDICTED: serine/threonine-protein phosphat...    336   2e-108   Zea mays [maize]
ref|XP_012092991.1|  PREDICTED: serine/threonine-protein phosphat...    336   2e-108   Jatropha curcas
gb|KGN52064.1|  hypothetical protein Csa_5G608520                       341   2e-108   Cucumis sativus [cucumbers]
gb|KDP20104.1|  hypothetical protein JCGZ_05873                         335   2e-108   Jatropha curcas
ref|XP_008393303.1|  PREDICTED: serine/threonine-protein phosphat...    335   3e-108   
ref|XP_010942275.1|  PREDICTED: serine/threonine-protein phosphat...    335   3e-108   Elaeis guineensis
ref|XP_010929062.1|  PREDICTED: serine/threonine-protein phosphat...    335   3e-108   Elaeis guineensis
ref|XP_004972370.1|  PREDICTED: serine/threonine-protein phosphat...    335   3e-108   Setaria italica
ref|NP_001030769.1|  protein phosphatase 2A subunit A2                  333   6e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797605.1|  PREDICTED: serine/threonine-protein phosphat...    334   6e-108   Phoenix dactylifera
ref|XP_010458785.1|  PREDICTED: serine/threonine-protein phosphat...    334   8e-108   Camelina sativa [gold-of-pleasure]
gb|AEB40165.1|  protein phosphatase 2A structural subunit               334   9e-108   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010495228.1|  PREDICTED: serine/threonine-protein phosphat...    333   1e-107   Camelina sativa [gold-of-pleasure]
gb|KJB80118.1|  hypothetical protein B456_013G081300                    332   1e-107   Gossypium raimondii
ref|NP_189208.1|  protein phosphatase 2A subunit A2                     333   2e-107   Arabidopsis thaliana [mouse-ear cress]
emb|CAA57528.1|  protein phosphatase 2A 65 kDa regulatory subunit       333   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KJB80117.1|  hypothetical protein B456_013G081300                    333   3e-107   Gossypium raimondii
gb|KJB80114.1|  hypothetical protein B456_013G081300                    333   3e-107   Gossypium raimondii
ref|XP_004512939.1|  PREDICTED: serine/threonine-protein phosphat...    333   3e-107   Cicer arietinum [garbanzo]
ref|XP_011006221.1|  PREDICTED: serine/threonine-protein phosphat...    333   3e-107   Populus euphratica
ref|XP_003534171.1|  PREDICTED: serine/threonine-protein phosphat...    332   4e-107   Glycine max [soybeans]
ref|XP_011623847.1|  PREDICTED: serine/threonine-protein phosphat...    332   4e-107   Amborella trichopoda
gb|EYU40874.1|  hypothetical protein MIMGU_mgv1a003588mg                332   5e-107   Erythranthe guttata [common monkey flower]
ref|XP_004300534.1|  PREDICTED: serine/threonine-protein phosphat...    332   5e-107   Fragaria vesca subsp. vesca
ref|XP_010677978.1|  PREDICTED: serine/threonine-protein phosphat...    331   1e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010476330.1|  PREDICTED: serine/threonine-protein phosphat...    331   1e-106   Camelina sativa [gold-of-pleasure]
gb|KHG15336.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    331   1e-106   Gossypium arboreum [tree cotton]
ref|XP_010237336.1|  PREDICTED: serine/threonine-protein phosphat...    330   2e-106   Brachypodium distachyon [annual false brome]
ref|XP_003577085.1|  PREDICTED: serine/threonine-protein phosphat...    330   2e-106   Brachypodium distachyon [annual false brome]
ref|XP_002892742.1|  hypothetical protein ARALYDRAFT_888699             330   2e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_003518674.1|  PREDICTED: serine/threonine-protein phosphat...    330   2e-106   Glycine max [soybeans]
gb|KHN27183.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    330   2e-106   Glycine soja [wild soybean]
ref|XP_010551283.1|  PREDICTED: serine/threonine-protein phosphat...    330   3e-106   Tarenaya hassleriana [spider flower]
ref|NP_001150156.1|  LOC100283785                                       328   1e-105   Zea mays [maize]
ref|XP_002282096.2|  PREDICTED: serine/threonine-protein phosphat...    327   4e-105   Vitis vinifera
ref|XP_009415447.1|  PREDICTED: serine/threonine-protein phosphat...    327   6e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577041.1|  PREDICTED: serine/threonine-protein phosphat...    327   7e-105   Brachypodium distachyon [annual false brome]
ref|XP_010237331.1|  PREDICTED: serine/threonine-protein phosphat...    326   8e-105   
emb|CBI27044.3|  unnamed protein product                                327   1e-104   Vitis vinifera
ref|XP_009391301.1|  PREDICTED: serine/threonine-protein phosphat...    326   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN68660.1|  hypothetical protein VITISV_002162                     325   2e-104   Vitis vinifera
ref|XP_010036877.1|  PREDICTED: serine/threonine-protein phosphat...    325   3e-104   Eucalyptus grandis [rose gum]
ref|XP_008783038.1|  PREDICTED: serine/threonine-protein phosphat...    325   3e-104   Phoenix dactylifera
ref|XP_006417131.1|  hypothetical protein EUTSA_v10007164mg             325   3e-104   Eutrema salsugineum [saltwater cress]
ref|XP_006440947.1|  hypothetical protein CICLE_v100194171mg            309   1e-103   
ref|XP_002893420.1|  serine/threonine protein phosphatase type 2A...    323   2e-103   
ref|NP_001031035.1|  protein phosphatase 2A subunit A3                  320   5e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51132.1|  BnaA07g37150D                                          322   6e-103   Brassica napus [oilseed rape]
ref|XP_009103071.1|  PREDICTED: serine/threonine-protein phosphat...    322   7e-103   Brassica rapa
gb|AAG09551.1|AC011810_10  Putative protein phosphotase 2a 65kd r...    321   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172790.2|  protein phosphatase 2A subunit A3                     321   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307078.1|  hypothetical protein CARUB_v10008664mg             320   2e-102   Capsella rubella
ref|XP_010477897.1|  PREDICTED: serine/threonine-protein phosphat...    320   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...    330   2e-102   
ref|XP_010499103.1|  PREDICTED: serine/threonine-protein phosphat...    320   3e-102   Camelina sativa [gold-of-pleasure]
gb|AAB60713.1|  serine/threonine protein phosphatase type 2A regu...    318   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460344.1|  PREDICTED: serine/threonine-protein phosphat...    318   1e-101   Camelina sativa [gold-of-pleasure]
ref|NP_173920.1|  serine/threonine-protein phosphatase 2A regulat...    318   1e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDY36104.1|  BnaA08g19440D                                          318   2e-101   Brassica napus [oilseed rape]
ref|XP_006415878.1|  hypothetical protein EUTSA_v10007162mg             317   3e-101   Eutrema salsugineum [saltwater cress]
ref|XP_001777048.1|  predicted protein                                  316   7e-101   
emb|CAA57527.1|  65 kDa regulatory subunit of protein phosphatase 2A    316   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109883.1|  PREDICTED: serine/threonine-protein phosphat...    315   2e-100   Brassica rapa
ref|XP_002973833.1|  hypothetical protein SELMODRAFT_232183             314   5e-100   
ref|XP_001775815.1|  predicted protein                                  313   8e-100   
ref|XP_001769725.1|  predicted protein                                  310   1e-98    
emb|CDY42101.1|  BnaA09g28590D                                          310   2e-98    Brassica napus [oilseed rape]
emb|CAA66487.1|  protein phosphatase 2A                                 309   3e-98    Nicotiana tabacum [American tobacco]
emb|CDY03849.1|  BnaC07g10740D                                          295   5e-93    
ref|XP_002988290.1|  hypothetical protein SELMODRAFT_447252             285   1e-88    
ref|XP_002963887.1|  hypothetical protein SELMODRAFT_166330             285   1e-88    Selaginella moellendorffii
ref|XP_006367043.1|  PREDICTED: serine/threonine-protein phosphat...    283   3e-88    Solanum tuberosum [potatoes]
ref|XP_010319425.1|  PREDICTED: serine/threonine-protein phosphat...    281   1e-87    Solanum lycopersicum
ref|XP_004236962.1|  PREDICTED: serine/threonine-protein phosphat...    281   2e-87    Solanum lycopersicum
ref|XP_006441864.1|  hypothetical protein CICLE_v10022447mg             261   2e-84    
ref|XP_007142892.1|  hypothetical protein PHAVU_007G0258001g            270   1e-83    Phaseolus vulgaris [French bean]
emb|CDX84993.1|  BnaC05g20620D                                          261   3e-81    
ref|XP_009764796.1|  PREDICTED: serine/threonine-protein phosphat...    254   5e-77    Nicotiana sylvestris
gb|KIY96952.1|  Serine/threonine-protein phosphatase 2A regulator...    247   2e-74    Monoraphidium neglectum
gb|ADV40147.1|  putative protein phosphatase 2A regulatory subunit A    236   4e-73    Latrodectus hesperus [black widow]
ref|XP_008217607.1|  PREDICTED: serine/threonine-protein phosphat...    243   7e-73    
ref|XP_001600229.1|  PREDICTED: serine/threonine-protein phosphat...    243   9e-73    Nasonia vitripennis
emb|CAA10285.1|  protein phosphatase                                    242   9e-73    Cicer arietinum [garbanzo]
ref|XP_009616233.1|  PREDICTED: serine/threonine-protein phosphat...    242   2e-72    Nicotiana tomentosiformis
ref|XP_005644559.1|  ARM repeat-containing protein                      241   9e-72    Coccomyxa subellipsoidea C-169
ref|XP_008479235.1|  PREDICTED: serine/threonine-protein phosphat...    235   2e-71    
ref|XP_011501051.1|  PREDICTED: serine/threonine-protein phosphat...    239   2e-71    Ceratosolen solmsi marchali
ref|XP_011558037.1|  PREDICTED: serine/threonine-protein phosphat...    231   7e-71    Plutella xylostella [cabbage moth]
ref|XP_011266575.1|  PREDICTED: serine/threonine-protein phosphat...    238   1e-70    Camponotus floridanus
gb|EFN73589.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    238   2e-70    Camponotus floridanus
ref|XP_011266584.1|  PREDICTED: serine/threonine-protein phosphat...    237   2e-70    Camponotus floridanus
ref|XP_011144206.1|  PREDICTED: serine/threonine-protein phosphat...    237   2e-70    
gb|KHJ82027.1|  HEAT repeat protein                                     228   2e-70    Oesophagostomum dentatum [nodule worm]
ref|XP_011144205.1|  PREDICTED: serine/threonine-protein phosphat...    237   2e-70    
gb|AFL91512.1|  phosphatase-like protein                                237   2e-70    Panonychus citri [citrus fruit mite]
dbj|BAN21528.1|  serine/threonine protein phosphatase 2a regulato...    233   5e-70    Riptortus pedestris
ref|XP_008479230.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    236   6e-70    
ref|XP_011336007.1|  PREDICTED: serine/threonine-protein phosphat...    236   6e-70    Ooceraea biroi
ref|XP_011336006.1|  PREDICTED: serine/threonine-protein phosphat...    236   8e-70    Ooceraea biroi
ref|XP_011694196.1|  PREDICTED: serine/threonine-protein phosphat...    235   8e-70    Wasmannia auropunctata
ref|XP_011166786.1|  PREDICTED: serine/threonine-protein phosphat...    235   9e-70    Solenopsis invicta [imported red fire ant]
ref|XP_011863883.1|  PREDICTED: serine/threonine-protein phosphat...    235   9e-70    Vollenhovia emeryi
ref|XP_011863882.1|  PREDICTED: serine/threonine-protein phosphat...    235   1e-69    Vollenhovia emeryi
ref|XP_011166784.1|  PREDICTED: serine/threonine-protein phosphat...    235   1e-69    Solenopsis invicta [imported red fire ant]
ref|XP_012062306.1|  PREDICTED: serine/threonine-protein phosphat...    235   1e-69    Atta cephalotes
gb|EFZ13522.1|  hypothetical protein SINV_04974                         235   1e-69    
ref|XP_011062133.1|  PREDICTED: serine/threonine-protein phosphat...    235   2e-69    Acromyrmex echinatior
gb|EGI60796.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    235   2e-69    Acromyrmex echinatior
gb|EHJ67187.1|  protein phosphatase 2, regulatory subunit A, alph...    228   2e-69    
ref|XP_002406082.1|  protein phosphatase 2A regulatory subunit A,...    235   2e-69    Ixodes scapularis [blacklegged tick]
ref|XP_011062132.1|  PREDICTED: serine/threonine-protein phosphat...    234   2e-69    Acromyrmex echinatior
dbj|BAH72359.1|  ACYPI002758                                            225   3e-69    Acyrthosiphon pisum
ref|NP_001034525.1|  protein phosphatase 2, regulatory subunit A,...    234   3e-69    
gb|KDR23265.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    234   4e-69    Zootermopsis nevadensis
ref|XP_002613476.1|  hypothetical protein BRAFLDRAFT_119854             233   7e-69    Branchiostoma floridae
gb|AAM48413.1|  RE28669p                                                224   1e-68    Drosophila melanogaster
ref|XP_002682119.1|  phosphoprotein phosphatase A                       232   2e-68    Naegleria gruberi strain NEG-M
gb|ENN75423.1|  hypothetical protein YQE_07974                          232   2e-68    Dendroctonus ponderosae
gb|ERL94150.1|  hypothetical protein D910_11432                         232   2e-68    Dendroctonus ponderosae
gb|AEE63553.1|  unknown                                                 232   2e-68    Dendroctonus ponderosae
gb|ELT97469.1|  hypothetical protein CAPTEDRAFT_152474                  231   2e-68    Capitella teleta
gb|ERG81286.1|  serine threonine-protein phosphatase 2a 65 kda re...    231   3e-68    
ref|XP_001894294.1|  protein phosphatase PP2A regulatory subunit        231   3e-68    Brugia malayi [agent of lymphatic filariasis]
ref|XP_005095307.1|  PREDICTED: serine/threonine-protein phosphat...    231   5e-68    
gb|ERZ97088.1|  hypothetical protein GLOINDRAFT_340356                  231   5e-68    
gb|KDO70012.1|  hypothetical protein CISIN_1g0068982mg                  217   6e-68    Citrus sinensis [apfelsine]
ref|XP_011312304.1|  PREDICTED: serine/threonine-protein phosphat...    230   7e-68    Fopius arisanus
ref|XP_011312305.1|  PREDICTED: serine/threonine-protein phosphat...    230   7e-68    Fopius arisanus
ref|XP_006747287.1|  PREDICTED: serine/threonine-protein phosphat...    226   8e-68    Leptonychotes weddellii
ref|XP_011554286.1|  PREDICTED: serine/threonine-protein phosphat...    230   1e-67    Plutella xylostella [cabbage moth]
ref|XP_002111654.1|  expressed hypothetical protein                     230   1e-67    Trichoplax adhaerens
ref|NP_001171792.1|  protein phosphatase 2, regulatory subunit A,...    229   2e-67    Saccoglossus kowalevskii
gb|AEB77782.1|  protein phosphatase 2 regulatory subunit A alpha ...    229   2e-67    Helicoverpa armigera [American bollworm]
gb|KHN76768.1|  putative serine/threonine-protein phosphatase PP2...    231   2e-67    Toxocara canis
gb|ERE60505.1|  serine/threonine-protein phosphatase 2A regulator...    226   2e-67    Cricetulus griseus [Chinese hamsters]
ref|XP_003136199.1|  protein phosphatase PP2A regulatory subunit        230   2e-67    Loa loa
ref|XP_008545083.1|  PREDICTED: serine/threonine-protein phosphat...    229   2e-67    Microplitis demolitor
ref|XP_004922104.1|  PREDICTED: serine/threonine-protein phosphat...    229   3e-67    Bombyx mori [silk moth]
ref|XP_008545088.1|  PREDICTED: serine/threonine-protein phosphat...    229   3e-67    Microplitis demolitor
ref|XP_003738779.1|  PREDICTED: serine/threonine-protein phosphat...    229   3e-67    Galendromus occidentalis
emb|CDY04182.1|  BnaA09g19600D                                          215   3e-67    
ref|XP_002119919.1|  PREDICTED: serine/threonine-protein phosphat...    228   4e-67    Ciona intestinalis [sea vase]
ref|XP_009060863.1|  hypothetical protein LOTGIDRAFT_219170             228   4e-67    Lottia gigantea
ref|XP_001120202.2|  PREDICTED: serine/threonine-protein phosphat...    228   4e-67    Apis mellifera [bee]
ref|XP_011662449.1|  PREDICTED: serine/threonine-protein phosphat...    228   5e-67    Strongylocentrotus purpuratus [purple urchin]
ref|XP_006562820.1|  PREDICTED: serine/threonine-protein phosphat...    228   5e-67    Apis mellifera [bee]
ref|XP_011662461.1|  PREDICTED: serine/threonine-protein phosphat...    228   5e-67    Strongylocentrotus purpuratus [purple urchin]
gb|ETN68324.1|  HEAT repeat protein                                     228   5e-67    Necator americanus
gb|EFX90149.1|  hypothetical protein DAPPUDRAFT_300165                  228   6e-67    Daphnia pulex
ref|XP_001625764.1|  predicted protein                                  228   6e-67    Nematostella vectensis
gb|KFD57741.1|  hypothetical protein M513_01411                         228   6e-67    Trichuris suis
ref|XP_002641277.1|  C. briggsae CBR-PAA-1 protein                      228   8e-67    Caenorhabditis briggsae
ref|XP_011449631.1|  PREDICTED: serine/threonine-protein phosphat...    227   1e-66    Crassostrea gigas
ref|XP_011449632.1|  PREDICTED: serine/threonine-protein phosphat...    227   1e-66    Crassostrea gigas
emb|CDW58966.1|  serine:threonine protein phosphatase 2A 65 kDa         228   1e-66    Trichuris trichiura
emb|CAP25734.2|  Protein CBR-PAA-1                                      228   1e-66    Caenorhabditis briggsae
gb|EYB94290.1|  hypothetical protein Y032_0173g403                      228   1e-66    Ancylostoma ceylanicum
gb|EGT39825.1|  hypothetical protein CAEBREN_11425                      227   2e-66    Caenorhabditis brenneri
ref|XP_010829830.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Bison bison bison
gb|AAP36766.1|  Homo sapiens protein phosphatase 2 (formerly 2A),...    227   2e-66    synthetic construct
ref|NP_001032554.1|  serine/threonine-protein phosphatase 2A 65 k...    227   2e-66    Bos taurus [bovine]
ref|XP_008845654.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Nannospalax galili
ref|NP_058587.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    227   2e-66    Mus musculus [mouse]
pdb|3FGA|A  Chain A, Structural Basis Of Pp2a And Sgo Interaction       227   2e-66    Homo sapiens [man]
ref|XP_006772968.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Myotis davidii
ref|XP_005341840.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Ictidomys tridecemlineatus
ref|XP_004415541.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Odobenus rosmarus divergens
ref|XP_005984732.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Pantholops hodgsonii [Tibetan antelope]
ref|NP_055040.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    227   2e-66    Homo sapiens [man]
ref|XP_007955412.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Orycteropus afer afer
ref|XP_007622229.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    
gb|EHH59859.1|  hypothetical protein EGM_10070                          227   2e-66    Macaca fascicularis [crab eating macaque]
gb|KHN80727.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    227   2e-66    Toxocara canis
ref|XP_010584891.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Loxodonta africana [African bush elephant]
ref|XP_004619940.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    Sorex araneus [Eurasian shrew]
pdb|1B3U|A  Chain A, Crystal Structure Of Constant Regulatory Dom...    227   2e-66    Homo sapiens [man]
ref|XP_008248017.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    227   2e-66    
ref|XP_006194471.1|  PREDICTED: serine/threonine-protein phosphat...    227   2e-66    
ref|XP_005880804.1|  PREDICTED: serine/threonine-protein phosphat...    226   2e-66    
ref|XP_004381783.1|  PREDICTED: serine/threonine-protein phosphat...    226   2e-66    
dbj|BAC40565.1|  unnamed protein product                                226   2e-66    
gb|EYB94291.1|  hypothetical protein Y032_0173g403                      228   2e-66    
ref|XP_006905036.1|  PREDICTED: serine/threonine-protein phosphat...    226   2e-66    
gb|AAA36399.1|  phosphatase 2A regulatory subunit                       226   2e-66    
ref|XP_007648156.1|  PREDICTED: serine/threonine-protein phosphat...    226   2e-66    
gb|EFB14807.1|  hypothetical protein PANDA_017429                       226   2e-66    
ref|XP_006157810.1|  PREDICTED: serine/threonine-protein phosphat...    226   2e-66    
ref|XP_005616279.1|  PREDICTED: serine/threonine-protein phosphat...    226   2e-66    
ref|XP_003110937.1|  CRE-PAA-1 protein                                  227   2e-66    
dbj|BAF83282.1|  unnamed protein product                                226   2e-66    
emb|CAG29336.1|  PPP2R1A                                                226   2e-66    
ref|NP_498162.2|  Protein PAA-1                                         226   3e-66    
ref|XP_003225135.2|  PREDICTED: serine/threonine-protein phosphat...    227   3e-66    
pdb|2PKG|A  Chain A, Structure Of A Complex Between The A Subunit...    226   3e-66    
ref|XP_002432536.1|  serine/threonine-protein phosphatase PP2A 65...    226   3e-66    
pdb|3DW8|A  Chain A, Structure Of A Protein Phosphatase 2a Holoen...    226   3e-66    
ref|XP_006157809.1|  PREDICTED: serine/threonine-protein phosphat...    226   3e-66    
pdb|4I5L|A  Chain A, Structural Mechanism Of Trimeric Pp2a Holoen...    226   4e-66    
ref|NP_001080135.1|  protein phosphatase 2, regulatory subunit A,...    226   4e-66    
ref|XP_004666547.1|  PREDICTED: serine/threonine-protein phosphat...    225   4e-66    
gb|KJH48794.1|  HEAT repeat protein                                     226   4e-66    
ref|XP_004666546.1|  PREDICTED: serine/threonine-protein phosphat...    226   5e-66    
gb|KFB35772.1|  hypothetical protein ZHAS_00002676                      230   5e-66    
ref|XP_006833878.1|  PREDICTED: serine/threonine-protein phosphat...    224   5e-66    
ref|XP_011189359.1|  PREDICTED: serine/threonine-protein phosphat...    225   5e-66    
gb|ELW48894.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    226   6e-66    
ref|XP_007142893.1|  hypothetical protein PHAVU_007G0258001g            224   6e-66    
ref|XP_002088790.1|  Pp2A-29B                                           225   6e-66    
ref|XP_005533983.1|  PREDICTED: serine/threonine-protein phosphat...    224   6e-66    
gb|AAH52678.1|  Protein phosphatase 2 (formerly 2A), regulatory s...    225   6e-66    
ref|NP_989405.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    225   6e-66    
ref|XP_007179922.1|  PREDICTED: serine/threonine-protein phosphat...    225   6e-66    
gb|ETN60749.1|  serine/threonine protein phosphatase 2a regulator...    229   6e-66    
ref|XP_010967202.1|  PREDICTED: serine/threonine-protein phosphat...    225   7e-66    
ref|XP_011202491.1|  PREDICTED: serine/threonine-protein phosphat...    225   7e-66    
ref|XP_006868185.1|  PREDICTED: serine/threonine-protein phosphat...    225   7e-66    
ref|XP_001949483.1|  PREDICTED: serine/threonine-protein phosphat...    226   7e-66    
ref|XP_006890831.1|  PREDICTED: serine/threonine-protein phosphat...    224   8e-66    
ref|XP_001652452.1|  AAEL006977-PA                                      225   8e-66    
ref|XP_006833877.1|  PREDICTED: serine/threonine-protein phosphat...    225   8e-66    
ref|XP_004439075.1|  PREDICTED: serine/threonine-protein phosphat...    226   8e-66    
ref|XP_004715719.1|  PREDICTED: serine/threonine-protein phosphat...    224   8e-66    
ref|XP_004922102.1|  PREDICTED: serine/threonine-protein phosphat...    225   9e-66    
ref|XP_011189358.1|  PREDICTED: serine/threonine-protein phosphat...    225   9e-66    
ref|XP_003486616.1|  PREDICTED: serine/threonine-protein phosphat...    225   9e-66    
gb|EYB83532.1|  hypothetical protein Y032_0333g2791                     225   9e-66    
ref|XP_011202490.1|  PREDICTED: serine/threonine-protein phosphat...    225   1e-65    
ref|XP_002503918.1|  protein phosphatase 2a                             225   1e-65    
ref|XP_003402717.1|  PREDICTED: serine/threonine-protein phosphat...    224   1e-65    
ref|XP_006890830.1|  PREDICTED: serine/threonine-protein phosphat...    225   1e-65    
ref|XP_006681625.1|  hypothetical protein BATDEDRAFT_20637              224   1e-65    
ref|XP_001496310.2|  PREDICTED: serine/threonine-protein phosphat...    226   1e-65    
ref|XP_007106439.1|  PREDICTED: serine/threonine-protein phosphat...    225   1e-65    
ref|XP_007934752.1|  PREDICTED: serine/threonine-protein phosphat...    224   1e-65    
ref|XP_008538780.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    226   1e-65    
ref|XP_011189355.1|  PREDICTED: serine/threonine-protein phosphat...    225   1e-65    
gb|EPY73471.1|  serine/threonine-protein phosphatase 2A regulator...    226   1e-65    
ref|XP_011189357.1|  PREDICTED: serine/threonine-protein phosphat...    225   1e-65    
ref|NP_001171033.1|  serine/threonine-protein phosphatase 2A 65 k...    223   1e-65    
dbj|BAG57867.1|  unnamed protein product                                223   1e-65    
ref|XP_011202489.1|  PREDICTED: serine/threonine-protein phosphat...    225   2e-65    
ref|XP_011921815.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-65    
ref|XP_004521451.1|  PREDICTED: serine/threonine-protein phosphat...    225   2e-65    
ref|XP_005069580.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-65    
ref|XP_007441284.1|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|XP_004585107.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-65    
ref|XP_002078641.1|  GD23530                                            224   2e-65    
ref|XP_004454702.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    226   2e-65    
emb|CEF62474.1|  Serine/threonine-protein phosphatase 2A 65 kDa r...    224   2e-65    
ref|XP_005005046.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-65    
gb|AAA28304.1|  protein phosphatase 2A 65 kDa regulatory subunit        224   2e-65    
ref|NP_001027225.1|  protein phosphatase 2A at 29B, isoform C           224   2e-65    
ref|XP_007934750.1|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|XP_008148378.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-65    
ref|NP_001006775.1|  platelet-derived growth factor subunit B           224   2e-65    
ref|XP_002162841.2|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|XP_001970288.1|  GG10540                                            224   2e-65    
ref|XP_005347389.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-65    
ref|XP_003472884.1|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|NP_001081031.1|  protein phosphatase 2, regulatory subunit A,...    224   2e-65    
ref|XP_006912906.1|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|XP_007538537.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-65    
emb|CAA56713.1|  phosphorylase phosphatase                              224   2e-65    
ref|NP_001020589.1|  serine/threonine-protein phosphatase 2A 65 k...    224   2e-65    
ref|XP_009015041.1|  hypothetical protein HELRODRAFT_191252             224   2e-65    
ref|XP_005191631.2|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|XP_004521449.1|  PREDICTED: serine/threonine-protein phosphat...    225   2e-65    
ref|XP_006151038.1|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|XP_005069579.1|  PREDICTED: serine/threonine-protein phosphat...    224   2e-65    
ref|XP_005579657.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|NP_002707.3|  serine/threonine-protein phosphatase 2A 65 kDa ...    224   3e-65    
ref|XP_002051550.1|  GJ16152                                            225   3e-65    
ref|XP_007464722.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_006034569.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
dbj|BAE00417.1|  unnamed protein product                                224   3e-65    
ref|XP_005761043.1|  hypothetical protein EMIHUDRAFT_68148              224   3e-65    
ref|XP_010984268.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_005005045.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_004326179.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
gb|AAA35531.1|  medium tumor antigen-associated 61-kD protein           223   3e-65    
gb|KHN20717.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    222   3e-65    
sp|P54613.1|2AAB_PIG  RecName: Full=Serine/threonine-protein phos...    224   3e-65    
ref|XP_003357333.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_005579656.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_010593753.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_004626174.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_008259779.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_006151037.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_005334304.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_003794777.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_001961940.1|  GF15221                                            225   3e-65    
ref|XP_011921812.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_010380630.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_004273470.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_004585106.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
gb|EGW03807.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    224   3e-65    
ref|XP_010380631.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_010593752.1|  PREDICTED: serine/threonine-protein phosphat...    224   3e-65    
ref|XP_004382551.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_006151039.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_007128319.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_002002381.1|  GI17352                                            225   3e-65    
ref|XP_008148377.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
ref|XP_001987928.1|  GH10837                                            224   3e-65    
ref|XP_004413637.1|  PREDICTED: serine/threonine-protein phosphat...    223   3e-65    
emb|CEI93929.1|  Putative Protein phosphatase 2 (Formerly 2A), re...    216   4e-65    
gb|ETE63053.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    223   4e-65    
ref|XP_005667374.1|  PREDICTED: serine/threonine-protein phosphat...    224   4e-65    
ref|XP_011363717.1|  PREDICTED: serine/threonine-protein phosphat...    223   4e-65    
ref|XP_007538479.1|  PREDICTED: serine/threonine-protein phosphat...    223   4e-65    
ref|XP_008831023.1|  PREDICTED: serine/threonine-protein phosphat...    223   4e-65    
ref|NP_082890.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    223   4e-65    
pdb|2NYL|A  Chain A, Crystal Structure Of Protein Phosphatase 2a ...    223   4e-65    
ref|XP_005347388.1|  PREDICTED: serine/threonine-protein phosphat...    223   4e-65    
ref|NP_001082552.1|  serine/threonine-protein phosphatase 2A 65 k...    223   4e-65    
ref|XP_005901603.1|  PREDICTED: serine/threonine-protein phosphat...    222   4e-65    
ref|XP_010380632.1|  PREDICTED: serine/threonine-protein phosphat...    223   4e-65    
pdb|4I5N|A  Chain A, Structural Mechanism Of Trimeric Pp2a Holoen...    223   4e-65    
ref|XP_005615295.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    224   5e-65    
ref|XP_004413636.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_004326177.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_008683000.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_006833876.1|  PREDICTED: serine/threonine-protein phosphat...    224   5e-65    
gb|ELK18455.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    231   5e-65    
ref|XP_007464720.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_005334303.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_004273468.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_011921811.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_004626172.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_003794775.1|  PREDICTED: serine/threonine-protein phosphat...    223   5e-65    
ref|XP_002067166.1|  GK24159                                            224   5e-65    
ref|XP_002822526.1|  PREDICTED: serine/threonine-protein phosphat...    224   5e-65    
ref|NP_001080408.1|  protein phosphatase 2, regulatory subunit A,...    223   5e-65    
ref|XP_008575838.1|  PREDICTED: serine/threonine-protein phosphat...    223   6e-65    
ref|XP_004481189.1|  PREDICTED: serine/threonine-protein phosphat...    223   6e-65    
ref|XP_001371292.1|  PREDICTED: serine/threonine-protein phosphat...    223   6e-65    
ref|XP_004382550.1|  PREDICTED: serine/threonine-protein phosphat...    223   6e-65    
gb|AAH44120.1|  LOC398563 protein                                       223   6e-65    
gb|EKC43171.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    227   6e-65    
ref|XP_002014521.1|  GL19226                                            224   6e-65    
ref|NP_001245944.1|  protein phosphatase 2A at 29B, isoform D           224   7e-65    
gb|AAC63525.1|  protein phosphatase 2A regulatory subunit A, beta...    223   7e-65    
ref|XP_010861232.1|  PREDICTED: serine/threonine-protein phosphat...    223   7e-65    
ref|XP_005901602.1|  PREDICTED: serine/threonine-protein phosphat...    223   7e-65    
ref|XP_003583134.1|  PREDICTED: serine/threonine-protein phosphat...    223   7e-65    
ref|XP_012146318.1|  PREDICTED: serine/threonine-protein phosphat...    222   7e-65    
ref|XP_004856606.1|  PREDICTED: serine/threonine-protein phosphat...    223   8e-65    
ref|XP_007934748.1|  PREDICTED: serine/threonine-protein phosphat...    224   8e-65    
ref|XP_006065329.1|  PREDICTED: serine/threonine-protein phosphat...    223   8e-65    
gb|EPB75048.1|  hypothetical protein ANCCEY_05868                       224   8e-65    
ref|XP_004481188.1|  PREDICTED: serine/threonine-protein phosphat...    223   8e-65    
ref|XP_008259765.1|  PREDICTED: serine/threonine-protein phosphat...    224   8e-65    
ref|XP_008259769.1|  PREDICTED: serine/threonine-protein phosphat...    224   8e-65    
ref|NP_001285748.1|  protein phosphatase 2A at 29B, isoform E           223   8e-65    
ref|XP_003705692.2|  PREDICTED: serine/threonine-protein phosphat...    222   8e-65    
ref|XP_011921810.1|  PREDICTED: serine/threonine-protein phosphat...    223   9e-65    
gb|EDL95488.1|  protein phosphatase 2 (formerly 2A), regulatory s...    224   9e-65    
ref|XP_002708504.1|  PREDICTED: serine/threonine-protein phosphat...    223   9e-65    
ref|XP_010380629.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_004016059.1|  PREDICTED: serine/threonine-protein phosphat...    222   1e-64    
ref|XP_004585105.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|NP_001267102.1|  serine/threonine-protein phosphatase 2A 65 k...    223   1e-64    
ref|NP_859050.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    223   1e-64    
ref|XP_003415736.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_004791695.1|  PREDICTED: serine/threonine-protein phosphat...    224   1e-64    
ref|XP_006151036.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_006151040.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
dbj|BAF84964.1|  unnamed protein product                                223   1e-64    
ref|XP_005069578.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_004344366.2|  protein phosphatase 2                              222   1e-64    
ref|XP_005579655.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_004326176.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_011921808.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_011541194.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_010380628.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_003357336.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_007538345.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_004273467.1|  PREDICTED: serine/threonine-protein phosphat...    223   1e-64    
ref|XP_003794776.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_005347385.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_007173031.1|  PREDICTED: serine/threonine-protein phosphat...    222   2e-64    
ref|XP_011363718.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_007128320.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|NP_001029257.1|  serine/threonine-protein phosphatase 2A 65 k...    223   2e-64    
ref|XP_006151035.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_006972393.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_006972392.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_007464719.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_005347386.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_007538407.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_005667373.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_006243095.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
gb|KFO20731.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    223   2e-64    
gb|EDL25768.1|  protein phosphatase 2 (formerly 2A), regulatory s...    223   2e-64    
ref|XP_004626171.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_009422350.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    
ref|XP_004749848.1|  PREDICTED: serine/threonine-protein phosphat...    223   2e-64    



>ref|XP_009776620.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
 ref|XP_009776621.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=581

 Score =   360 bits (924),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HASVLLPPLEGLCSVEETCVREKAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPEPLK ELRTIYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKNELRTIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_009621929.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009621930.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
Length=581

 Score =   357 bits (916),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HASVLL PLEGLCSVEETCVREKAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLSPLEGLCSVEETCVREKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPEPLK ELRTIYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKNELRTIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_004241625.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum lycopersicum]
Length=581

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSAIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELG+FIPYVGGV+HA VLLPPLEGLCSVEETCVREKAVESLC+IGSQMKES
Sbjct  61   DEVLLAMAEELGMFIPYVGGVEHARVLLPPLEGLCSVEETCVREKAVESLCKIGSQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLA GEWFTARVSSCGLFHIAYPSAPEPLK ELRTIYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLATGEWFTARVSSCGLFHIAYPSAPEPLKNELRTIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006354729.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=581

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSGIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELG+FIPYVGGV+HA VLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES
Sbjct  61   DEVLLAMAEELGMFIPYVGGVEHAHVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPEPLK ELRTIY  LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKNELRTIYCQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_003637402.1| Protein phosphatase 2A regulatory subunit A [Medicago truncatula]
Length=258

 Score =   343 bits (879),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFL+ENNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLTENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HASVLLPPLE  CSVEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLPPLEAFCSVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE  KTELR+IYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEASKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KDO70006.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70007.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70008.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70009.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70010.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
 gb|KDO70011.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
Length=213

 Score =   337 bits (865),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ +IPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB39314.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39315.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39316.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=526

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S++EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006279157.1| hypothetical protein CARUB_v100079670mg, partial [Capsella rubella]
 gb|EOA12055.1| hypothetical protein CARUB_v100079670mg, partial [Capsella rubella]
Length=305

 Score =   335 bits (860),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F+PLAKRLAAGEWFTARVS+CG+FHIAYPSAP+ LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVEHFLPLAKRLAAGEWFTARVSACGIFHIAYPSAPDLLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_002276180.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
 ref|XP_010663586.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
Length=587

 Score =   345 bits (884),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREP  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_007036503.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
 gb|EOY21004.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
Length=432

 Score =   339 bits (870),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+++A+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLFHIAYPSAP+ LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPDALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>emb|CDO98444.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   344 bits (883),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVF+PYVGGV+HA+VLLPPLEGLCSVEETCVR+KAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEHANVLLPPLEGLCSVEETCVRDKAVESLCRIGSQMREA  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+E FIPL KRLAAGEWFTARVSSCGLFHIAYPSA E L+ ELRTIYS LCQDDMPMVR
Sbjct  121  DLLEFFIPLVKRLAAGEWFTARVSSCGLFHIAYPSASETLRNELRTIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|KHG03474.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=586

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S++EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010265183.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
 ref|XP_010265184.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
Length=587

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVF+PYVGGV++A++LLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEYANILLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEMLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB39317.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=584

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S++EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB39313.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=586

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S++EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>emb|CBI15438.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  132  SYLSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENND  311
            S +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENND
Sbjct  54   SEMAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENND  113

Query  312  DDDEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMK  491
            DDDEVLLAMAEELGVFIPYVGGV+HA+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+
Sbjct  114  DDDEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMR  173

Query  492  ESDLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPM  671
            E DLVE+FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR IYS LCQDDMPM
Sbjct  174  EPDLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRAIYSQLCQDDMPM  233

Query  672  VRRAAA  689
            VRR+AA
Sbjct  234  VRRSAA  239



>gb|KEH44250.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFL+ENNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLTENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HASVLLPPLE  CSVEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHASVLLPPLEAFCSVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE  KTELR+IYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEASKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|EPS62738.1| hypothetical protein M569_12049 [Genlisea aurea]
Length=587

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LK ELRTIYS LCQDDMPMVR
Sbjct  121  DLVDSFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDLLKAELRTIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|KDO39435.1| hypothetical protein CISIN_1g039154mg [Citrus sinensis]
Length=211

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVL DELKN+DIQLRLNSIRRLSTIARALGEERT KELIPFLS NNDDD
Sbjct  1    MAMVDEPLYPIAVLTDELKNDDIQLRLNSIRRLSTIARALGEERTPKELIPFLSANNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETC+R+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCMRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_008361732.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S++EEPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSVVEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_011077133.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Sesamum indicum]
Length=587

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++ IPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDSVIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDLLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008339694.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S++EEPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSVVEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP  LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPXTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010102836.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
 gb|EXB94196.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
Length=362

 Score =   335 bits (859),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +++PLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSSVDDPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYP APE LKTELR+IY+ LC DDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPGAPEALKTELRSIYTQLCTDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_009356482.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>emb|CDY69424.1| BnaAnng30450D, partial [Brassica napus]
Length=531

 Score =   340 bits (873),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ EEPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMTEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCR+GSQMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CG+FHIAYPSAP+ +KTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSACGVFHIAYPSAPDAVKTELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_007225550.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 ref|XP_007225551.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26749.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26750.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
Length=587

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPETLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_008446576.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Cucumis melo]
 ref|XP_011655767.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Cucumis sativus]
Length=587

 Score =   342 bits (877),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEMLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_008243199.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Prunus mume]
Length=587

 Score =   342 bits (877),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPETLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_012082057.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Jatropha curcas]
 gb|KDP29385.1| hypothetical protein JCGZ_18306 [Jatropha curcas]
Length=587

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDMLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_002312385.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 ref|XP_002311444.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE89752.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 gb|EEE88811.2| phosphatase family protein [Populus trichocarpa]
Length=586

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +EEPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTVEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGGVD+A VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGVDYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_002511958.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF50627.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ ++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MATVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAY SAPE +KTELRTIYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYTSAPETIKTELRTIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010263329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nelumbo nucifera]
Length=587

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEMLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_007152779.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
 gb|ESW24773.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
Length=587

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++++++PLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA+VLLPPLE LC+VEETCVR+K+VESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETCVRDKSVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE +KTELR IY  LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEVVKTELRAIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006854054.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Amborella trichopoda]
 gb|ERN15521.1| hypothetical protein AMTR_s00048p00082810 [Amborella trichopoda]
Length=587

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLA+GEWFTARVSSCGLFHIAYPSAPE LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLASGEWFTARVSSCGLFHIAYPSAPEMLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_004956389.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Setaria italica]
Length=587

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSAP+ LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSAPDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_004956390.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Setaria italica]
Length=583

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSAP+ LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSAPDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_009388386.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like, partial [Musa acuminata 
subsp. malaccensis]
Length=352

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFL ENNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLCENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+ HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGIQHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSA E LK ELR++Y  LCQDDMPMVR
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSSCGLFHIAYPSATELLKAELRSMYGHLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_009336593.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
 ref|XP_009336594.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
Length=587

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|AAG29594.1|AF196287_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
beta isoform [Medicago sativa subsp. x varia]
Length=587

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++++++PLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLA AEELGVF+PYVGGVDHASVLLPPLE LC+VEETCVR+K+VESLCRIG+QM+E 
Sbjct  61   DEVLLATAEELGVFVPYVGGVDHASVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLA+GEWFTARVSSCGLFHIAYPSAPE LKTELR IY  LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLASGEWFTARVSSCGLFHIAYPSAPEALKTELRAIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006583401.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006583402.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
Length=587

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++++++PLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGVDHA+VLLPPLE LC+VEETCVR+K+VESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVDHANVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE +KTELR IY  LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPESVKTELRAIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010094777.1| hypothetical protein L484_019987 [Morus notabilis]
 gb|EXB56942.1| hypothetical protein L484_019987 [Morus notabilis]
Length=579

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFI YVGGV+HA+VLLPPLE LCSVEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFITYVGGVEHANVLLPPLETLCSVEETCVRDKAVESLCRIGSQMREK  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA E LKTELRT+YS LCQDDMPMVR
Sbjct  121  DLVEYFIPMVKRLAAGEWFTARVSSCGLFHIAYPSASETLKTELRTVYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|AAG29593.1|AF196286_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Medicago sativa subsp. x varia]
Length=585

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFL+ENNDDDDEVL
Sbjct  3    DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLTENNDDDDEVL  62

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LAMAEELGVFIPYVGGV+HASVLLPPLE  CSVEETCVR+KAVESLCRIGSQM+ESDLVE
Sbjct  63   LAMAEELGVFIPYVGGVEHASVLLPPLEAFCSVEETCVRDKAVESLCRIGSQMRESDLVE  122

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE  KTELR+IYS LCQDDMPMVRR+AA
Sbjct  123  YFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEASKTELRSIYSQLCQDDMPMVRRSAA  182



>ref|XP_009152111.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Brassica rapa]
Length=587

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMTDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCR+GSQMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CG+FHIAYPSAP+ +KTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSACGVFHIAYPSAPDAVKTELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_002314877.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 ref|XP_006378496.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
 gb|ABK94060.1| unknown [Populus trichocarpa]
 gb|EEF01048.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 gb|ERP56293.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
Length=587

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S MEEPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTMEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLA+AEELGVFIPYVGGV++A VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E+
Sbjct  61   DEVLLALAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFT+RVS+CGLFHIAYPSAPE LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTSRVSACGLFHIAYPSAPEMLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KDO41973.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=536

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+++A+VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRLAAGEWFTARVSSCGLFH+AYPSAPE LKTELRTIY  LCQDDMPMVR
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYPSAPEALKTELRTIYRQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KDO41974.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=513

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+++A+VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRLAAGEWFTARVSSCGLFH+AYPSAPE LKTELRTIY  LCQDDMPMVR
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYPSAPEALKTELRTIYRQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006376763.1| hypothetical protein POPTR_0012s06210g [Populus trichocarpa]
 gb|ERP54560.1| hypothetical protein POPTR_0012s06210g [Populus trichocarpa]
Length=392

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ ++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MATIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA+ELGVFIPYVGGV++A+VLLPPLE LC+VEETCVR+K+VESLCRIG+QM E 
Sbjct  61   DEVLLAMADELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKSVESLCRIGTQMIEQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR +YS LCQDDMPMVR
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRALYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>emb|CDY13586.1| BnaA06g33370D [Brassica napus]
Length=595

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMTDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCR+GSQMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CG+FHIAYPSAP+ +KTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLAAGEWFTARVSACGVFHIAYPSAPDAVKTELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|KJB52972.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52973.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52974.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
Length=588

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIR+LSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA+VLLPPLE LC VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCIVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELRT+Y  LCQDDMPMVR
Sbjct  121  DLVEFFIPLLKRLAAGEWFTARVSSCGLFHIAYPSAPEALKTELRTLYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010044277.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 ref|XP_010044278.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 gb|KCW86343.1| hypothetical protein EUGRSUZ_B03031 [Eucalyptus grandis]
Length=587

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA+VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCAVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHI YPSAP+ LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGLFHIVYPSAPDMLKTELRSIYNQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB23733.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=504

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV +A+VLLPPLE LC+VEETCVREKAVESLCRIG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLF IAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_007036502.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
 gb|EOY21003.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
Length=587

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+++A+VLLPPLE LC+VEETCVR+KAVESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLFHIAYPSAP+ LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPDALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_002529138.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF33251.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDVLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_011008279.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008287.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008294.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
Length=587

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S MEEPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSAMEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLA+AEELGVFIPYVGGV++A VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E+
Sbjct  61   DEVLLALAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFT+RVS+CGLFHIAYPSAPE LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTSRVSACGLFHIAYPSAPEMLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_007046273.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
 gb|EOY02105.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
Length=587

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ EEPLYPIAVLIDELKN+DIQLRLNSIRRLSTIA ALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMAEEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIACALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEMLKTELRSIYNQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_011070821.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Sesamum indicum]
Length=587

 Score =   339 bits (870),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S  +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSRADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAY SAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYSSAPDTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006485775.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Citrus sinensis]
Length=587

 Score =   339 bits (870),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+++A+VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRLAAGEWFTARVSSCGLFH+AYPSAPE LKTELRTIY  LCQDDMPMVR
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYPSAPEALKTELRTIYRQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_004497109.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004497110.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Cicer arietinum]
Length=587

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTR+ELIPFL+ENNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRRELIPFLTENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA+ LLPPLE  CSVEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANALLPPLEAFCSVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE  KTELR+IYS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPETSKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB23732.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23734.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23735.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=586

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV +A+VLLPPLE LC+VEETCVREKAVESLCRIG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLF IAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KDO41972.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+++A+VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRLAAGEWFTARVSSCGLFH+AYPSAPE LKTELRTIY  LCQDDMPMVR
Sbjct  121  DVVEHFIPLVKRLAAGEWFTARVSSCGLFHVAYPSAPEALKTELRTIYRQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|NP_001062674.1| Os09g0249700 [Oryza sativa Japonica Group]
 emb|CAB51803.1| phosphatase 2A regulatory A subunit [Oryza sativa]
 emb|CAB51804.1| protein phosphatase 2A A subunit [Oryza sativa]
 dbj|BAD19910.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAD22212.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAF24588.1| Os09g0249700 [Oryza sativa Japonica Group]
 gb|EAZ43900.1| hypothetical protein OsJ_28521 [Oryza sativa Japonica Group]
 dbj|BAG91590.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84161.1| hypothetical protein OsI_30535 [Oryza sativa Indica Group]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ M+EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MASMDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ F+P+ KRLAAGEWFTARVSSCGLFHIAYPSAP+ LK ELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFVPVVKRLAAGEWFTARVSSCGLFHIAYPSAPDQLKAELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_004297127.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Fragaria vesca subsp. vesca]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  1    MSVVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSA E LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSASETLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KEH27050.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++++++PLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLA AEELGVF+PYVGGV+HASVLLPPLE LC+VEETCVR+K+VESLCRIG+QM+E 
Sbjct  61   DEVLLATAEELGVFVPYVGGVEHASVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLA+GEWFTARVSSCGLFHIAYPSAPE LKTELR IY  LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLASGEWFTARVSSCGLFHIAYPSAPEALKTELRAIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB50734.1| hypothetical protein B456_008G184500 [Gossypium raimondii]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +EEPLYPIA+LIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTVEEPLYPIALLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLL PLE LC+VEETCVR+KAV+SLCRIGSQMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHARVLLAPLETLCTVEETCVRDKAVKSLCRIGSQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F+PL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAYPSAPEMLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006484434.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Citrus sinensis]
 ref|XP_006484435.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Citrus sinensis]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ +IPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006437703.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 ref|XP_006437704.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50943.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50944.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ +IPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDWYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_008374745.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++E LYPIAVLIDELKNEDI+LRLNSIRR+STIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDETLYPIAVLIDELKNEDIKLRLNSIRRISTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGVDHA+VLLPPLE LC+VEETCVR+KAV+SLC+IG QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVDHANVLLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELRT YS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRTTYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010681587.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
 ref|XP_010681588.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLL+MA+ELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLSMADELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDYFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYNQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_007210261.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
 gb|EMJ11460.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
Length=587

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS+NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSDNNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A++LLPPLE LC+VEETCVR+KAV+SLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANILLPPLETLCTVEETCVRDKAVDSLCRIGAQMREK  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFH+AYPSAPE LKTELRT YS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHMAYPSAPETLKTELRTTYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB23731.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV +A+VLLPPLE LC+VEETCVREKAVESLCRIG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLF IAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB23730.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV +A+VLLPPLE LC+VEETCVREKAVESLCRIG+QM E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVQYANVLLPPLETLCTVEETCVREKAVESLCRIGAQMMEQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+FIPL KRLAAGEWFTARVSSCGLF IAYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  121  DLVESFIPLVKRLAAGEWFTARVSSCGLFRIAYPSAPEALKTELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010495219.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSVIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAP+PLK ELR++YS LCQDDMPMVR
Sbjct  121  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYPSAPDPLKAELRSLYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|AEQ75494.1| serine/threonine protein phosphatase 2a regulatory subunit A 
[Rosa multiflora]
Length=587

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSA E LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVSWFIPLVKRLAAGEWFTARVSACGLFHIAYPSASETLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_003555890.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
 gb|KHN11434.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/180 (91%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTR+ELIPFLSENNDDDDEVL
Sbjct  3    DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRRELIPFLSENNDDDDEVL  62

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LAMAEELGVFIPYVGGV+HASVLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ESDLVE
Sbjct  63   LAMAEELGVFIPYVGGVEHASVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVE  122

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             +IPL KRLAAGEWFTARVS+CGLFHIAYPSAPE  KTELR+IYS LCQDDMPMVRR+AA
Sbjct  123  YYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPETSKTELRSIYSQLCQDDMPMVRRSAA  182



>gb|ACL54598.1| unknown [Zea mays]
Length=587

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA + LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSASDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_009347000.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++E LYPIAVLIDELKNEDI+LRLNSIRR+STIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDETLYPIAVLIDELKNEDIKLRLNSIRRVSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGVDHA+VLLPPLE LC+VEETCVR+KAV+SLC+IG QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVDHANVLLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELRT YS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRTTYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_011021847.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021855.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021865.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +EE LYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTVEERLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGGVD+A VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGVDYAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVEWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010458784.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
2A 65 kDa regulatory subunit A gamma isoform-like [Camelina 
sativa]
Length=587

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAP+PLK ELR++YS LCQDDMPMVR
Sbjct  121  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYPSAPDPLKAELRSLYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010476329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAP+PLK ELR++YS LCQDDMPMVR
Sbjct  121  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYPSAPDPLKAELRSLYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008648330.1| PREDICTED: LOC732740 isoform X1 [Zea mays]
 gb|AFW75380.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=587

 Score =   338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA + LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSASDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_002876929.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53188.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE L SVEETCVREKAVESLCR+GSQMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSSVEETCVREKAVESLCRVGSQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CG+FHIAYPSAP+ LKTELR++Y+ LCQDDMPMVR
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGVFHIAYPSAPDMLKTELRSLYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008240282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Prunus mume]
Length=587

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLS+NNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSDNNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A++LLPPLE LC+VEETCVR+KAV+SLCRIG QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANILLPPLETLCTVEETCVRDKAVDSLCRIGVQMREK  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE L+TELRT YS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLRTELRTTYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006297363.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
 gb|EOA30261.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
Length=550

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F+PLAKRLAAGEWFTARVS+CG+FHIAYPSAP+ LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVEHFLPLAKRLAAGEWFTARVSACGIFHIAYPSAPDLLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010554238.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
 ref|XP_010554239.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
Length=586

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSE+NDDD
Sbjct  1    MSTIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSESNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVF P+VGGV+HA VLLPPLE LC+VEETCVREKAVESLCR+GSQM+E+
Sbjct  61   DEVLLAMAEELGVFTPFVGGVEHAHVLLPPLETLCTVEETCVREKAVESLCRVGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDTLKTELRSIYNQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|NP_001105839.1| LOC732740 [Zea mays]
 gb|AAY24685.1| protein phosphatase 2A regulatory subunit A [Zea mays]
 gb|AFW75381.1| protein phosphatase 2A regulatory subunit A [Zea mays]
Length=583

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA + LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSASDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008350866.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREG  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  FIPL KRLAAGEWFTARVS+CGLFHIAYPSA + LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVNWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAXDTLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_004238945.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Solanum lycopersicum]
Length=587

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F+PL KRLAAGEWFTARVS+CGLFHIAY SAPE LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAYSSAPEMLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_009606530.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
 ref|XP_009606531.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
Length=587

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F+PL KRLAAGEWFTARVS+CGLFHIAY SAPE LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAYSSAPEMLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_003536691.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006589702.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
 gb|KHN05580.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   337 bits (864),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTR+ELIPFLSENNDDDDEVL
Sbjct  3    DEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRRELIPFLSENNDDDDEVL  62

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LAMAEELGVFIPYVGGV+HASVLLPPLE LC+VEETCVR+KA ESLCRIGSQM+ESDLVE
Sbjct  63   LAMAEELGVFIPYVGGVEHASVLLPPLETLCTVEETCVRDKAAESLCRIGSQMRESDLVE  122

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             +IPL KRLAAGEWFTARVS+CGLFHIAYPSAPE  KTELR+IYS LCQDDMPMVRR+AA
Sbjct  123  YYIPLVKRLAAGEWFTARVSACGLFHIAYPSAPETSKTELRSIYSQLCQDDMPMVRRSAA  182



>ref|XP_009766514.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana sylvestris]
Length=587

 Score =   337 bits (865),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F+PL KRLAAGEWFTARVS+CGLFHIAY SAPE LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAYSSAPEMLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>emb|CDP00596.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   338 bits (868),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRL+TIARALGEERTRKELIPFLSENNDDD
Sbjct  48   MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLNTIARALGEERTRKELIPFLSENNDDD  107

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++ASVLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E+
Sbjct  108  DEVLLAMAEELGVFIPYVGGVEYASVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREN  167

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSA E LKTELR+IYS LCQDDMPMVR
Sbjct  168  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSASEMLKTELRSIYSQLCQDDMPMVR  227

Query  678  RAAA  689
            RAAA
Sbjct  228  RAAA  231



>ref|XP_006362557.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=587

 Score =   337 bits (864),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F+PL KRLAAGEWFTARVS+CGLFHIAY SAPE LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSACGLFHIAYSSAPEMLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010528048.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528049.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528050.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528051.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
Length=587

 Score =   337 bits (864),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DI LRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIHLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVREKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAY SAP+ LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLVDHFIPLVKRLAAGEWFTARVSACGLFHIAYLSAPDMLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006660451.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Oryza brachyantha]
Length=587

 Score =   337 bits (864),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ M+EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MATMDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ F+P+ KRLAAGEWFTARVSSCGLFHIAYPS+P+ LK ELR IY  LCQDDMPMVR
Sbjct  121  DIVDWFVPVVKRLAAGEWFTARVSSCGLFHIAYPSSPDQLKAELRNIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008659344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X3 [Zea mays]
 gb|AFW86038.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=583

 Score =   337 bits (863),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA + LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSALDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008659343.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Zea mays]
 gb|AFW86039.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=587

 Score =   337 bits (863),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA + LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSALDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|AFW75382.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=623

 Score =   338 bits (866),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA + LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSASDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|ERN07361.1| hypothetical protein AMTR_s00019p00236090 [Amborella trichopoda]
Length=604

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  96   IYTGK*TTKTL*SYLSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTR  275
            +++G    + L +++++++EPLYPIA+LIDELKNED+QLRLNSIRRLSTIARALGEERTR
Sbjct  5    LFSGLPNLERLENFMAMVDEPLYPIAILIDELKNEDLQLRLNSIRRLSTIARALGEERTR  64

Query  276  KELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKA  455
            KELIPFLSENNDDDDEVL+AMAEELGVFIPYVGGV+HA VLLPPLE LC+VEET VREK+
Sbjct  65   KELIPFLSENNDDDDEVLVAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETFVREKS  124

Query  456  VESLCRIGSQMKESDLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRT  635
            VESLCRIG QMKESD V+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE LK ELR+
Sbjct  125  VESLCRIGVQMKESDQVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEQLKAELRS  184

Query  636  IYSXLCQDDMPMVRRAAA  689
            IY+ LCQDDMPMVRRAAA
Sbjct  185  IYTQLCQDDMPMVRRAAA  202



>ref|XP_006660452.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Oryza brachyantha]
Length=583

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ M+EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MATMDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ F+P+ KRLAAGEWFTARVSSCGLFHIAYPS+P+ LK ELR IY  LCQDDMPMVR
Sbjct  121  DIVDWFVPVVKRLAAGEWFTARVSSCGLFHIAYPSSPDQLKAELRNIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_007153361.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 ref|XP_007153362.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25355.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25356.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
Length=587

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIR+LSTIARALGEERTR+ELIPFL ENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRKLSTIARALGEERTRRELIPFLGENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVF+P+VGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFVPFVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE  KTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEMSKTELRSIYNLLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_006395624.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
 gb|ESQ32910.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
Length=587

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCR+GSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSAVEETCVREKAVESLCRVGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  F+PL KRLAAGEWFTARVS+CG+FHIAYPSAP+ LKTELR+ YS LCQDDMPMVR
Sbjct  121  DLVVHFVPLVKRLAAGEWFTARVSACGVFHIAYPSAPDVLKTELRSTYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006307029.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
 gb|EOA39927.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
Length=610

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  24   MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  83

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  84   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMRET  143

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAPE LK ELR++YS LCQDDMPMVR
Sbjct  144  DLVEHFFPLAKRLSAGEWFTARVSACGIFHIAYPSAPELLKMELRSVYSQLCQDDMPMVR  203

Query  678  RAAA  689
            RAAA
Sbjct  204  RAAA  207



>ref|XP_009396282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Musa acuminata subsp. malaccensis]
Length=587

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ ++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MATIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F+PL KRLAAGEWFTARVSSCGLFH+AYPS+P+ LK ELR+IY+ +CQDD PMVR
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSSCGLFHVAYPSSPDQLKAELRSIYAQMCQDDTPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008659342.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Zea mays]
 gb|AFW86037.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=592

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA + LKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSALDQLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_012092991.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Jatropha curcas]
 ref|XP_012092992.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Jatropha curcas]
Length=587

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ ++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MATIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+ A+VLLPPLE LC+VEETCVR+KAVESL RIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEFANVLLPPLETLCTVEETCVRDKAVESLYRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELRT+YS LCQDDMPMVR
Sbjct  121  DVVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRTMYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KGN52064.1| hypothetical protein Csa_5G608520 [Cucumis sativus]
Length=796

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  210  MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  269

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ES
Sbjct  270  DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRES  329

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IY  LCQDDMPMVR
Sbjct  330  DLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEMLKTELRSIYGQLCQDDMPMVR  389

Query  678  RAAA  689
            R+AA
Sbjct  390  RSAA  393



>gb|KDP20104.1| hypothetical protein JCGZ_05873 [Jatropha curcas]
Length=587

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ ++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MATIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+ A+VLLPPLE LC+VEETCVR+KAVESL RIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEFANVLLPPLETLCTVEETCVRDKAVESLYRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELRT+YS LCQDDMPMVR
Sbjct  121  DVVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRTMYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_008393303.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++E LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDERLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA++LLPPLE LC+VEETCVR+KAV+SLC+IG QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANILLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAY SAPE LKTELRT YS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYTSAPETLKTELRTTYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010942275.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Elaeis guineensis]
Length=587

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F+PL KRLAAGEWFTARVSSCGLFHIAY SAP+ LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLVDWFVPLVKRLAAGEWFTARVSSCGLFHIAYSSAPDHLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010929062.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Elaeis guineensis]
Length=587

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
             LV+ F+PL KRLAAGEWFTARVSSCGLFHIAYPSAP+ LK ELR+IYS LCQDDMPMVR
Sbjct  121  YLVDWFVPLVKRLAAGEWFTARVSSCGLFHIAYPSAPDQLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_004972370.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Setaria italica]
Length=587

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIR+LSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG+QM ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMNES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVSSCGLFHIAYPSA E LK ELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFIPVVKRLAAGEWFTARVSSCGLFHIAYPSASESLKAELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|NP_001030769.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 gb|AEE77070.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=544

 Score =   333 bits (854),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE L +VEETCVREKAVESLCR+GSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FI L KRLAAGEWFTARVS+CG+FHIAYPSAP+ LKTELR++Y+ LCQDDMPMVR
Sbjct  121  DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYPSAPDMLKTELRSLYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_008797605.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Phoenix dactylifera]
Length=587

 Score =   334 bits (857),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWFTARVSSCGLFHIAY SAP+ LK ELR+IY  LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFTARVSSCGLFHIAYASAPDHLKAELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010458785.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
 ref|XP_010458786.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   334 bits (857),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ +EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+ GEWFTARVS+CG+FHIAYPSAP+ LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVEHFFPLAKRLSGGEWFTARVSACGIFHIAYPSAPDQLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|AEB40165.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40166.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40167.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|EMT17513.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Aegilops tauschii]
Length=587

 Score =   334 bits (857),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FI + KRLAAGEWFTARVSSCGLFHIAYPSA +PLKTELRTIY  LCQDDMPMVR
Sbjct  121  DIVDYFIAVVKRLAAGEWFTARVSSCGLFHIAYPSATDPLKTELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010495228.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+ +EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMADEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVREKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+ GEWFTARVS+CG+FHIAYPSAP+ LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVEHFFPLAKRLSGGEWFTARVSACGIFHIAYPSAPDQLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|KJB80118.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=528

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +E PLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRSELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLL PLE LC+VEETCVR+KAVESLC+IGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+E F PL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLIEWFTPLVKRLAAGEWFTARVSACGLFHIAYPSAPETLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|NP_189208.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 sp|Q38950.2|2AAB_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A beta isoform; Short=AtA beta; Short=PP2A, 
subunit A, beta isoform [Arabidopsis thaliana]
 dbj|BAA95767.1| protein phosphotase 2a 65kd regulatory subunit [Arabidopsis thaliana]
 gb|AAO00848.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
 gb|AAP37715.1| At3g25800 [Arabidopsis thaliana]
 gb|AEE77069.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=587

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE L +VEETCVREKAVESLCR+GSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FI L KRLAAGEWFTARVS+CG+FHIAYPSAP+ LKTELR++Y+ LCQDDMPMVR
Sbjct  121  DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYPSAPDMLKTELRSLYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>emb|CAA57528.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
Length=587

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE L +VEETCVREKAVESLCR+GSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVESLCRVGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FI L KRLAAGEWFTARVS+CG+FHIAYPSAP+ LKTELR++Y+ LCQDDMPMVR
Sbjct  121  DLVDHFISLVKRLAAGEWFTARVSACGVFHIAYPSAPDMLKTELRSLYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|KJB80117.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=589

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +E PLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRSELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLL PLE LC+VEETCVR+KAVESLC+IGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+E F PL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLIEWFTPLVKRLAAGEWFTARVSACGLFHIAYPSAPETLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KJB80114.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80115.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80116.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=587

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +E PLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRSELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLL PLE LC+VEETCVR+KAVESLC+IGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+E F PL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLIEWFTPLVKRLAAGEWFTARVSACGLFHIAYPSAPETLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_004512939.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cicer arietinum]
Length=587

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++++++PLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLA AEELGVF+PYVGGV++ASVLLPPLE LC+VEETCVR+K+VESLCRIG+QM+E 
Sbjct  61   DEVLLATAEELGVFVPYVGGVEYASVLLPPLETLCTVEETCVRDKSVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLA+GEWFTARVSSCGLFHIAYPSA E LKTELR IY  LCQDDMPMVR
Sbjct  121  DLVEHFIPLVKRLASGEWFTARVSSCGLFHIAYPSASEGLKTELRAIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_011006221.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++ ++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MATIDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA+ELGVFIPYVGGV++A+VLLPPLE LC+VEETCVR+K+VESLCRIG+QM E 
Sbjct  61   DEVLLAMADELGVFIPYVGGVEYANVLLPPLETLCTVEETCVRDKSVESLCRIGTQMIEQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ F PL KRLAAGEWFTARVSSCGLFHIAYPSAPE LKTELR +YS LCQDDMPMVR
Sbjct  121  DLVDHFSPLVKRLAAGEWFTARVSSCGLFHIAYPSAPETLKTELRALYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_003534171.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++++++PLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  1    MAMVDQPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA+VLLPPLE LC+VEET VR+K+VESLCRIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHANVLLPPLETLCTVEETSVRDKSVESLCRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE  IPL KRLAAGEWFTARVSSCGLFHIAYPSAPE +KTELR IY  LCQDDMPMVR
Sbjct  121  DLVEYLIPLVKRLAAGEWFTARVSSCGLFHIAYPSAPEAVKTELRAIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_011623847.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Amborella trichopoda]
Length=586

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNED+QLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAILIDELKNEDLQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVL+AMAEELGVFIPYVGGV+HA VLLPPLE LC+VEET VREK+VESLCRIG QMKES
Sbjct  61   DEVLVAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETFVREKSVESLCRIGVQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D V+ FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE LK ELR+IY+ LCQDDMPMVR
Sbjct  121  DQVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPEQLKAELRSIYTQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|EYU40874.1| hypothetical protein MIMGU_mgv1a003588mg [Erythranthe guttata]
Length=576

 Score =   332 bits (851),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +3

Query  147  MEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEV  326
            MEEPLYPIAVL+DELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFL ENNDD+DEV
Sbjct  3    MEEPLYPIAVLVDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLCENNDDEDEV  62

Query  327  LLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLV  506
            LLA AEELGVFIPYVGG++HA VLLPPLE LC+VEETCVR+K+VESLCRIGSQM+ESDLV
Sbjct  63   LLATAEELGVFIPYVGGMEHAHVLLPPLETLCTVEETCVRDKSVESLCRIGSQMRESDLV  122

Query  507  EAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAA  686
            + FIPL KRLAAGEWFTARVS+CGLFHIAY SAP+ LKTELR+IYS LCQDDMPMVRRAA
Sbjct  123  DWFIPLVKRLAAGEWFTARVSACGLFHIAYTSAPDMLKTELRSIYSQLCQDDMPMVRRAA  182

Query  687  A  689
            A
Sbjct  183  A  183



>ref|XP_004300534.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
 ref|XP_011465404.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
Length=586

 Score =   332 bits (851),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIR+LSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVF+PYVGGV++A++LLPPLE LC+VEETCVR+KAVESL RIG+QM+E 
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEYANILLPPLETLCTVEETCVRDKAVESLGRIGAQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLAAGEWFTARVSSCGLFHIAY SAPE +KTELRTIY+ LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYSSAPESMKTELRTIYNQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010677978.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA+E+G+FIPYVGGVDHA+VLLPPLE LC+VEETCVR+KAV SLC I SQMKES
Sbjct  61   DEVLLAMAQEMGLFIPYVGGVDHATVLLPPLETLCTVEETCVRDKAVHSLCSIASQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F P+ KRLA+GEWFTARVSSCGLF+IAYPSAPE +K ELRT+YS LCQDDMPMVR
Sbjct  121  DLVQSFFPMLKRLASGEWFTARVSSCGLFYIAYPSAPENIKAELRTMYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010476330.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S  +EPLYPIAVLI+ELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSTADEPLYPIAVLIEELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVREKAVESLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSNVEETCVREKAVESLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+ GEWFTARVS+CG+FHIAYPSAP+ LK ELR+IYS LCQDDMPMVR
Sbjct  121  DLVEHFFPLAKRLSGGEWFTARVSACGIFHIAYPSAPDQLKAELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|KHG15336.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=587

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +E PLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGE+RTR ELIPFLSENNDDD
Sbjct  1    MSTVEAPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRSELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVF+PYVGGV+HA VLL PLE LC+VEETCVR+KAVESLC+IGSQM+E+
Sbjct  61   DEVLLAMAEELGVFVPYVGGVEHAHVLLTPLETLCTVEETCVRDKAVESLCKIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+E F PL KRLAAGEWFTARVS+CGLFHIAYPSAPE LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLIERFTPLVKRLAAGEWFTARVSACGLFHIAYPSAPETLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010237336.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Brachypodium distachyon]
Length=583

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FI + KRLA+GEWFTARVSSCGLFHIAYPSA +PLK ELRTIY  LCQDDMPMVR
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYPSATDPLKAELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_003577085.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Brachypodium distachyon]
Length=587

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMVDEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE L +VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FI + KRLA+GEWFTARVSSCGLFHIAYPSA +PLK ELRTIY  LCQDDMPMVR
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYPSATDPLKAELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_002892742.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69001.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE L +VEETCVREKAV+SLCRIG+QM+E+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLETLSTVEETCVREKAVDSLCRIGAQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAP+ LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYPSAPDLLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_003518674.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIR+LSTIARALGEERTR+ELIPFL ENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRKLSTIARALGEERTRRELIPFLGENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG QM+ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGVEHAHVLLPPLEMLCTVEETCVRDKAVESLCRIGLQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLA+GEWFTARVSSCGLFHIAYPSAPE  K ELR++YS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLASGEWFTARVSSCGLFHIAYPSAPEMSKIELRSMYSLLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>gb|KHN27183.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=587

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIR+LSTIARALGEERTR+ELIPFL ENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRKLSTIARALGEERTRRELIPFLGENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIG QM+ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGVEHAHVLLPPLEMLCTVEETCVRDKAVESLCRIGLQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE FIPL KRLA+GEWFTARVSSCGLFHIAYPSAPE  K ELR++YS LCQDDMPMVR
Sbjct  121  DLVEYFIPLVKRLASGEWFTARVSSCGLFHIAYPSAPEMSKIELRSMYSLLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010551283.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
 ref|XP_010551284.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
Length=587

 Score =   330 bits (846),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S ++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLSEN+DDD
Sbjct  1    MSAVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG++HA VLLPPLE LC+VEETCVREKAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGIEHAYVLLPPLEALCTVEETCVREKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+F+PL KRL+AGEWF ARVS+CGLFH+AYP++ + LK ELR+ YS LCQDDMPMVR
Sbjct  121  DLVESFVPLVKRLSAGEWFAARVSACGLFHVAYPTSTDALKAELRSTYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|NP_001150156.1| LOC100283785 [Zea mays]
 gb|ACG38064.1| serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
Abeta isoform [Zea mays]
 gb|ACR36218.1| unknown [Zea mays]
 gb|AFW87186.1| Serine/threonine-protein phosphatase regulatory subunit Abeta 
isoform [Zea mays]
Length=587

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNEDIQLRLNSI++LSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDIQLRLNSIKKLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLC+IG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCQIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ F  + KRLA GEWFTARVSSCGLFHIAYPSAPE LK ELRTIY  LCQDDMPMVR
Sbjct  121  DIVDWFAHVVKRLAVGEWFTARVSSCGLFHIAYPSAPEQLKAELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_002282096.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
 ref|XP_010647838.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
Length=587

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAM EELGVFIPYVGG++HA VLLPPLE LC+VEET VR+KAVESLCRIGSQMKE+
Sbjct  61   DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+  FIPL KRLA+GEWFTARVS+CGLFHIAYPSAPE LK ELR IYS LCQDDMPMVR
Sbjct  121  DLINWFIPLVKRLASGEWFTARVSACGLFHIAYPSAPEMLKMELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_009415447.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   327 bits (838),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++  +EPLYPIAVLIDELKNEDIQLRLNSIR+LSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAATDEPLYPIAVLIDELKNEDIQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV +A VLLPPLE LC+VEETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVGYAHVLLPPLETLCTVEETCVRDKAVESLCRIGAQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV  F PL KRLA GEWFT+RVSSCGLFHIAYPSAP+ LK ELR+IY  LCQDD PMVR
Sbjct  121  DLVGWFAPLVKRLATGEWFTSRVSSCGLFHIAYPSAPDQLKVELRSIYGQLCQDDTPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_003577041.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Brachypodium 
distachyon]
Length=587

 Score =   327 bits (837),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++ +EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMADEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLL PLE L +VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLSPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FI + KRLA+GEWFTARVSSCGLFHIAYPSA +PLK ELRTIY  LCQDDMPMVR
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYPSATDPLKAELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010237331.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Brachypodium 
distachyon]
Length=583

 Score =   326 bits (836),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++ +EPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD+
Sbjct  1    MAMADEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDE  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLL PLE L +VEETCVR+KAVESLCRIG+QMKE+
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLSPLETLSTVEETCVRDKAVESLCRIGAQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FI + KRLA+GEWFTARVSSCGLFHIAYPSA +PLK ELRTIY  LCQDDMPMVR
Sbjct  121  DIVDFFIQVVKRLASGEWFTARVSSCGLFHIAYPSATDPLKAELRTIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>emb|CBI27044.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD
Sbjct  50   MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD  109

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAM EELGVFIPYVGG++HA VLLPPLE LC+VEET VR+KAVESLCRIGSQMKE+
Sbjct  110  DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN  169

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+  FIPL KRLA+GEWFTARVS+CGLFHIAYPSAPE LK ELR IYS LCQDDMPMVR
Sbjct  170  DLINWFIPLVKRLASGEWFTARVSACGLFHIAYPSAPEMLKMELRAIYSQLCQDDMPMVR  229

Query  678  RAAA  689
            R+AA
Sbjct  230  RSAA  233



>ref|XP_009391301.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391302.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVF+PY+GGV+ A VLLPPLE LC V+ETCVR+KAVESLCRIG+QMKES
Sbjct  61   DEVLLAMAEELGVFVPYIGGVEFAYVLLPPLETLCIVDETCVRDKAVESLCRIGTQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRLA GEWFTARVSSCGLFHIAYPSA E  K ELR++Y  LCQDDMPMVR
Sbjct  121  DIVEWFIPLVKRLAGGEWFTARVSSCGLFHIAYPSATELFKAELRSMYGQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>emb|CAN68660.1| hypothetical protein VITISV_002162 [Vitis vinifera]
Length=582

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAM EELGVFIPYVGG++HA VLLPPLE LC+VEET VR+KAVESLCRIGSQMKE+
Sbjct  61   DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DL+  FIPL KRLA+GEWFTARVS+CGLFHIAYPSAPE LK ELR IYS LCQDDMPMVR
Sbjct  121  DLINWFIPLVKRLASGEWFTARVSACGLFHIAYPSAPEMLKMELRAIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            R+AA
Sbjct  181  RSAA  184



>ref|XP_010036877.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036878.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036879.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 gb|KCW48540.1| hypothetical protein EUGRSUZ_K02214 [Eucalyptus grandis]
Length=588

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            ++++EEPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  2    MAVIEEPLYPIALLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  61

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELG F+PYVGGV HA+VLL PLE LC+VEET VR+KAV SLCRIG QM+E 
Sbjct  62   DEVLLAMAEELGAFLPYVGGVGHANVLLTPLETLCTVEETRVRDKAVASLCRIGDQMREQ  121

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+V+ FIP+ KRLAAGEWFTARVS+CGLFH+AYPSAPE LKTELR IYS LCQDDMPMVR
Sbjct  122  DVVDYFIPMMKRLAAGEWFTARVSACGLFHVAYPSAPEALKTELRGIYSQLCQDDMPMVR  181

Query  678  RAAA  689
            R+AA
Sbjct  182  RSAA  185



>ref|XP_008783038.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783039.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783040.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
Length=587

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAILIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A+VLLPPLE LC+VEET VR+KAVESLCRIG+QMK++
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYANVLLPPLETLCTVEETFVRDKAVESLCRIGAQMKKN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPL KRLAA EWFT RVSSCGLFHIAYPSAP+ LK ELR+IY  LCQDDMP VR
Sbjct  121  DLVDWFIPLVKRLAACEWFTGRVSSCGLFHIAYPSAPDQLKVELRSIYGQLCQDDMPTVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006417131.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 ref|XP_006417132.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35484.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35485.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
Length=587

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQLRLNSIRRLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG++HA+VLLPPLE L +VEET VREKAV+SLCRIGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEHANVLLPPLETLSTVEETIVREKAVDSLCRIGSQMREN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV+ FIPLAKRL+AGEWFTARVS+CG+FH+AY SA + LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDHFIPLAKRLSAGEWFTARVSACGIFHVAYASASDLLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006440947.1| hypothetical protein CICLE_v100194171mg, partial [Citrus clementina]
 gb|ESR54187.1| hypothetical protein CICLE_v100194171mg, partial [Citrus clementina]
Length=171

 Score =   309 bits (792),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGG+++A+VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+E 
Sbjct  61   DEVLLAMAEELGVFIPYVGGLEYANVLLPPLETLCTVEETCVRDKAVESLCRIGSQMREQ  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXL  650
            D++E FIPL KRLAAGEWFTARVSSCGLFH+AYPSAPE LKTELRTIY  L
Sbjct  121  DVIEHFIPLVKRLAAGEWFTARVSSCGLFHVAYPSAPEALKTELRTIYRQL  171



>ref|XP_002893420.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69679.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
Length=588

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG+++A VLLPPLE LC+VEETCVREKAVESLC+IGSQMKE+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVESLCKIGSQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+F+PL KRLAAGEWF ARVS+CG+FH+AY    + LKTELR  YS LCQDDMPMVR
Sbjct  121  DLVESFVPLVKRLAAGEWFAARVSACGIFHVAYQGCTDVLKTELRATYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|NP_001031035.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE28999.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=537

 Score =   320 bits (821),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQ RLNSI+RLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQRRLNSIKRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELG FI YVGGV++A VLLPPLE L +VEETCVREKAV+SLCRIG+QM+ES
Sbjct  61   DEVLLAMAEELGGFILYVGGVEYAYVLLPPLETLSTVEETCVREKAVDSLCRIGAQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAP+ LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYPSAPDVLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>emb|CDY51132.1| BnaA07g37150D [Brassica napus]
Length=586

 Score =   322 bits (824),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA ELGVFIP+VGGV+HA VLLPPLE LC+VEETCVREKAV+SLC+IGS+M+ES
Sbjct  61   DEVLLAMAGELGVFIPFVGGVEHAHVLLPPLESLCTVEETCVREKAVDSLCKIGSEMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CGLFH+AY    + LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFHVAYQGCTDVLKTELRSIYNQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_009103071.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Brassica rapa]
Length=586

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA ELGVFIP+VGGV+HA VLLPPLE LC+VEETCVREKAV+SLC+IGS+M+ES
Sbjct  61   DEVLLAMAGELGVFIPFVGGVEHAHVLLPPLESLCTVEETCVREKAVDSLCKIGSEMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CGLFH+AY    + LKTELR+IY+ LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFHVAYQGCTDVLKTELRSIYNQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|AAG09551.1|AC011810_10 Putative protein phosphotase 2a 65kd regulatory subunit [Arabidopsis 
thaliana]
Length=591

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQ RLNSI+RLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQRRLNSIKRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELG FI YVGGV++A VLLPPLE L +VEETCVREKAV+SLCRIG+QM+ES
Sbjct  61   DEVLLAMAEELGGFILYVGGVEYAYVLLPPLETLSTVEETCVREKAVDSLCRIGAQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAP+ LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYPSAPDVLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|NP_172790.2| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 ref|NP_001184981.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 sp|Q38951.2|2AAG_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A gamma isoform; Short=AtA gamma; Short=PP2A, 
subunit A, gamma isoform [Arabidopsis thaliana]
 gb|AAM20611.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AAO00961.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AEE28998.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE29000.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=587

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S+++EPLYPIAVLIDELKN+DIQ RLNSI+RLS IARALGEERTRKELIPFLSENNDDD
Sbjct  1    MSMVDEPLYPIAVLIDELKNDDIQRRLNSIKRLSIIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELG FI YVGGV++A VLLPPLE L +VEETCVREKAV+SLCRIG+QM+ES
Sbjct  61   DEVLLAMAEELGGFILYVGGVEYAYVLLPPLETLSTVEETCVREKAVDSLCRIGAQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE F PLAKRL+AGEWFTARVS+CG+FHIAYPSAP+ LKTELR+IY  LCQDDMPMVR
Sbjct  121  DLVEHFTPLAKRLSAGEWFTARVSACGIFHIAYPSAPDVLKTELRSIYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006307078.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
 gb|EOA39976.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
Length=588

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG+++A VLLPPLE LC+VEETCVREKAV+SLC+IGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVDSLCKIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CG+FH+AY    + LKTELR+ YS LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAYQGCTDVLKTELRSTYSLLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010477897.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Camelina sativa]
Length=588

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG+++A VLLPPLE LC+VEETCVREKAV+SLC+IGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVDSLCKIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CG+FH+AY    + LKTELR+ YS LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAYQGCTDVLKTELRSTYSLLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_009396657.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=992

 Score =   330 bits (845),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKNED+QLRLNSIR+LSTIARALGEERTRKELIPFLSENNDDD
Sbjct  1    MAMIDEPLYPIAVLIDELKNEDVQLRLNSIRKLSTIARALGEERTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV++A VLLPPLE LCSVEETCVR+KAVESLCRIG+QM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEYAHVLLPPLEILCSVEETCVRDKAVESLCRIGAQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
             LV+ F PL KRLAAGEWFT+RVSSCGLFHIAYPSAP+ LK ELR++YS  CQDD PMVR
Sbjct  121  SLVDWFAPLVKRLAAGEWFTSRVSSCGLFHIAYPSAPDQLKAELRSMYSQFCQDDTPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010499103.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG+++A VLLPPLE LC+VEETCVREKAV+SLC+IGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKAVDSLCKIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CG+FH+AY    + LKTELR+ YS LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAYQGCTDVLKTELRSTYSLLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>gb|AAB60713.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis thaliana]
Length=590

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG++ A VLLPPLE LC+VEETCVREKAVESLC+IGSQMKE+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEFAHVLLPPLESLCTVEETCVREKAVESLCKIGSQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+F+PL KRLA GEWF ARVS+CG+FH+AY    + LKTELR  YS LC+DDMPMVR
Sbjct  121  DLVESFVPLVKRLAGGEWFAARVSACGIFHVAYQGCTDVLKTELRATYSQLCKDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_010460344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG+++A VLLPPLE LC+VEETCVREKA++SLC+IGSQM+E+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEYAHVLLPPLESLCTVEETCVREKALDSLCKIGSQMRET  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CG+FH+AY    + LKTELR+ YS LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGIFHVAYQGCTDVLKTELRSTYSLLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|NP_173920.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
 sp|Q38845.1|2AAA_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A alpha isoform; Short=AtA alpha; Short=PP2A, 
subunit A, alpha isoform; Short=PR-65 A; AltName: Full=Protein 
ROOTS CURL IN NAPHTHYLPHTHALAMIC ACID 1; AltName: Full=Protein 
enhancer of ethylene-response 1 [Arabidopsis thaliana]
 gb|AAG50801.1|AC079281_3 phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAC49255.1| phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAM53315.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAN15427.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AEE30632.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
Length=588

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG++ A VLLPPLE LC+VEETCVREKAVESLC+IGSQMKE+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEFAHVLLPPLESLCTVEETCVREKAVESLCKIGSQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+F+PL KRLA GEWF ARVS+CG+FH+AY    + LKTELR  YS LC+DDMPMVR
Sbjct  121  DLVESFVPLVKRLAGGEWFAARVSACGIFHVAYQGCTDVLKTELRATYSQLCKDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>emb|CDY36104.1| BnaA08g19440D [Brassica napus]
Length=588

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIALLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG++HA V+LPPLE LC+VEET VREKAV+SLC+IGSQMKES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEHAHVILPPLESLCTVEETTVREKAVDSLCKIGSQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CGLFH+AY    + LKTELR+ Y  LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFHVAYQGCTDVLKTELRSSYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_006415878.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
 dbj|BAJ33743.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34231.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
Length=588

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA ELGVFIPYVGG++HA VLL PLE LC+VEETCVREKAV+SLC+IGSQM+ES
Sbjct  61   DEVLLAMAGELGVFIPYVGGIEHAHVLLSPLESLCTVEETCVREKAVDSLCKIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAGEWF ARVS+CGLF +AY    + LKTELR+IYS LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGEWFAARVSACGLFPVAYQGCTDVLKTELRSIYSQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_001777048.1| predicted protein [Physcomitrella patens]
 gb|EDQ58162.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKN+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  4    MAMVDEPLYPIAILIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  63

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA+ELG FI +VGGVD+A VLLPPLE LC+VEET VR+KAVESLC+IGSQMKE 
Sbjct  64   DEVLLAMADELGGFIAHVGGVDYAHVLLPPLESLCTVEETVVRDKAVESLCKIGSQMKER  123

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRL AGEWFTARVS+CGLFHIAYPSAP+ L+ ELR++Y+ LC DDMPMVR
Sbjct  124  DVVEWFIPLVKRLGAGEWFTARVSACGLFHIAYPSAPDLLRAELRSVYNQLCHDDMPMVR  183

Query  678  RAAA  689
            R+AA
Sbjct  184  RSAA  187



>emb|CAA57527.1| 65 kDa regulatory subunit of protein phosphatase 2A [Arabidopsis 
thaliana]
Length=590

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG++ A VLLPPLE LC+VEETCVR KAVESLC+IGSQMKE+
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEFAHVLLPPLESLCTVEETCVRGKAVESLCKIGSQMKEN  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLVE+F+PL KRLA GEWF ARVS+CG+FH+AY    + LKTELR  YS LC+DDMPMVR
Sbjct  121  DLVESFVPLVKRLAGGEWFAARVSACGIFHVAYQGCTDVLKTELRATYSQLCKDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_009109883.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
 ref|XP_009109885.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
Length=588

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKN+DIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIALLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIP+VGG++HA ++LPPLE LC+VEET VREKAV+SLC+IGSQMKES
Sbjct  61   DEVLLAMAEELGVFIPFVGGIEHAHMILPPLESLCTVEETTVREKAVDSLCKIGSQMKES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL KRLAAG+WF ARVS+CGLFH+AY    + LKTELR+ Y  LCQDDMPMVR
Sbjct  121  DLVDSFVPLVKRLAAGKWFAARVSACGLFHVAYQGCTDVLKTELRSSYGQLCQDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>ref|XP_002973833.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
 ref|XP_002983557.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ15458.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ24788.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
Length=580

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +3

Query  144  IMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDE  323
            +++EPLYPIA+LIDELKNEDI LRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDE
Sbjct  1    MVDEPLYPIAILIDELKNEDIHLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDE  60

Query  324  VLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDL  503
            VLLAMAEELG FIPYVGGVD+A VLLPPLE LC+V+ET VREKAVESLCRIGSQMKE DL
Sbjct  61   VLLAMAEELGAFIPYVGGVDYAYVLLPPLETLCTVDETIVREKAVESLCRIGSQMKEKDL  120

Query  504  VEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRA  683
            V+ FIPL KRL A EWFT+R+S+C LFH+AYPSAPE  ++ELR++Y+ LC DD+PMVRR+
Sbjct  121  VDWFIPLVKRLGADEWFTSRISACCLFHVAYPSAPEATRSELRSVYNHLCHDDLPMVRRS  180

Query  684  AA  689
            AA
Sbjct  181  AA  182



>ref|XP_001775815.1| predicted protein [Physcomitrella patens]
 gb|EDQ59354.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   313 bits (803),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKN+DIQLRLNSIRRLSTIARALGE+RTRKELIPFLSENNDDD
Sbjct  4    MAMVDEPLYPIAILIDELKNDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLSENNDDD  63

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA+ELG FIPYVGGVD+A VLL PLE LC+VEET VR+K+VESLC+IGSQMKE 
Sbjct  64   DEVLLAMADELGGFIPYVGGVDYAHVLLSPLESLCTVEETVVRDKSVESLCKIGSQMKER  123

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRL AGEWFTARVS+CGLFH+AYPS+P+ L+ ELR++Y+ LC D+MPMVR
Sbjct  124  DVVEWFIPLVKRLGAGEWFTARVSACGLFHVAYPSSPDLLRAELRSVYNQLCHDEMPMVR  183

Query  678  RAAA  689
            R+AA
Sbjct  184  RSAA  187



>ref|XP_001769725.1| predicted protein [Physcomitrella patens]
 gb|EDQ65526.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELK++DIQLRLNSIRRLSTIARALGE+RTRKELIPFL ENNDDD
Sbjct  4    MAMVDEPLYPIAILIDELKSDDIQLRLNSIRRLSTIARALGEDRTRKELIPFLCENNDDD  63

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA+ELG FI Y+GGV++A VLLPPLE LC+VEET VR+KAVESLC+IG+QMKE 
Sbjct  64   DEVLLAMADELGGFISYIGGVEYAHVLLPPLENLCTVEETVVRDKAVESLCKIGAQMKER  123

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            D+VE FIPL KRL AGEWFTARVS+CGLFHIAYPSAP+ L+ ELR++Y+ LC DDMPMVR
Sbjct  124  DVVEWFIPLVKRLGAGEWFTARVSACGLFHIAYPSAPDLLRAELRSVYNQLCHDDMPMVR  183

Query  678  RAAA  689
            R+AA
Sbjct  184  RSAA  187



>emb|CDY42101.1| BnaA09g28590D [Brassica napus]
Length=589

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIA+LIDELKN+DIQLRLNSIRRLSTI+RALGEERTRKELIPFLSEN+DDD
Sbjct  1    MAMVDEPLYPIALLIDELKNDDIQLRLNSIRRLSTISRALGEERTRKELIPFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFI YVGG++HA VLLPPLE LC+VEET VREKAV+SLC+IGSQM+ES
Sbjct  61   DEVLLAMAEELGVFILYVGGLEHAHVLLPPLESLCTVEETSVREKAVDSLCKIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
            DLV++F+PL K LAAGEWF ARVS+CGLFH+AY    + LKTELR+ YS LC+DDMPMVR
Sbjct  121  DLVDSFVPLVKILAAGEWFAARVSACGLFHVAYQGCTDVLKTELRSSYSQLCKDDMPMVR  180

Query  678  RAAA  689
            RAAA
Sbjct  181  RAAA  184



>emb|CAA66487.1| protein phosphatase 2A [Nicotiana tabacum]
Length=586

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 168/184 (91%), Gaps = 1/184 (1%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            + ++++PLYPI VLID+LK ++ QLRLNSIRRLSTIARALGEE+TRKELIPFLSENNDDD
Sbjct  1    MPMVDDPLYPIPVLIDDLKTDEKQLRLNSIRRLSTIARALGEEKTRKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
             EVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+K VESLCRIGSQM+ES
Sbjct  61   -EVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKPVESLCRIGSQMRES  119

Query  498  DLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVR  677
             LV+ F+PL KRLAAGEWFTARVS+CGLFHIAY SAPE LK ELR+IYS LCQDDMPMVR
Sbjct  120  GLVDWFVPLVKRLAAGEWFTARVSACGLFHIAYSSAPEMLKAELRSIYSQLCQDDMPMVR  179

Query  678  RAAA  689
            R+A 
Sbjct  180  RSAT  183



>emb|CDY03849.1| BnaC07g10740D [Brassica napus]
Length=529

 Score =   295 bits (754),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 166/186 (89%), Gaps = 2/186 (1%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPI VLIDELKN+DIQLRLN I RLSTIARALGEERTRKELI FLSEN+DDD
Sbjct  1    MAMVDEPLYPIDVLIDELKNDDIQLRLNFICRLSTIARALGEERTRKELIHFLSENSDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMA EL VFIP+VGGV+HA VLLPPLE LC+VEETCVREK V+SLC+IGS+M+ES
Sbjct  61   DEVLLAMAGELVVFIPFVGGVEHAHVLLPPLESLCTVEETCVREKVVDSLCKIGSEMRES  120

Query  498  DLVEAFIPLAK--RLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPM  671
            DLV++F+PL K  +LAAGEWF ARVS+CGLFH+ Y    + LKTEL++IY+ LCQDDMPM
Sbjct  121  DLVDSFVPLVKVRQLAAGEWFAARVSACGLFHVPYQGCTDVLKTELQSIYNQLCQDDMPM  180

Query  672  VRRAAA  689
            VRRAAA
Sbjct  181  VRRAAA  186



>ref|XP_002988290.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
 gb|EFJ10709.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
Length=584

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            +++EEPLYPIAVLIDELKN+D+QLR+NS+RRLSTIARALGE+RTR+ELIPFL++ +DDD+
Sbjct  3    AMVEEPLYPIAVLIDELKNDDVQLRINSVRRLSTIARALGEDRTRRELIPFLADGSDDDE  62

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLAMAEELG  +PYVGGV++A  LLPPLE LC VEE+ VREKAV SLC+I S M E D
Sbjct  63   EVLLAMAEELGNLVPYVGGVEYAHSLLPPLEALCDVEESAVREKAVASLCKIASVMNERD  122

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            LVE F P+ KRLAAGEWFTARVS CGL HI YPSAPE L+ ELRTIY+ L  DDMP+VRR
Sbjct  123  LVEWFAPVVKRLAAGEWFTARVSVCGLLHIVYPSAPELLRAELRTIYNQLSHDDMPLVRR  182

Query  681  AA  686
            AA
Sbjct  183  AA  184



>ref|XP_002963887.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
 gb|EFJ35758.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
Length=587

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            +++EEPLYPIAVLIDELKN+D+QLR+NS+RRLSTIARALGE+RTR+ELIPFL++ +DDD+
Sbjct  3    AMVEEPLYPIAVLIDELKNDDVQLRINSVRRLSTIARALGEDRTRRELIPFLADGSDDDE  62

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLAMAEELG  +PYVGGV++A  LLPPLE LC VEE+ VREKAV SLC+I S M E D
Sbjct  63   EVLLAMAEELGNLVPYVGGVEYAHSLLPPLEALCDVEESAVREKAVASLCKIASVMNERD  122

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            LVE F P+ KRLAAGEWFTARVS CGL HI YPSAPE L+ ELRTIY+ L  DDMP+VRR
Sbjct  123  LVEWFAPVVKRLAAGEWFTARVSVCGLLHIVYPSAPELLRAELRTIYNQLSHDDMPLVRR  182

Query  681  AA  686
            AA
Sbjct  183  AA  184



>ref|XP_006367043.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=585

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYP+  ++DELKN+DIQLRLNSIRRLS+IA  LGE+RTR+ELIPFL  N DD+DEVLLAM
Sbjct  8    LYPM--VLDELKNDDIQLRLNSIRRLSSIACQLGEDRTRRELIPFLCRNTDDEDEVLLAM  65

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            +EELG FIPYVGGV+HA VLLP L  LC+VEE CVR+KAVESLCRIGSQM+ESDL++ F+
Sbjct  66   SEELGGFIPYVGGVEHAHVLLPLLGTLCTVEEICVRDKAVESLCRIGSQMRESDLIDRFV  125

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             L KRLAAGEWFTARVS+CGLFHIAYPS+PE LK ELR+IYS L QDDMPMVRR+AA
Sbjct  126  SLVKRLAAGEWFTARVSACGLFHIAYPSSPEMLKAELRSIYSQLSQDDMPMVRRSAA  182



>ref|XP_010319425.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Solanum lycopersicum]
Length=549

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYP+  ++DELKN+DIQLRLNS+RRLS+IA  LGE+RTR+ELIPFL  N DD+DEVLLAM
Sbjct  6    LYPM--ILDELKNDDIQLRLNSVRRLSSIACQLGEDRTRRELIPFLCRNTDDEDEVLLAM  63

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            +EELG FIPYVGGV+HA VLLP L  LC+VEE CVR+KAVESLCRIGSQM+ESDL++ F+
Sbjct  64   SEELGGFIPYVGGVEHAHVLLPLLGTLCTVEEICVRDKAVESLCRIGSQMRESDLIDWFV  123

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             L KRLAAGEWFTARVS+CGLFHIAYPS+PE LK ELR+IY  L QDDMPMVRR+AA
Sbjct  124  SLVKRLAAGEWFTARVSACGLFHIAYPSSPEMLKAELRSIYGQLSQDDMPMVRRSAA  180



>ref|XP_004236962.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Solanum lycopersicum]
Length=583

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYP+  ++DELKN+DIQLRLNS+RRLS+IA  LGE+RTR+ELIPFL  N DD+DEVLLAM
Sbjct  6    LYPM--ILDELKNDDIQLRLNSVRRLSSIACQLGEDRTRRELIPFLCRNTDDEDEVLLAM  63

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            +EELG FIPYVGGV+HA VLLP L  LC+VEE CVR+KAVESLCRIGSQM+ESDL++ F+
Sbjct  64   SEELGGFIPYVGGVEHAHVLLPLLGTLCTVEEICVRDKAVESLCRIGSQMRESDLIDWFV  123

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             L KRLAAGEWFTARVS+CGLFHIAYPS+PE LK ELR+IY  L QDDMPMVRR+AA
Sbjct  124  SLVKRLAAGEWFTARVSACGLFHIAYPSSPEMLKAELRSIYGQLSQDDMPMVRRSAA  180



>ref|XP_006441864.1| hypothetical protein CICLE_v10022447mg [Citrus clementina]
 gb|ESR55104.1| hypothetical protein CICLE_v10022447mg [Citrus clementina]
Length=185

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +++++EPLYPIAVLIDELKN+DIQLRLNSIRRLSTIARALGEERT KELIPFLSENNDDD
Sbjct  1    MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTPKELIPFLSENNDDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPYVGGV+HA VLLPPLE LC+VEETC+R+KAVESLCRIGSQM+ES
Sbjct  61   DEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCMRDKAVESLCRIGSQMRES  120

Query  498  DLVEAFIPLAKRLAAGEWFTARVSS  572
            DLV+ FIPL KRLAAGEWFTARVS+
Sbjct  121  DLVDWFIPLVKRLAAGEWFTARVSA  145



>ref|XP_007142892.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
 gb|ESW14886.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
Length=545

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  264  ERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCV  443
            ERTR+ELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGV+HASVLLPPLE LC+VEETCV
Sbjct  1    ERTRRELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVEHASVLLPPLETLCTVEETCV  60

Query  444  REKAVESLCRIGSQMKESDLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKT  623
            R+KAVESLCRIGSQM+ESDLVE FIPL KRLAAGEWFTARVS+CGLFHIAYPSAPE  KT
Sbjct  61   RDKAVESLCRIGSQMRESDLVEYFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPETSKT  120

Query  624  ELRTIYSXLCQDDMPMVRRAAA  689
            ELR+IYS LCQDDMPMVRR+AA
Sbjct  121  ELRSIYSQLCQDDMPMVRRSAA  142



>emb|CDX84993.1| BnaC05g20620D [Brassica napus]
Length=422

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  210  LRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAMAEELGVFIPYVGGVDHA  389
            LRLNSI RLSTI+RALGEERTRKELIPFLSEN+ D+DEVLLAMAEELGVFIPYVGGV+HA
Sbjct  67   LRLNSIHRLSTISRALGEERTRKELIPFLSENSGDNDEVLLAMAEELGVFIPYVGGVEHA  126

Query  390  SVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFIPLAKRLAAGEWFTARVS  569
             VLLPPLE LC+VEET VREKAV+SLC+IG QM+ESDLV++F+PL KRLA GEWF ARVS
Sbjct  127  HVLLPPLESLCTVEETSVREKAVDSLCKIGFQMRESDLVDSFVPLVKRLAVGEWFAARVS  186

Query  570  SCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
            +CGLFH+ Y    + LKTELR+ YS L +DDMPMV+RAAA
Sbjct  187  ACGLFHVLYQGCTDVLKTELRSSYSQLFKDDMPMVQRAAA  226



>ref|XP_009764796.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=601

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 153/186 (82%), Gaps = 3/186 (2%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDD-  314
            +S+  E      VLIDEL NED  LRLNS+R+LSTIARALG ERTR E I ++ EN DD 
Sbjct  1    MSMSNESASLAVVLIDELMNEDSDLRLNSMRQLSTIARALGVERTRTEFIQYIRENFDDE  60

Query  315  -DDEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMK  491
             D+EVLL MA++LGVFIPYVGGV++A+VLLPPLEGLC V ETCVR+KAVESLC+IGSQM+
Sbjct  61   YDEEVLLKMAQQLGVFIPYVGGVEYATVLLPPLEGLCRVGETCVRDKAVESLCKIGSQMR  120

Query  492  ESDLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPM  671
            E DL+E+FIPL K+LA  EW TA+ SSCGLFHIAYP+A EPL+ ELRT+Y+ LC ++ P+
Sbjct  121  EPDLIESFIPLLKKLADKEW-TAQSSSCGLFHIAYPNATEPLREELRTLYNQLCHNETPL  179

Query  672  VRRAAA  689
            VR+AAA
Sbjct  180  VRKAAA  185



>gb|KIY96952.1| Serine/threonine-protein phosphatase 2A regulatory subunit A 
beta isoform [Monoraphidium neglectum]
Length=546

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +E L PIA+LIDELKN++   RLNSI+RLSTIA ALGEERTR ELIPFL+E+NDD+DEVL
Sbjct  8    DEKLLPIAILIDELKNDEAVRRLNSIQRLSTIALALGEERTRTELIPFLTESNDDEDEVL  67

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LAMAEELG F+PYVGG   A  LLPPLE L  VEET VR+KAVESLC++G ++ +  + E
Sbjct  68   LAMAEELGKFVPYVGGPAFAHHLLPPLENLSQVEETVVRDKAVESLCKVGEKLPDQSVAE  127

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
              +PL KRLA GEWFT+RVSSCGLF +AY  AP   +TELR +Y  LC D+ PMVRRAAA
Sbjct  128  YLVPLIKRLAQGEWFTSRVSSCGLFTVAYQRAPPATRTELRQLYGQLCHDETPMVRRAAA  187



>gb|ADV40147.1| putative protein phosphatase 2A regulatory subunit A [Latrodectus 
hesperus]
Length=302

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDEL+NED+QLRLNSI++LSTIA ALG ERTR ELIPFL++   D+D
Sbjct  6    SNTDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I  Q   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNISQQHSAAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L + F+PL KRLA+G+WFT+R S+CGLF + Y     PLK ELR  +  LCQDD PMVRR
Sbjct  126  LEQHFVPLVKRLASGDWFTSRTSACGLFSVCYSRLSAPLKAELRNHFRNLCQDDTPMVRR  185

Query  681  AAA  689
            AAA
Sbjct  186  AAA  188



>ref|XP_008217607.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Nasonia vitripennis]
Length=590

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    STADDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRTELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG D+   LLPPLE L +VEET VR+KAVESL  I SQ   SD
Sbjct  66   EVLLALAEQLGTFTPLVGGPDYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPSD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + Y    +P+K ELR  +  LCQDD PMVRR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYYRVSQPIKAELRNHFRNLCQDDTPMVRR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_001600229.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Nasonia vitripennis]
Length=590

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    STADDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRTELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG D+   LLPPLE L +VEET VR+KAVESL  I SQ   SD
Sbjct  66   EVLLALAEQLGTFTPLVGGPDYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPSD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + Y    +P+K ELR  +  LCQDD PMVRR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYYRVSQPIKAELRNHFRNLCQDDTPMVRR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>emb|CAA10285.1| protein phosphatase [Cicer arietinum]
Length=538

 Score =   242 bits (617),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  291  FLSENNDDDDEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLC  470
            FLSENNDDDDEVLLA AEELGVF+PYVGGV++ASVLLPPLE LC+VEETCVR+K+VESLC
Sbjct  3    FLSENNDDDDEVLLATAEELGVFVPYVGGVEYASVLLPPLETLCTVEETCVRDKSVESLC  62

Query  471  RIGSQMKESDLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXL  650
            RIG+QM+E DLVE FIPL KRLA+GEWFTARVSSCGLFHIAYPSA E LKTELR IY  L
Sbjct  63   RIGAQMREQDLVEHFIPLVKRLASGEWFTARVSSCGLFHIAYPSASEGLKTELRAIYGQL  122

Query  651  CQDDMPMVRRAAA  689
            CQDDMPMVRR+AA
Sbjct  123  CQDDMPMVRRSAA  135



>ref|XP_009616233.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
Length=583

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 156/186 (84%), Gaps = 3/186 (2%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSEN--ND  311
            +S+ +E  Y  AVLIDEL NED +LRLNS+R+LSTIARALG ERTR E I ++ EN  ++
Sbjct  1    MSMSDESAYGAAVLIDELMNEDRELRLNSMRQLSTIARALGVERTRTEFIQYIRENFDDE  60

Query  312  DDDEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMK  491
            DD+EVLL MAE+LGVFIPYVGG +HA+VLLPPL+GLCS  E+ VR+KAVESLC+IGSQM+
Sbjct  61   DDEEVLLEMAEQLGVFIPYVGGAEHATVLLPPLKGLCSDGESRVRDKAVESLCKIGSQMR  120

Query  492  ESDLVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPM  671
            E DL+E+FIPL KRL   EW TA++SSCGLFHI YP+APEP++ ELRT+Y+ LC DD P+
Sbjct  121  EPDLIESFIPLLKRLTDKEW-TAQISSCGLFHIGYPNAPEPVRKELRTLYNQLCHDDTPL  179

Query  672  VRRAAA  689
            VR+AAA
Sbjct  180  VRKAAA  185



>ref|XP_005644559.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20015.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
Length=589

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+ LRLNS+RRLSTIA ALGEERTR+ELIPF+SE+NDD+DEVL
Sbjct  7    DDGLYPIAVLIDELKNEDVALRLNSVRRLSTIALALGEERTRRELIPFVSESNDDEDEVL  66

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AEELG FIPYVGG ++  VLL PLE LC+VEET VR+KAV+SL  I S++    + E
Sbjct  67   LALAEELGRFIPYVGGPEYGHVLLSPLENLCTVEETVVRDKAVQSLAAIASELPTKSVSE  126

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAY-PSAPEPLKTELRTIYSXLCQDDMPMVRRAA  686
             F+PL KRLA GEWFT+R+S CGL  +A+  S  E    ELR +Y  L QDD PMVRRAA
Sbjct  127  YFVPLVKRLAGGEWFTSRISCCGLLPVAHRVSTQESELQELRGLYRVLSQDDTPMVRRAA  186

Query  687  A  689
            A
Sbjct  187  A  187



>ref|XP_008479235.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like, partial [Diaphorina citri]
Length=420

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG+ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I +Q    DL  
Sbjct  69   LALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEA  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR+ +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMVRRAAA  188



>ref|XP_011501051.1| PREDICTED: serine/threonine-protein phosphatase PP2A 65 kDa regulatory 
subunit [Ceratosolen solmsi marchali]
Length=590

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG D    LLPPLE L +VEET VR+KAVESL  I +Q   +DL E
Sbjct  69   LALAEQLGNFTPLVGGPDFVHSLLPPLEQLAAVEETVVRDKAVESLRNIAAQHSAADLEE  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RLA+G+WFT+R S+CGLF + YP   +P+K ELR+ +  LCQDD PMVRR+AA
Sbjct  129  HFVPLVQRLASGDWFTSRTSACGLFSVCYPRVFQPVKAELRSHFRNLCQDDTPMVRRSAA  188



>ref|XP_011558037.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Plutella xylostella]
Length=311

 Score =   231 bits (588),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  +E LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SGTDESLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG FI +VGG + A  LLPPLE L +VEET VR+KAV SL  + +      
Sbjct  66   EVLLALAEQLGNFINHVGGGEFAHCLLPPLESLATVEETVVRDKAVASLRAVAAHHSPQA  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L + F+PL +RLA G+WFT+R S+CGLF + YP    P+K ELR  +  LCQDD PMVRR
Sbjct  126  LEQHFVPLVQRLAGGDWFTSRASACGLFSVCYPRVSLPVKAELRQHFRTLCQDDTPMVRR  185

Query  681  AAA  689
            AAA
Sbjct  186  AAA  188



>ref|XP_011266575.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Camponotus floridanus]
Length=590

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>gb|EFN73589.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Camponotus floridanus]
Length=601

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011266584.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Camponotus floridanus]
Length=590

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011144206.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Harpegnathos saltator]
 gb|EFN81456.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Harpegnathos saltator]
Length=590

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ    D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPVD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +KTELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVGPAIKTELRNHFRGLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>gb|KHJ82027.1| HEAT repeat protein, partial [Oesophagostomum dentatum]
Length=274

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+ LRLNSIR+LSTIA ALG ERTR ELI FL++   D+DEVL
Sbjct  10   DDSLYPIAVLIDELRNEDVHLRLNSIRKLSTIALALGVERTRNELIQFLTDTIYDEDEVL  69

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            L +AE+LG F P VGG D+   LLPPLE L +VEET VR+KAVESL +I  +   + L E
Sbjct  70   LILAEQLGNFTPLVGGPDYVHCLLPPLENLATVEETVVRDKAVESLRKIADKHSTAALEE  129

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             FIP+ KRLA G+WFT+R S+CGLF +AYP     +K ELR+++  LC+DD PMVRRAAA
Sbjct  130  YFIPMLKRLATGDWFTSRTSACGLFSVAYPRVSPAIKAELRSLFRQLCRDDTPMVRRAAA  189



>ref|XP_011144205.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Harpegnathos saltator]
Length=590

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ    D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPVD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +KTELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVGPAIKTELRNHFRGLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>gb|AFL91512.1| phosphatase-like protein, partial [Panonychus citri]
Length=585

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYPIAVLIDEL+NED+Q+RLNSI++LSTI+ ALG ERTR ELIPFL+E   D+DEVLLA+
Sbjct  12   LYPIAVLIDELRNEDVQIRLNSIKKLSTISLALGVERTRSELIPFLTETIYDEDEVLLAL  71

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            AE+LG F P VGGV++ + LLPPLE L +VEET VREKAV+SL  I  Q    DL   F+
Sbjct  72   AEQLGNFTPLVGGVEYVNCLLPPLESLATVEETIVREKAVDSLRNISQQHSPQDLETHFV  131

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
            PL +RL++G+WFT R S+CGLF + YP    P+K ELRT +  LCQDD PMVRRAAA
Sbjct  132  PLVRRLSSGDWFTTRTSACGLFSVCYPRVSAPVKAELRTNFRALCQDDTPMVRRAAA  188



>dbj|BAN21528.1| serine/threonine protein phosphatase 2a regulatory subunit a, 
partial [Riptortus pedestris]
Length=464

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYPIAVLIDELKNED+QLRLNSI++LSTI+ ALG ERTR ELIPFL++   D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTISLALGVERTRSELIPFLTDTIYDEDEVLLAL  71

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ   SDL   F+
Sbjct  72   AEQLGQFTPLVGGPEYVYCLLPPLESLATVEETVVRDKAVESLRYISSQHSVSDLENRFV  131

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
            PL  RLA+G+WFT+R S+CGLF + Y     P+K ELRT +  LCQDD PMVRRAAA
Sbjct  132  PLVTRLASGDWFTSRTSACGLFSVCYGRVSIPVKAELRTHFRNLCQDDTPMVRRAAA  188



>ref|XP_008479230.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
2A 65 kDa regulatory subunit A alpha isoform-like [Diaphorina 
citri]
Length=593

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG+ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I +Q    DL  
Sbjct  69   LALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEA  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR+ +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMVRRAAA  188



>ref|XP_011336007.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Cerapachys biroi]
Length=590

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SATDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIAAQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPTIKGELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011336006.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Cerapachys biroi]
 gb|EZA56198.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Cerapachys biroi]
Length=590

 Score =   236 bits (601),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SATDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIAAQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPTIKGELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011694196.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Wasmannia auropunctata]
Length=590

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011166786.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Solenopsis invicta]
 ref|XP_011645755.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Pogonomyrmex barbatus]
Length=590

 Score =   235 bits (600),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011863883.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Vollenhovia emeryi]
Length=590

 Score =   235 bits (600),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011863882.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Vollenhovia emeryi]
Length=590

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011166784.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Solenopsis invicta]
 ref|XP_011645756.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Pogonomyrmex barbatus]
Length=590

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_012062306.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Atta cephalotes]
Length=590

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>gb|EFZ13522.1| hypothetical protein SINV_04974, partial [Solenopsis invicta]
Length=589

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011062133.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Acromyrmex echinatior]
Length=590

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPVIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>gb|EGI60796.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Acromyrmex echinatior]
Length=603

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPVIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>gb|EHJ67187.1| protein phosphatase 2, regulatory subunit A, alpha isoform [Danaus 
plexippus]
Length=324

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  +E LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR EL+PFL+E   D+D
Sbjct  6    SGTDESLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELVPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG FI  VGG ++A  LLPPLE L ++EET VR+KAV SL  + +      
Sbjct  66   EVLLALAEQLGNFINLVGGGEYAHCLLPPLESLATIEETVVRDKAVASLRAVAAHHSPQA  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L + F+PL +RLA G+WFT+R S+CGL+ + YP    P+K ELR  +  LCQDD PMVRR
Sbjct  126  LEQHFVPLVQRLAGGDWFTSRASACGLYSVCYPRVSAPVKAELREHFRVLCQDDTPMVRR  185

Query  681  AAA  689
            AAA
Sbjct  186  AAA  188



>ref|XP_002406082.1| protein phosphatase 2A regulatory subunit A, putative [Ixodes 
scapularis]
 gb|EEC03446.1| protein phosphatase 2A regulatory subunit A, putative [Ixodes 
scapularis]
Length=597

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            E+ LYPIAVLIDEL+NED+QLRLNSI++LSTIA ALG ERTR ELIPFL++   D+DEVL
Sbjct  9    EDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I  Q   SDL +
Sbjct  69   LALAEQLGNFTPLVGGSEFVHCLLPPLESLATVEETVVRDKAVESLRHISQQHSPSDLEQ  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL KRLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PMVRRAAA
Sbjct  129  YFVPLVKRLASGDWFTSRTSACGLFSVCYPRVSATVKGELRNHFRNLCQDDTPMVRRAAA  188



>ref|XP_011062132.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Acromyrmex echinatior]
Length=590

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+D
Sbjct  6    SNTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG +    LLPPLE L +VEET VR+KAVESL  I SQ   +D
Sbjct  66   EVLLALAEQLGTFTPLVGGPEFVHCLLPPLESLATVEETVVRDKAVESLRNIASQHSPAD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL +RLA+G+WFT+R S+CGLF + YP     +K ELR  +  LCQDD PM RR
Sbjct  126  LEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPVIKAELRNHFRSLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>dbj|BAH72359.1| ACYPI002758 [Acyrthosiphon pisum]
Length=280

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVLLA+
Sbjct  18   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRVELIPFLTETIYDEDEVLLAL  77

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            AE+LG F  YVGG D A  LLPPLE L +VEET VR+KAVESL +I      +DL   F+
Sbjct  78   AEQLGNFTNYVGGPDFAYTLLPPLESLATVEETVVRDKAVESLRQIAVLHSPTDLENHFV  137

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             L  RLA+G+WFT+R S+CGLF + Y      +K+ELR  +  LCQDD PMVRRAAA
Sbjct  138  SLVIRLASGDWFTSRTSACGLFSVCYSRVNPMIKSELRNFFRNLCQDDTPMVRRAAA  194



>ref|NP_001034525.1| protein phosphatase 2, regulatory subunit A, alpha isoform [Tribolium 
castaneum]
 emb|CAI45288.1| phosphatase [Tribolium castaneum]
 gb|EFA10293.1| hypothetical protein TcasGA2_TC012508 [Tribolium castaneum]
Length=590

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG FI  VGG ++A  LLPPLE L +VEET VR+KAVESL  +  Q   +DL  
Sbjct  69   LALAEQLGSFITLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLEN  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RL+AG+WFT+R S+CGLF + YP     +K +LR+ +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVQRLSAGDWFTSRTSACGLFSVCYPRVSAQMKADLRSHFRALCQDDTPMVRRAAA  188



>gb|KDR23265.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Zootermopsis nevadensis]
Length=591

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG DH   LLPPLE L +VEET VR+KAV+SL  I  Q    DL  
Sbjct  69   LALAEQLGSFTPLVGGSDHVHCLLPPLESLATVEETVVRDKAVDSLRAISGQHSPGDLEA  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RLA+G+WFT+R S+CGLF + Y      +K++LR  +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVQRLASGDWFTSRTSACGLFSVCYQRVGAAVKSDLRNHFRNLCQDDTPMVRRAAA  188



>ref|XP_002613476.1| hypothetical protein BRAFLDRAFT_119854 [Branchiostoma floridae]
 gb|EEN69485.1| hypothetical protein BRAFLDRAFT_119854 [Branchiostoma floridae]
Length=598

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+QLRLNSI++LSTIA ALG ERTR ELIPFL++   D+DEVL
Sbjct  7    DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVL  66

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG +H   LLPPLE L +VEET VR+KAVESL +I      +DL  
Sbjct  67   LALAEQLGNFTPLVGGQEHVHCLLPPLESLATVEETVVRDKAVESLRKIAGDHSSADLEA  126

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL KRLA G+WFT+R S+CGLF + YP     +K ELRT +  LC DD PMVRRAAA
Sbjct  127  HFVPLVKRLAQGDWFTSRTSACGLFSVPYPRVSSTVKAELRTNFRNLCGDDTPMVRRAAA  186



>gb|AAM48413.1| RE28669p [Drosophila melanogaster]
Length=307

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  147  MEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEV  326
            +++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALGEERTR ELIPFL+E   D+DEV
Sbjct  8    VDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGEERTRSELIPFLTETIYDEDEV  67

Query  327  LLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLV  506
            LLA+A++LG F   VGG + A  L+PPLE L +VEET VR+KAVESL  + ++    DL 
Sbjct  68   LLALADQLGNFTSLVGGPEFAMYLIPPLESLATVEETVVRDKAVESLRTVAAEHSAQDLE  127

Query  507  EAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAA  686
               +P  +RL +G+WFT+R S+CGLF + YP   +P+K ELR  +  LCQD+ PMVRRAA
Sbjct  128  IHVVPTLQRLVSGDWFTSRTSACGLFSVCYPRVTQPVKAELRANFRKLCQDETPMVRRAA  187

Query  687  A  689
            A
Sbjct  188  A  188



>ref|XP_002682119.1| phosphoprotein phosphatase A [Naegleria gruberi]
 gb|EFC49375.1| phosphoprotein phosphatase A [Naegleria gruberi]
Length=584

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENN-DDDDEV  326
            EE LYPIA+LIDELKNED+QLRLNSI+RL TIA ALG +RTR ELIPFL+E+  DD+DEV
Sbjct  7    EESLYPIAILIDELKNEDVQLRLNSIKRLGTIANALGADRTRYELIPFLNESCIDDEDEV  66

Query  327  LLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLV  506
            LLA+AEELG F+ YVGG +HA  L+ PLE LC+VEE  VREKAV+SLC+I ++MK     
Sbjct  67   LLALAEELGNFVQYVGGAEHAHCLILPLETLCNVEENSVREKAVKSLCKIANEMKALQHT  126

Query  507  EAFI-PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRA  683
            E +I PL ++L++G+WFT+R SSCGLF + Y    + ++ ELR  Y+ LC+D+ PMVRRA
Sbjct  127  EQYILPLVRKLSSGDWFTSRSSSCGLFSVLYSVVGKDIRAELRQTYAKLCKDETPMVRRA  186

Query  684  A  686
            A
Sbjct  187  A  187



>gb|ENN75423.1| hypothetical protein YQE_07974, partial [Dendroctonus ponderosae]
Length=592

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGLERTRIELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG FIP VGG ++A  LLPPLE L +VEET VR+KAVESL  +  Q   +DL  
Sbjct  69   LALAEQLGQFIPLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLET  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RL++G+WFT+R S CGLF   YP     +KT+LR  +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVERLSSGDWFTSRTSGCGLFAACYPRVSAHVKTDLRAHFKALCQDDTPMVRRAAA  188



>gb|ERL94150.1| hypothetical protein D910_11432 [Dendroctonus ponderosae]
Length=588

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGLERTRIELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG FIP VGG ++A  LLPPLE L +VEET VR+KAVESL  +  Q   +DL  
Sbjct  69   LALAEQLGQFIPLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLET  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RL++G+WFT+R S CGLF   YP     +KT+LR  +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVERLSSGDWFTSRTSGCGLFAACYPRVSAHVKTDLRAHFKALCQDDTPMVRRAAA  188



>gb|AEE63553.1| unknown [Dendroctonus ponderosae]
Length=600

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGLERTRIELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG FIP VGG ++A  LLPPLE L +VEET VR+KAVESL  +  Q   +DL  
Sbjct  69   LALAEQLGQFIPLVGGPEYAYCLLPPLESLATVEETVVRDKAVESLRAVAQQHSPADLET  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RL++G+WFT+R S CGLF   YP     +KT+LR  +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVERLSSGDWFTSRTSGCGLFAACYPRVSAHVKTDLRAHFKALCQDDTPMVRRAAA  188



>gb|ELT97469.1| hypothetical protein CAPTEDRAFT_152474 [Capitella teleta]
Length=591

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+QLRLNSI++L TIA ALG ERTRKELIPFL++   D+DEVL
Sbjct  9    DDSLYPIAVLIDELRNEDVQLRLNSIKKLGTIALALGVERTRKELIPFLTDTIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG DH   LLPPLE L +VEET VR+KAV+SL  I +Q   +DL  
Sbjct  69   LALAEQLGTFTPLVGGSDHVHCLLPPLESLATVEETVVRDKAVDSLRIIATQHSTADLEN  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL KRL++G+WFT+R S+CGLF + YP     +K EL   +  LC DD PMVRRAAA
Sbjct  129  HFVPLVKRLSSGDWFTSRTSACGLFSVCYPRVSNAVKVELGIHFRNLCGDDTPMVRRAAA  188



>gb|ERG81286.1| serine threonine-protein phosphatase 2a 65 kda regulatory subunit 
a beta isoform [Ascaris suum]
Length=594

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +E LYPIAVLIDEL+NED+QLRLNSIR+LSTIA ALG ERTR EL+ FL++   D+DEVL
Sbjct  11   DENLYPIAVLIDELRNEDVQLRLNSIRKLSTIALALGVERTRGELVQFLTDTIYDEDEVL  70

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG D+   LLPPLE L +VEET VR+KAVESL +I  +   + L E
Sbjct  71   LALAEQLGNFTPLVGGPDYVHCLLPPLENLATVEETVVRDKAVESLRKIAEKHSSAALEE  130

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             FIP+ +RLA G+WFT+R S+CGLF +AYP     +K ELR ++  LC+DD PMVRRAAA
Sbjct  131  HFIPMVRRLATGDWFTSRTSACGLFSVAYPRVGPAIKAELRNMFRALCRDDTPMVRRAAA  190



>ref|XP_001894294.1| protein phosphatase PP2A regulatory subunit [Brugia malayi]
 emb|CDP91086.1| Protein BM-PAA-1 [Brugia malayi]
Length=594

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIA+LIDEL+NED+QLRLNSIR+LSTIA ALG ERTR ELI FL++   D+DEVL
Sbjct  11   DDNLYPIAILIDELRNEDVQLRLNSIRKLSTIALALGVERTRGELIQFLTDTIYDEDEVL  70

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG D+   LLPPLE L +VEET VR+KAVESL +I  +   + L E
Sbjct  71   LALAEQLGNFTPLVGGPDYVYCLLPPLENLATVEETVVRDKAVESLRKIADKHSSAALEE  130

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             FIP+ +RLA G+WFT+R S+CGLF +AYP     +K+ELR ++  LC+DD PMVRRAAA
Sbjct  131  HFIPMIRRLATGDWFTSRTSACGLFSVAYPRVSPAIKSELRNLFRTLCRDDTPMVRRAAA  190



>ref|XP_005095307.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Aplysia californica]
Length=604

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +E LYPIAVLIDEL+NED+QLRLNSI++L TIA ALG ERTR ELIPFL++   D+DEVL
Sbjct  7    DESLYPIAVLIDELRNEDVQLRLNSIKKLGTIALALGVERTRSELIPFLTDTIYDEDEVL  66

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG +H   LLPPLE L +VEET VR+KAV+SL  I  Q  ++DL  
Sbjct  67   LALAEQLGSFTPLVGGPEHVHCLLPPLESLATVEETVVRDKAVDSLRIIADQHSQADLEN  126

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+P+ KRLA G+WFT+R S+CGLF + Y  A   +K ELR IY  LC DD PMVRRA A
Sbjct  127  FFVPMVKRLAGGDWFTSRTSACGLFSVCYKRASTNVKAELRQIYRNLCADDTPMVRRAVA  186



>gb|ERZ97088.1| hypothetical protein GLOINDRAFT_340356 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX70101.1| Tpd3p [Rhizophagus irregularis DAOM 197198w]
Length=590

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            E+ LYPIAVL+DEL+ +D+  RLN+IRRLSTIA ALG +RTR ELIPFL E+ DD+DEVL
Sbjct  8    EDSLYPIAVLLDELRADDVNFRLNAIRRLSTIALALGVQRTRDELIPFLDESIDDEDEVL  67

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AEELG F+ YVGG DHA ++L PLE L +VEET VR+KAVESL ++   + +  + E
Sbjct  68   LALAEELGNFVEYVGGKDHAHIILGPLENLAAVEETLVRDKAVESLTKVAIVLSQQQIEE  127

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             +IPL KRL +G+WFT+R S+CGL+  AY +A    + ELR+++  LCQDD PMVRRAAA
Sbjct  128  YYIPLIKRLGSGDWFTSRTSACGLYAAAYQTATPSSQDELRSMFKQLCQDDTPMVRRAAA  187



>gb|KDO70012.1| hypothetical protein CISIN_1g0068982mg, partial [Citrus sinensis]
Length=147

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  336  MAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAF  515
            MAEELGVFIPYVGGV+HA VLLPPLE LC+VEETCVR+KAVESLCRIGSQM+ESDLV+ +
Sbjct  1    MAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWY  60

Query  516  IPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
            IPL KRLAAGEWFTARVS+CGLFHIAYPSAP+ LKTELR+IY+ LCQDDMPMVRR+AA
Sbjct  61   IPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAA  118



>ref|XP_011312304.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Fopius arisanus]
Length=590

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG +RTR EL+PFL+E   D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGADRTRSELMPFLTETIYDEDEVLLAL  71

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            AE+LG F P VGG +H   LLPPLE L +VEET VR+KAVESL  I  Q   S L E F+
Sbjct  72   AEQLGSFTPLVGGPEHVHCLLPPLETLAAVEETVVRDKAVESLRNIAGQHNPSYLEEHFV  131

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
            PL +RLAAG+WFT+R S+CGL  + YP      K ELR  +  LCQDD PMVRR+AA
Sbjct  132  PLVQRLAAGDWFTSRTSACGLISVCYPRVSPATKAELRNHFRNLCQDDTPMVRRSAA  188



>ref|XP_011312305.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Fopius arisanus]
Length=590

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +3

Query  159  LYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVLLAM  338
            LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG +RTR EL+PFL+E   D+DEVLLA+
Sbjct  12   LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGADRTRSELMPFLTETIYDEDEVLLAL  71

Query  339  AEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVEAFI  518
            AE+LG F P VGG +H   LLPPLE L +VEET VR+KAVESL  I  Q   S L E F+
Sbjct  72   AEQLGSFTPLVGGPEHVHCLLPPLETLAAVEETVVRDKAVESLRNIAGQHNPSYLEEHFV  131

Query  519  PLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
            PL +RLAAG+WFT+R S+CGL  + YP      K ELR  +  LCQDD PMVRR+AA
Sbjct  132  PLVQRLAAGDWFTSRTSACGLISVCYPRVSPATKAELRNHFRNLCQDDTPMVRRSAA  188



>ref|XP_006747287.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Leptonychotes weddellii]
Length=407

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+QLRLNSI++LSTIA ALG ERTR EL+PFL++   D+DEVL
Sbjct  7    DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL  66

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F   VGG ++   LLPPLE L +VEET VR+KAVESL  I  +   SDL  
Sbjct  67   LALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEA  126

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL KRLA G+WFT+R S+CGLF + YP     +K ELR  +  LC DD PMVRRAAA
Sbjct  127  HFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAA  186



>ref|XP_011554286.1| PREDICTED: serine/threonine-protein phosphatase PP2A 65 kDa regulatory 
subunit [Plutella xylostella]
Length=590

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +E LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DESLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG FI +VGG + A  LLPPLE L +VEET VR+KAV SL  + +      L +
Sbjct  69   LALAEQLGNFINHVGGGEFAHCLLPPLESLATVEETVVRDKAVASLRAVAAHHSPQALEQ  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RLA G+WFT+R S+CGLF + YP    P+K ELR  +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVQRLAGGDWFTSRASACGLFSVCYPRVSLPVKAELRQHFRTLCQDDTPMVRRAAA  188



>ref|XP_002111654.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV25621.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=594

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  147  MEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEV  326
            +E+ +YPIAVLIDEL+NED+ LRLNSI++LSTIA ALG ERTR ELIPFL++   D+DEV
Sbjct  6    VEDSIYPIAVLIDELRNEDVALRLNSIKKLSTIALALGVERTRNELIPFLTDTIYDEDEV  65

Query  327  LLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLV  506
            LLA+AE+LG F P VGG DH  VLL PLE L +VEET VR+KAVESL  I  + K  DL 
Sbjct  66   LLALAEQLGNFTPLVGGSDHVYVLLAPLESLATVEETVVRDKAVESLRNIAVEHKPKDLE  125

Query  507  EAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAA  686
              F+PL KRL+ G+WFT+R S+CGLF + Y      +K+ELR  Y  LC DD PMVRRAA
Sbjct  126  SHFVPLVKRLSQGDWFTSRTSACGLFSVCYSRVNPNVKSELRNHYKMLCNDDTPMVRRAA  185

Query  687  A  689
            A
Sbjct  186  A  186



>ref|NP_001171792.1| protein phosphatase 2, regulatory subunit A, alpha [Saccoglossus 
kowalevskii]
Length=590

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+QLRLNSI++LSTIA ALG ERTR ELIPFL++   D+DEVL
Sbjct  8    DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTDTIYDEDEVL  67

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG  H   LLPPLE L +VEET VR+KAV+SL  I  +   SDL  
Sbjct  68   LALAEQLGSFTPLVGGPAHVHCLLPPLESLATVEETVVRDKAVDSLRNISEEHSASDLES  127

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL KRL+ G+WFT+R S+CGLF + YP     +K ELR  +  LC DD PMVRRAAA
Sbjct  128  HFVPLVKRLSGGDWFTSRTSACGLFSVCYPRVSNNMKAELRNNFRNLCGDDTPMVRRAAA  187



>gb|AEB77782.1| protein phosphatase 2 regulatory subunit A alpha isoform [Helicoverpa 
armigera]
Length=590

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +E LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E   D+DEVL
Sbjct  9    DESLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTRSELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG FI  VGG + A  LLPPLE L +VEET VR+KAV SL  + +      L +
Sbjct  69   LALAEQLGNFINLVGGGEFAHCLLPPLESLATVEETVVRDKAVASLRAVAAHHTPQALEQ  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RLA G+WFT+R S+CGLF + YP    P+K ELR  +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVQRLAGGDWFTSRASACGLFSVCYPRVSAPVKAELRQHFRSLCQDDTPMVRRAAA  188



>gb|KHN76768.1| putative serine/threonine-protein phosphatase PP2A regulatory 
subunit [Toxocara canis]
Length=696

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +E LYPIAVLIDEL+NED+QLRLNSIR+LSTIA ALG ERTR EL+ FL++   D+DEVL
Sbjct  11   DENLYPIAVLIDELRNEDVQLRLNSIRKLSTIALALGVERTRGELVQFLTDTIYDEDEVL  70

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG D+   LLPPLE L +VEET VR+KAVESL +I  +   + L E
Sbjct  71   LALAEQLGNFTPLVGGPDYVHCLLPPLENLATVEETVVRDKAVESLRKIAEKHSSAALEE  130

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             FIP+ +RLA G+WFT+R S+CGLF +AYP     +K ELR ++  LC+DD PMVRRAAA
Sbjct  131  HFIPMVRRLATGDWFTSRTSACGLFSVAYPRVGPAIKAELRNMFRALCRDDTPMVRRAAA  190



>gb|ERE60505.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
beta isoform-like isoform 1, partial [Cricetulus griseus]
Length=454

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+QLRLNSI++LSTIA ALG ERTR EL+PFL++   D+DEVL
Sbjct  7    DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL  66

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F   VGG ++   LLPPLE L +VEET VR+KAVESL  I  +   SDL  
Sbjct  67   LALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEA  126

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL KRLA G+WFT+R S+CGLF + YP     +K ELR  +  LC DD PMVRRAAA
Sbjct  127  HFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAA  186



>ref|XP_003136199.1| protein phosphatase PP2A regulatory subunit [Loa loa]
 gb|EFO27868.1| phosphatase PP2A regulatory subunit [Loa loa]
Length=657

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIA+LIDEL+NED+QLRLNSIR+LSTIA ALG ERTR ELI FL++   D+DEVL
Sbjct  74   DDNLYPIAILIDELRNEDVQLRLNSIRKLSTIALALGVERTRGELIQFLTDTIYDEDEVL  133

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG D+   LLPPLE L +VEET VR+KAVESL +I  +   + L E
Sbjct  134  LALAEQLGNFTPLVGGPDYVFCLLPPLENLATVEETVVRDKAVESLRKIADKHSSTALEE  193

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             FIP+ +RLA G+WFT+R S+CGLF +AYP     +K ELR ++  LC+DD PMVRRAAA
Sbjct  194  HFIPMIRRLATGDWFTSRTSACGLFSVAYPRVSPAIKAELRNLFRTLCRDDTPMVRRAAA  253



>ref|XP_008545083.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Microplitis demolitor]
Length=590

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR EL+PFL+E   D+D
Sbjct  6    SSTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGAERTRSELMPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ   + 
Sbjct  66   EVLLALAEQLGSFTPLVGGPEYVHCLLPPLEALAAVEETVVRDKAVESLRNIASQHSPTY  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L + F+PL +RLA+G+WFT+R S+CGL  + YP      K ELR  +  LCQDD PMVRR
Sbjct  126  LEDHFVPLVQRLASGDWFTSRTSACGLISVCYPRVSPATKAELRNHFRNLCQDDTPMVRR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_004922104.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Bombyx mori]
Length=590

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            +E LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERT+ ELIPFL+E   D+DEVL
Sbjct  9    DESLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTKSELIPFLTETIYDEDEVL  68

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG FI  VGG + A  LLPPLE L +VEET VR+KAV SL  +        L E
Sbjct  69   LALAEQLGSFINLVGGGEFAHCLLPPLETLAAVEETVVRDKAVASLRAVAEHHSPQALEE  128

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL +RLA G+WFT+R S+CGLF + YP    P+K ELR  +  LCQDD PMVRRAAA
Sbjct  129  HFVPLVQRLAGGDWFTSRTSACGLFSVCYPRVSAPVKAELRQHFRSLCQDDTPMVRRAAA  188



>ref|XP_008545088.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Microplitis demolitor]
Length=590

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR EL+PFL+E   D+D
Sbjct  6    SSTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGAERTRSELMPFLTETIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LLPPLE L +VEET VR+KAVESL  I SQ   + 
Sbjct  66   EVLLALAEQLGSFTPLVGGPEYVHCLLPPLEALAAVEETVVRDKAVESLRNIASQHSPTY  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L + F+PL +RLA+G+WFT+R S+CGL  + YP      K ELR  +  LCQDD PMVRR
Sbjct  126  LEDHFVPLVQRLASGDWFTSRTSACGLISVCYPRVSPATKAELRNHFRNLCQDDTPMVRR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_003738779.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Metaseiulus occidentalis]
Length=589

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDEL+NED+QLRLNSIRRLSTIA ALG ERTR ELIPFL++   D+D
Sbjct  6    STSDDSLYPIAVLIDELRNEDVQLRLNSIRRLSTIALALGVERTRSELIPFLTDTIYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG + A  LL PLE L +VEET VR+KAV+SL  +  Q   +D
Sbjct  66   EVLLALAEQLGQFTPLVGGAEFAHCLLLPLESLATVEETVVRDKAVDSLRALSQQHSATD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L   F+PL KRLA G+WFT+R S+CGLF + Y      +K ELR  +  LCQDD PMVRR
Sbjct  126  LENFFVPLVKRLATGDWFTSRTSACGLFSVCYERVSTTVKQELRDSFRNLCQDDTPMVRR  185

Query  681  AAA  689
            AAA
Sbjct  186  AAA  188



>emb|CDY04182.1| BnaA09g19600D [Brassica napus]
Length=130

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 5/135 (4%)
 Frame = +3

Query  138  LSIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD  317
            +S +EEPLYPI VLIDELKN+DIQLRLNSIRRLSTIARALGEE+TRKELIPFLSENN+DD
Sbjct  1    MSTIEEPLYPIVVLIDELKNDDIQLRLNSIRRLSTIARALGEEKTRKELIPFLSENNEDD  60

Query  318  DEVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKES  497
            DEVLLAMAEELGVFIPY GGV+HA+ LLPPLE L +VE     EKAVESLCR+G+QM+ES
Sbjct  61   DEVLLAMAEELGVFIPYAGGVEHANDLLPPLETLSTVE-----EKAVESLCRVGTQMRES  115

Query  498  DLVEAFIPLAKRLAA  542
            +LV+ F+PL KRLAA
Sbjct  116  ELVDHFLPLVKRLAA  130



>ref|XP_002119919.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Ciona intestinalis]
Length=587

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+QL+LNS+R+LSTIA ALG ERTR ELIPFL+++  D+DEVL
Sbjct  7    DDSLYPIAVLIDELRNEDVQLQLNSMRKLSTIALALGVERTRSELIPFLTDSMCDEDEVL  66

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG   A  LLPPLE L +VEET VR+KAV+SL  + +    +DL  
Sbjct  67   LALAEQLGSFTPLVGGNSFAHCLLPPLESLSTVEETVVRDKAVDSLRSVANDHSANDLEA  126

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
              IPL KRLA G+WFT+R S+CGLF + YP     LK ELRT++  LC DD PMVRRAAA
Sbjct  127  YMIPLIKRLATGDWFTSRTSACGLFSVVYPRVSSALKQELRTMFRNLCGDDTPMVRRAAA  186



>ref|XP_009060863.1| hypothetical protein LOTGIDRAFT_219170 [Lottia gigantea]
 gb|ESO88455.1| hypothetical protein LOTGIDRAFT_219170 [Lottia gigantea]
Length=590

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+QLRLNSI++LSTIA ALG+ERTR ELIPFL++   D+DEVL
Sbjct  8    DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGDERTRSELIPFLTDTIYDEDEVL  67

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG +H   LLPPLE L +VEET VR+KAV+SL  I +Q  ++DL  
Sbjct  68   LALAEQLGNFTPLVGGPEHVICLLPPLESLATVEETVVRDKAVDSLRLIAAQHSQADLEN  127

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+PL KRL+ G+WFT+R S+CGLF + Y      +K ELR  +  LC DD PMVRRAAA
Sbjct  128  HFVPLVKRLSLGDWFTSRTSACGLFAVCYSRVSNNVKAELRQHFRNLCGDDTPMVRRAAA  187



>ref|XP_001120202.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Apis mellifera]
 ref|XP_003690652.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Apis florea]
 ref|XP_006610479.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Apis dorsata]
Length=590

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E+  D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTESMYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LL PLE L +VEET VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGQFTPLVGGPEYVHCLLKPLESLATVEETVVRDKAVESLRTIAAQHSSTD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL  RLA G+WFT+R S+CGLF + YP     +K  LR  +  LCQDD PM RR
Sbjct  126  LEEQFVPLIHRLATGDWFTSRTSACGLFSVCYPRVSPTVKACLRNHFRNLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011662449.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X1 [Strongylocentrotus 
purpuratus]
 ref|XP_011662457.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X2 [Strongylocentrotus 
purpuratus]
Length=591

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+Q RLNSI++LSTIA ALG ERTR ELIPFL++   D+DEVL
Sbjct  8    DDSLYPIAVLIDELRNEDVQRRLNSIKKLSTIALALGVERTRGELIPFLTDTIYDEDEVL  67

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG +H   LLPPLE L +VEET VR+KAV+SL ++  +  ++DL  
Sbjct  68   LALAEQLGSFTPLVGGPEHVFCLLPPLESLATVEETVVRDKAVDSLRKLSEEHTQTDLEN  127

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+P+ KRLAAG+WFT+R S+CGLF + Y       K ELR +++ LC DD PMVRRAAA
Sbjct  128  HFVPMVKRLAAGDWFTSRTSACGLFSVCYKKCKNTTKGELRVLFNNLCSDDTPMVRRAAA  187



>ref|XP_006562820.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Apis mellifera]
 ref|XP_006610478.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Apis dorsata]
Length=590

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 137/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  141  SIMEEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDD  320
            S  ++ LYPIAVLIDELKNED+QLRLNSI++LSTIA ALG ERTR ELIPFL+E+  D+D
Sbjct  6    STTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTESMYDED  65

Query  321  EVLLAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESD  500
            EVLLA+AE+LG F P VGG ++   LL PLE L +VEET VR+KAVESL  I +Q   +D
Sbjct  66   EVLLALAEQLGQFTPLVGGPEYVHCLLKPLESLATVEETVVRDKAVESLRTIAAQHSSTD  125

Query  501  LVEAFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRR  680
            L E F+PL  RLA G+WFT+R S+CGLF + YP     +K  LR  +  LCQDD PM RR
Sbjct  126  LEEQFVPLIHRLATGDWFTSRTSACGLFSVCYPRVSPTVKACLRNHFRNLCQDDTPMARR  185

Query  681  AAA  689
            +AA
Sbjct  186  SAA  188



>ref|XP_011662461.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform isoform X3 [Strongylocentrotus 
purpuratus]
Length=588

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  150  EEPLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL  329
            ++ LYPIAVLIDEL+NED+Q RLNSI++LSTIA ALG ERTR ELIPFL++   D+DEVL
Sbjct  8    DDSLYPIAVLIDELRNEDVQRRLNSIKKLSTIALALGVERTRGELIPFLTDTIYDEDEVL  67

Query  330  LAMAEELGVFIPYVGGVDHASVLLPPLEGLCSVEETCVREKAVESLCRIGSQMKESDLVE  509
            LA+AE+LG F P VGG +H   LLPPLE L +VEET VR+KAV+SL ++  +  ++DL  
Sbjct  68   LALAEQLGSFTPLVGGPEHVFCLLPPLESLATVEETVVRDKAVDSLRKLSEEHTQTDLEN  127

Query  510  AFIPLAKRLAAGEWFTARVSSCGLFHIAYPSAPEPLKTELRTIYSXLCQDDMPMVRRAAA  689
             F+P+ KRLAAG+WFT+R S+CGLF + Y       K ELR +++ LC DD PMVRRAAA
Sbjct  128  HFVPMVKRLAAGDWFTSRTSACGLFSVCYKKCKNTTKGELRVLFNNLCSDDTPMVRRAAA  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1183832463410