BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11999

Length=810
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                226   2e-64   Sesamum indicum [beniseed]
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                216   8e-61   Nicotiana tomentosiformis
ref|XP_006369129.1|  subtilase family protein                           214   3e-60   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           213   6e-60   Solanum tuberosum [potatoes]
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                212   2e-59   Nicotiana sylvestris
emb|CDP20511.1|  unnamed protein product                                211   6e-59   Coffea canephora [robusta coffee]
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                211   6e-59   Erythranthe guttata [common monkey flower]
emb|CAN75240.1|  hypothetical protein VITISV_014207                     208   7e-59   Vitis vinifera
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                209   2e-58   Solanum lycopersicum
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                209   2e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   206   6e-58   Citrus sinensis [apfelsine]
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                207   1e-57   Populus euphratica
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                207   1e-57   Vitis vinifera
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                207   2e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     206   4e-57   Eucalyptus grandis [rose gum]
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                205   8e-57   Eucalyptus grandis [rose gum]
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             205   9e-57   Citrus clementina [clementine]
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                204   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                203   3e-56   Populus euphratica
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    202   4e-56   Elaeis guineensis
gb|KJB57037.1|  hypothetical protein B456_009G146000                    202   7e-56   Gossypium raimondii
gb|ACN34516.1|  unknown                                                 195   1e-55   Zea mays [maize]
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                201   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           201   2e-55   Solanum tuberosum [potatoes]
ref|XP_007024651.1|  Subtilase family protein                           200   3e-55   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           200   4e-55   Setaria italica
ref|NP_001146035.1|  uncharacterized protein LOC100279566               195   1e-54   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             198   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                197   3e-54   Vitis vinifera
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease                197   5e-54   Fragaria vesca subsp. vesca
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                197   5e-54   Phoenix dactylifera
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           196   8e-54   Citrus sinensis [apfelsine]
gb|KJB70156.1|  hypothetical protein B456_011G061400                    196   9e-54   Gossypium raimondii
gb|AFW73751.1|  putative subtilase family protein                       196   1e-53   
ref|XP_010111996.1|  Subtilisin-like protease                           196   2e-53   
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    195   2e-53   
emb|CAN75239.1|  hypothetical protein VITISV_014205                     194   4e-53   Vitis vinifera
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    193   1e-52   Medicago truncatula
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                192   2e-52   
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980          192   2e-52   Sorghum bicolor [broomcorn]
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             191   4e-52   Prunus persica
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                191   6e-52   Prunus mume [ume]
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                191   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ26761.1|  subtilisin-like protein                                 179   1e-51   Nicotiana benthamiana
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                190   2e-51   Malus domestica [apple tree]
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                189   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    189   3e-51   Cucumis melo [Oriental melon]
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             188   5e-51   Capsella rubella
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                188   7e-51   Camelina sativa [gold-of-pleasure]
gb|ACB87529.1|  subtilisin protease                                     186   9e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             187   1e-50   Phaseolus vulgaris [French bean]
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                187   1e-50   Nicotiana sylvestris
gb|ADW11233.1|  subtilisin-like protease 2                              187   2e-50   Phaseolus vulgaris [French bean]
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                186   3e-50   Camelina sativa [gold-of-pleasure]
gb|EPS74243.1|  subtilase family protein                                186   4e-50   Genlisea aurea
gb|KHN01421.1|  Subtilisin-like protease                                180   4e-50   Glycine soja [wild soybean]
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    185   7e-50   Arabis alpina [alpine rockcress]
gb|EAY87746.1|  hypothetical protein OsI_09161                          183   7e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                185   9e-50   Camelina sativa [gold-of-pleasure]
dbj|BAH20348.1|  AT3G14067                                              184   9e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001048301.1|  Os02g0779200                                       184   2e-49   
ref|XP_002885009.1|  subtilase family protein                           184   3e-49   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             184   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566473.2|  Subtilase family protein                              183   3e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CBI35855.3|  unnamed protein product                                187   3e-49   Vitis vinifera
emb|CDY33251.1|  BnaC01g37240D                                          183   3e-49   Brassica napus [oilseed rape]
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                182   5e-49   Brassica rapa
emb|CDY52259.1|  BnaC05g52030D                                          182   5e-49   Brassica napus [oilseed rape]
gb|EMT02947.1|  Subtilisin-like protease                                178   5e-49   
gb|AFW73750.1|  putative subtilase family protein                       182   6e-49   
emb|CDY39093.1|  BnaA01g29630D                                          182   6e-49   Brassica napus [oilseed rape]
gb|AGN03879.1|  senescence-associated subtilisin protease               182   7e-49   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ93208.1|  predicted protein                                      182   7e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87876.1|  predicted protein                                      182   8e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX97539.1|  BnaA05g25400D                                          178   2e-48   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease SBT1.7         181   2e-48   Cucumis sativus [cucumbers]
gb|KHN39620.1|  Subtilisin-like protease                                180   2e-48   Glycine soja [wild soybean]
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           180   4e-48   
ref|XP_006841679.1|  PREDICTED: subtilisin-like protease                180   4e-48   Amborella trichopoda
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease                180   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                179   7e-48   Brassica rapa
dbj|BAJ93872.1|  predicted protein                                      179   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor     178   2e-47   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    179   2e-47   
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like           177   3e-47   Setaria italica
ref|XP_004954114.1|  PREDICTED: subtilisin-like protease-like           177   4e-47   Setaria italica
ref|XP_002452918.1|  hypothetical protein SORBIDRAFT_04g034950          177   7e-47   Sorghum bicolor [broomcorn]
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease                176   1e-46   Zea mays [maize]
dbj|BAJ97136.1|  predicted protein                                      175   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012068868.1|  PREDICTED: subtilisin-like protease SBT1.7         175   3e-46   Jatropha curcas
gb|EAY87749.1|  hypothetical protein OsI_09164                          173   3e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_003570499.1|  PREDICTED: subtilisin-like protease                174   5e-46   Brachypodium distachyon [annual false brome]
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like           173   1e-45   Setaria italica
ref|XP_010088794.1|  Subtilisin-like protease                           174   1e-45   Morus notabilis
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                172   2e-45   Prunus mume [ume]
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             172   2e-45   
ref|XP_002452917.1|  hypothetical protein SORBIDRAFT_04g034940          172   2e-45   Sorghum bicolor [broomcorn]
gb|EMS59706.1|  Subtilisin-like protease                                170   4e-45   Triticum urartu
gb|EMT01939.1|  Subtilisin-like protease                                170   1e-44   
ref|XP_010088796.1|  Subtilisin-like protease                           171   1e-44   Morus notabilis
gb|EMT11314.1|  hypothetical protein F775_42966                         168   1e-44   
tpg|DAA61658.1|  TPA: putative subtilase family protein                 169   1e-44   
dbj|BAJ91400.1|  predicted protein                                      169   6e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     168   6e-44   Zea mays [maize]
gb|ACF79126.1|  unknown                                                 167   1e-43   Zea mays [maize]
dbj|BAD19523.1|  putative subtilisin-like proteinase                    167   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EMS46826.1|  Subtilisin-like protease                                163   7e-43   Triticum urartu
ref|XP_003595292.1|  Subtilisin-like protease                           165   1e-42   Medicago truncatula
ref|NP_001234288.1|  SBT2 protein precursor                             164   2e-42   Solanum lycopersicum
ref|XP_004308418.2|  PREDICTED: subtilisin-like protease                164   2e-42   Fragaria vesca subsp. vesca
gb|KJB49367.1|  hypothetical protein B456_008G115500                    164   2e-42   Gossypium raimondii
gb|ABK96588.1|  unknown                                                 155   2e-42   Populus trichocarpa x Populus deltoides
gb|AGT17100.1|  serine protease                                         164   3e-42   Saccharum hybrid cultivar R570
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          164   3e-42   Sorghum bicolor [broomcorn]
gb|EMT11726.1|  Subtilisin-like protease                                164   4e-42   
ref|XP_003609994.1|  Subtilisin-like protease                           163   5e-42   
gb|AES92191.2|  subtilisin-like serine protease                         163   5e-42   Medicago truncatula
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           163   7e-42   Solanum tuberosum [potatoes]
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             165   8e-42   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                162   9e-42   
gb|EMT11725.1|  Subtilisin-like protease                                160   1e-41   
ref|XP_007051971.1|  Subtilase family protein                           162   1e-41   
ref|XP_010232411.1|  PREDICTED: subtilisin-like protease                162   2e-41   Brachypodium distachyon [annual false brome]
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           161   3e-41   Solanum tuberosum [potatoes]
gb|KHG02130.1|  Subtilisin-like protease                                160   5e-41   Gossypium arboreum [tree cotton]
emb|CDP15538.1|  unnamed protein product                                160   5e-41   Coffea canephora [robusta coffee]
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                160   5e-41   Solanum lycopersicum
ref|XP_010931682.1|  PREDICTED: subtilisin-like protease                160   7e-41   Elaeis guineensis
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           159   8e-41   
dbj|BAD36156.1|  putative serine protease                               159   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006849717.1|  PREDICTED: subtilisin-like protease                159   1e-40   Amborella trichopoda
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                159   2e-40   Nicotiana tomentosiformis
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           159   2e-40   Citrus sinensis [apfelsine]
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      158   2e-40   Ricinus communis
gb|KJB49366.1|  hypothetical protein B456_008G115400                    158   3e-40   Gossypium raimondii
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                158   3e-40   
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                158   4e-40   
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg                150   4e-40   Erythranthe guttata [common monkey flower]
gb|AHA84190.1|  subtilisin-like protease                                157   5e-40   Phaseolus vulgaris [French bean]
gb|EMS60034.1|  Subtilisin-like protease                                155   5e-40   Triticum urartu
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           157   5e-40   Setaria italica
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                157   6e-40   Malus domestica [apple tree]
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             157   6e-40   Prunus persica
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             156   1e-39   Phaseolus vulgaris [French bean]
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           157   1e-39   Cicer arietinum [garbanzo]
gb|KHN13888.1|  Subtilisin-like protease                                156   1e-39   Glycine soja [wild soybean]
dbj|BAJ89916.1|  predicted protein                                      156   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                156   1e-39   Nicotiana sylvestris
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                156   2e-39   Phoenix dactylifera
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease                156   2e-39   
ref|NP_001064523.2|  Os10g0394200                                       148   2e-39   
gb|ACN28035.1|  unknown                                                 152   2e-39   Zea mays [maize]
ref|XP_006445191.1|  hypothetical protein CICLE_v10018512mg             158   2e-39   
ref|XP_006381615.1|  subtilase family protein                           155   3e-39   
gb|EAZ24824.1|  hypothetical protein OsJ_08603                          155   3e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KHN13887.1|  Subtilisin-like protease                                154   3e-39   Glycine soja [wild soybean]
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                155   4e-39   Vitis vinifera
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease                155   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           155   5e-39   Glycine max [soybeans]
ref|NP_001048303.1|  Os02g0780200                                       155   6e-39   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                154   7e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1     154   8e-39   Brachypodium distachyon [annual false brome]
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    154   8e-39   Glycine max [soybeans]
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                154   9e-39   Cucumis melo [Oriental melon]
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     154   9e-39   
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     154   9e-39   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     154   1e-38   Nicotiana sylvestris
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     154   1e-38   Nicotiana sylvestris
gb|EAY87753.1|  hypothetical protein OsI_09169                          154   1e-38   Oryza sativa Indica Group [Indian rice]
gb|KHN27220.1|  Subtilisin-like protease                                153   1e-38   Glycine soja [wild soybean]
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                153   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                153   2e-38   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           153   2e-38   Cicer arietinum [garbanzo]
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     154   2e-38   Eucalyptus grandis [rose gum]
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                153   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                153   2e-38   Prunus mume [ume]
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                153   2e-38   Nelumbo nucifera [Indian lotus]
gb|KJB34438.1|  hypothetical protein B456_006G065800                    151   2e-38   Gossypium raimondii
dbj|BAK06243.1|  predicted protein                                      153   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                153   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                153   2e-38   Eucalyptus grandis [rose gum]
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                153   3e-38   Populus euphratica
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                153   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_007051969.1|  Subtilase family protein isoform 1                 152   3e-38   
gb|KJB34439.1|  hypothetical protein B456_006G065800                    151   3e-38   Gossypium raimondii
gb|ACN27710.1|  unknown                                                 152   4e-38   Zea mays [maize]
gb|AES80028.2|  subtilisin-like serine protease                         152   4e-38   Medicago truncatula
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                152   4e-38   Nicotiana tomentosiformis
ref|XP_003623810.1|  Subtilisin-like protease                           152   4e-38   
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    152   4e-38   Citrus sinensis [apfelsine]
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                152   5e-38   Fragaria vesca subsp. vesca
tpg|DAA50265.1|  TPA: putative subtilase family protein                 152   6e-38   
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                152   6e-38   Eucalyptus grandis [rose gum]
ref|NP_001151549.1|  subtilisin-like protease precursor                 152   6e-38   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                152   7e-38   Sesamum indicum [beniseed]
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease                149   9e-38   
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                151   9e-38   Sesamum indicum [beniseed]
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    151   9e-38   Elaeis guineensis
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease                151   1e-37   Elaeis guineensis
gb|KJB34440.1|  hypothetical protein B456_006G065800                    151   1e-37   Gossypium raimondii
gb|EMT24678.1|  Subtilisin-like protease                                149   1e-37   
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   151   1e-37   Citrus sinensis [apfelsine]
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    151   1e-37   Elaeis guineensis
gb|ACL52505.1|  unknown                                                 148   1e-37   Zea mays [maize]
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease                151   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             151   1e-37   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           151   1e-37   Setaria italica
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                151   1e-37   Vitis vinifera
gb|KHN31561.1|  Subtilisin-like protease                                149   1e-37   Glycine soja [wild soybean]
gb|KHN44005.1|  Subtilisin-like protease                                148   1e-37   Glycine soja [wild soybean]
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     151   1e-37   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             150   1e-37   Phaseolus vulgaris [French bean]
gb|EMS67510.1|  Subtilisin-like protease                                149   2e-37   Triticum urartu
ref|XP_010090170.1|  Subtilisin-like protease                           150   2e-37   Morus notabilis
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    150   2e-37   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    150   2e-37   Arabis alpina [alpine rockcress]
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                150   2e-37   Phoenix dactylifera
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      150   3e-37   
gb|KHN07895.1|  Subtilisin-like protease                                148   3e-37   Glycine soja [wild soybean]
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           150   3e-37   Glycine max [soybeans]
emb|CDY18042.1|  BnaC07g04280D                                          149   3e-37   Brassica napus [oilseed rape]
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                150   3e-37   Eucalyptus grandis [rose gum]
ref|XP_012077058.1|  PREDICTED: subtilisin-like protease SBT1.7         149   4e-37   Jatropha curcas
dbj|BAD94244.1|  serine protease like protein                           145   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease SBT1.1         149   4e-37   Cucumis sativus [cucumbers]
gb|KJB82990.1|  hypothetical protein B456_013G223900                    149   4e-37   Gossypium raimondii
ref|XP_010087293.1|  Subtilisin-like protease                           149   5e-37   
gb|ADE77855.1|  unknown                                                 145   6e-37   Picea sitchensis
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       147   6e-37   Cucumis sativus [cucumbers]
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           147   6e-37   
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                149   6e-37   Cucumis melo [Oriental melon]
ref|XP_002885806.1|  predicted protein                                  149   6e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                149   7e-37   Solanum lycopersicum
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             149   7e-37   Phaseolus vulgaris [French bean]
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                149   7e-37   Malus domestica [apple tree]
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                149   7e-37   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                149   8e-37   Pyrus x bretschneideri [bai li]
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                149   8e-37   Cucumis melo [Oriental melon]
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           149   8e-37   Glycine max [soybeans]
ref|XP_010540256.1|  PREDICTED: subtilisin-like protease                148   9e-37   Tarenaya hassleriana [spider flower]
emb|CDY67452.1|  BnaCnng55020D                                          148   1e-36   Brassica napus [oilseed rape]
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                148   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864127.1|  subtilase family protein                           148   1e-36   
ref|XP_002519362.1|  conserved hypothetical protein                     140   1e-36   
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             148   1e-36   Eutrema salsugineum [saltwater cress]
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                148   1e-36   Brassica rapa
emb|CDY00497.1|  BnaA10g07760D                                          148   1e-36   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                148   1e-36   Erythranthe guttata [common monkey flower]
dbj|BAJ97849.1|  predicted protein                                      147   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                148   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                149   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     148   1e-36   Tarenaya hassleriana [spider flower]
gb|EMT32146.1|  Subtilisin-like protease                                140   1e-36   
gb|EAY90937.1|  hypothetical protein OsI_12551                          145   2e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                147   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                147   2e-36   Nicotiana sylvestris
gb|EEE50901.1|  hypothetical protein OsJ_31407                          147   2e-36   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA50071.1|  TPA: putative subtilase family protein                 147   2e-36   
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     147   2e-36   Zea mays [maize]
ref|XP_002320086.2|  subtilase family protein                           147   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011660019.1|  PREDICTED: subtilisin-like protease SBT1.7         147   2e-36   Cucumis sativus [cucumbers]
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      147   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78354.1|  hypothetical protein OsI_33442                          147   3e-36   Oryza sativa Indica Group [Indian rice]
emb|CDX99895.1|  BnaC09g28100D                                          147   3e-36   
dbj|BAJ87169.1|  predicted protein                                      147   3e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT07781.1|  Subtilisin-like protease                                145   3e-36   
emb|CAN81091.1|  hypothetical protein VITISV_040911                     144   3e-36   Vitis vinifera
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             147   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                147   3e-36   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY63302.1|  BnaCnng41810D                                          147   3e-36   Brassica napus [oilseed rape]
ref|XP_008378050.1|  PREDICTED: subtilisin-like protease                145   4e-36   
ref|NP_568765.1|  subtilase 1.3                                         147   4e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33400.1|  BnaA07g04390D                                          146   4e-36   Brassica napus [oilseed rape]
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                146   4e-36   Vitis vinifera
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             147   4e-36   Capsella rubella
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    146   5e-36   
emb|CDP05276.1|  unnamed protein product                                147   5e-36   Coffea canephora [robusta coffee]
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           146   5e-36   Cicer arietinum [garbanzo]
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                146   5e-36   Brassica rapa
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     146   5e-36   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease                146   6e-36   
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     146   6e-36   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             146   6e-36   
ref|XP_007012625.1|  Subtilase family protein                           146   6e-36   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                146   7e-36   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                146   7e-36   
dbj|BAJ87780.1|  predicted protein                                      146   8e-36   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                146   8e-36   
gb|ADE76648.1|  unknown                                                 142   9e-36   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                146   9e-36   
gb|KHG16003.1|  Subtilisin-like protease                                145   9e-36   
gb|KHN12283.1|  Subtilisin-like protease                                143   9e-36   
gb|EMT22975.1|  Subtilisin-like protease                                143   9e-36   
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           145   9e-36   
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    145   9e-36   
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             145   1e-35   
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           145   1e-35   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            145   1e-35   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                145   1e-35   
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             145   1e-35   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                146   1e-35   
ref|XP_010692332.1|  PREDICTED: subtilisin-like protease                145   1e-35   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                145   1e-35   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                145   1e-35   
ref|XP_004140477.2|  PREDICTED: subtilisin-like protease SBT1.1         145   1e-35   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease                144   1e-35   
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190          145   1e-35   
ref|XP_006857965.1|  PREDICTED: subtilisin-like protease                145   1e-35   
ref|NP_565330.1|  Subtilase-like protein                                145   1e-35   
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                145   2e-35   
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease                145   2e-35   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           145   2e-35   
gb|KHN10472.1|  Subtilisin-like protease                                144   2e-35   
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           144   2e-35   
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                144   2e-35   
emb|CDY18653.1|  BnaA09g07420D                                          144   2e-35   
ref|XP_009381819.1|  PREDICTED: subtilisin-like protease                144   3e-35   
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                144   3e-35   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           144   3e-35   
ref|XP_009411443.1|  PREDICTED: subtilisin-like protease                144   3e-35   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             144   3e-35   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                144   3e-35   
emb|CDY29697.1|  BnaA04g17300D                                          144   3e-35   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease                144   3e-35   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    144   4e-35   
dbj|BAJ90522.1|  predicted protein                                      140   4e-35   
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             144   4e-35   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             144   4e-35   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           144   4e-35   
gb|ACN28204.1|  unknown                                                 144   4e-35   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          144   4e-35   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                144   4e-35   
emb|CBI35805.3|  unnamed protein product                                142   5e-35   
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             144   5e-35   
ref|XP_010105479.1|  Subtilisin-like protease                           144   5e-35   
gb|EAY95232.1|  hypothetical protein OsI_17050                          141   5e-35   
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           143   6e-35   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease SBT1.6         143   6e-35   
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           143   6e-35   
ref|XP_010111995.1|  Subtilisin-like protease                           143   7e-35   
ref|XP_006648004.1|  PREDICTED: subtilisin-like protease-like           143   7e-35   
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like           143   7e-35   
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                143   8e-35   
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                143   8e-35   
ref|NP_001050634.1|  Os03g0605300                                       143   9e-35   
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                143   9e-35   
ref|XP_002304250.2|  hypothetical protein POPTR_0003s06940g             141   9e-35   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                142   1e-34   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             142   1e-34   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                142   1e-34   
gb|KHN04108.1|  Subtilisin-like protease                                142   1e-34   
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                142   1e-34   
gb|ACN27570.1|  unknown                                                 140   1e-34   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                142   1e-34   
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                142   1e-34   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           142   1e-34   
ref|XP_002533857.1|  Cucumisin precursor, putative                      142   1e-34   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                142   1e-34   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                142   1e-34   
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                142   1e-34   
ref|XP_012068251.1|  PREDICTED: subtilisin-like protease SBT1.7         142   1e-34   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         142   1e-34   
gb|KHN04600.1|  Subtilisin-like protease                                142   1e-34   
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    142   1e-34   
ref|XP_010906270.1|  PREDICTED: subtilisin-like protease                140   2e-34   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    142   2e-34   
gb|EEC76224.1|  hypothetical protein OsI_13631                          140   2e-34   
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980          142   2e-34   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                142   2e-34   
emb|CDO96926.1|  unnamed protein product                                142   2e-34   
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like           142   2e-34   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             142   2e-34   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     142   2e-34   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease                142   2e-34   
gb|EPS65938.1|  hypothetical protein M569_08836                         142   2e-34   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     142   2e-34   
gb|KJB29423.1|  hypothetical protein B456_005G099900                    142   2e-34   
gb|EMS67351.1|  Subtilisin-like protease                                141   2e-34   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      142   2e-34   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                142   2e-34   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                142   2e-34   
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                142   2e-34   
ref|XP_008797372.1|  PREDICTED: subtilisin-like protease                142   3e-34   
ref|XP_007024750.1|  Subtilase family protein isoform 1                 141   3e-34   
gb|KHM99187.1|  Subtilisin-like protease                                133   3e-34   
ref|XP_002523127.1|  Xylem serine proteinase 1 precursor, putative      140   3e-34   
gb|KHN06066.1|  Subtilisin-like protease                                140   3e-34   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             141   4e-34   
ref|XP_002321861.2|  subtilase family protein                           141   4e-34   
emb|CDY63300.1|  BnaCnng41800D                                          140   4e-34   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           141   4e-34   
emb|CAH66960.1|  OSIGBa0147H17.8                                        141   4e-34   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease                141   4e-34   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease                141   4e-34   
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                141   4e-34   
ref|NP_001053614.1|  Os04g0573300                                       141   4e-34   
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           141   5e-34   
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           140   5e-34   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                140   5e-34   
gb|ERN03185.1|  hypothetical protein AMTR_s00003p00138760               140   5e-34   
ref|XP_010109072.1|  Subtilisin-like protease                           140   5e-34   
ref|NP_001152427.1|  LOC100286067 precursor                             140   6e-34   
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like           140   6e-34   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                140   6e-34   
tpg|DAA51518.1|  TPA: putative subtilase family protein                 140   6e-34   
gb|EMT24677.1|  hypothetical protein F775_42866                         140   6e-34   
gb|ABR17987.1|  unknown                                                 140   6e-34   
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease                140   7e-34   
ref|XP_006841510.2|  PREDICTED: subtilisin-like protease                140   7e-34   
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    140   7e-34   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease                140   7e-34   
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                140   7e-34   
ref|XP_008810220.1|  PREDICTED: subtilisin-like protease                140   8e-34   
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           140   8e-34   
emb|CDY63869.1|  BnaCnng42760D                                          133   9e-34   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           140   1e-33   
gb|AGT16121.1|  hypothetical protein SHCRBa_028_H13_F_280               140   1e-33   
ref|XP_012078825.1|  PREDICTED: subtilisin-like protease SBT1.7         140   1e-33   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                140   1e-33   
gb|EPS61757.1|  hypothetical protein M569_13035                         140   1e-33   
ref|NP_001159342.1|  putative subtilase family protein precursor        140   1e-33   
emb|CAD29822.2|  putative serine protease                               138   1e-33   
dbj|BAJ88858.1|  predicted protein                                      140   1e-33   
gb|KHN15704.1|  Subtilisin-like protease                                139   1e-33   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease                140   1e-33   
ref|NP_001051353.1|  Os03g0761500                                       139   1e-33   
ref|XP_006857985.2|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                139   2e-33   
gb|EPS65791.1|  hypothetical protein M569_08985                         139   2e-33   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                139   2e-33   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           139   2e-33   
gb|ERN19452.1|  hypothetical protein AMTR_s00069p00181050               139   2e-33   
ref|XP_012078946.1|  PREDICTED: subtilisin-like protease SBT1.7         131   2e-33   
emb|CDY18651.1|  BnaA09g07440D                                          139   2e-33   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                139   2e-33   
gb|KJB49368.1|  hypothetical protein B456_008G115600                    139   2e-33   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                139   2e-33   
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                139   2e-33   
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             139   2e-33   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                139   2e-33   
ref|XP_002510884.1|  Cucumisin precursor, putative                      139   2e-33   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                139   3e-33   
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                139   3e-33   
gb|KDO81559.1|  hypothetical protein CISIN_1g0053341mg                  137   3e-33   
gb|ABX75360.1|  hypothetical protein LBL6                               132   3e-33   
gb|KEH35793.1|  subtilisin-like serine protease                         138   3e-33   
ref|XP_012083506.1|  PREDICTED: subtilisin-like protease SBT1.1         138   3e-33   
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     138   3e-33   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         138   3e-33   
gb|KDP28200.1|  hypothetical protein JCGZ_13971                         138   3e-33   
ref|XP_012082822.1|  PREDICTED: subtilisin-like protease SBT1.6         138   4e-33   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                138   4e-33   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           138   4e-33   
ref|XP_012068325.1|  PREDICTED: subtilisin-like protease SBT1.7         138   5e-33   
emb|CDY43568.1|  BnaC02g16650D                                          131   5e-33   
gb|KJB27210.1|  hypothetical protein B456_004G284900                    138   5e-33   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                138   6e-33   
ref|XP_004958127.1|  PREDICTED: subtilisin-like protease-like           138   6e-33   
gb|ABR18065.1|  unknown                                                 138   6e-33   
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                137   7e-33   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           137   7e-33   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       137   7e-33   
gb|KHN17728.1|  Subtilisin-like protease                                130   8e-33   
gb|ACN26674.1|  unknown                                                 135   8e-33   
ref|NP_569048.1|  subtilisin-like protease                              137   8e-33   
emb|CAN62248.1|  hypothetical protein VITISV_022540                     139   8e-33   
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                137   8e-33   
emb|CDY55359.1|  BnaCnng28690D                                          137   9e-33   
gb|EYU44465.1|  hypothetical protein MIMGU_mgv1a0020562mg               134   9e-33   
ref|XP_006841997.1|  PREDICTED: subtilisin-like protease                137   9e-33   
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like           137   1e-32   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             137   1e-32   
gb|KJB70050.1|  hypothetical protein B456_011G056000                    137   1e-32   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             137   1e-32   
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1      137   1e-32   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             137   1e-32   
emb|CAA59963.1|  subtilisin-like protease                               137   1e-32   
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease                137   1e-32   
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease                137   1e-32   
gb|KHN45156.1|  Subtilisin-like protease                                136   1e-32   
emb|CDP02570.1|  unnamed protein product                                137   1e-32   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           136   2e-32   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    136   2e-32   
ref|XP_010105478.1|  Subtilisin-like protease                           136   2e-32   
ref|XP_002534008.1|  Xylem serine proteinase 1 precursor, putative      136   2e-32   
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease                136   2e-32   
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                136   2e-32   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                136   2e-32   
gb|EEC83669.1|  hypothetical protein OsI_29445                          136   2e-32   
emb|CAN81090.1|  hypothetical protein VITISV_040910                     137   2e-32   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             136   2e-32   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             136   2e-32   
gb|KJB57083.1|  hypothetical protein B456_009G147400                    136   2e-32   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                136   2e-32   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                136   2e-32   
ref|XP_012068804.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    136   2e-32   
ref|XP_007051968.1|  Subtilase family protein                           136   2e-32   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                136   2e-32   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                136   2e-32   



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 140/210 (67%), Gaps = 9/210 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG   + DL TG  S P  HGSGHVDP  A DPGLVYD  + 
Sbjct  563  SPAAIKSALMTTAYNLDNSG-GNITDLATGSESNPFVHGSGHVDPNRAVDPGLVYDLEIT  621

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCTIGYDS++I++F + +  VDC       PG LNYPSF+VVF  +   + YKRT
Sbjct  622  DYVAFLCTIGYDSRRISVFTKQASSVDCDALGFKTPGNLNYPSFSVVFSGSESVVKYKRT  681

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF-------A  280
            VKNVGK  N  Y+V V TP  V V+VSPS+LVFS++ DKLSYEVTF+S           +
Sbjct  682  VKNVGKEANAVYEVKVNTPLGVEVSVSPSKLVFSEKEDKLSYEVTFKSSANAVGFEITGS  741

Query  279  DPSFGSLSWSD-GTHLVTSPIAVIWEARSV  193
              SFGS+ WSD G+HLV SPIAV+W   S 
Sbjct  742  KSSFGSIEWSDGGSHLVRSPIAVLWRRNSA  771



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 140/212 (66%), Gaps = 9/212 (4%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y LDNSG+    DL TG  STP  HGSGHVDP  A DPGLVYD   +D
Sbjct  564  PAAVKSALMTTAYNLDNSGK-VFTDLATGQESTPFVHGSGHVDPNRALDPGLVYDIETSD  622

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKRT  439
            YV+FLC+IGYD   +A+F+R+S  V+C  +NL  PG LNYPSF+VVF       + YKR 
Sbjct  623  YVNFLCSIGYDGDDVAVFVRDSSRVNCSEQNLATPGDLNYPSFSVVFTGESNGVVKYKRV  682

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS-------VPQFA  280
            +KNVGK  +  Y+V V  PS+V V+VSP++LVFS+    LSYE++F+S       + +  
Sbjct  683  MKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKKSLSYEISFKSKSSGDLEMVKGI  742

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            + +FGS+ WSDG H V SPIAV W   S + +
Sbjct  743  ESAFGSIEWSDGIHNVRSPIAVRWRHYSAASI  774



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 139/208 (67%), Gaps = 5/208 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT YTLDNSG++ + DL +G  STP  HG+GHVDP +A DPGLVYD   +
Sbjct  564  SPAAIKSALVTTAYTLDNSGKN-IKDLASGEESTPFIHGAGHVDPNSALDPGLVYDMDTS  622

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC IGYDS +IA+F+R  P  D  +  +G+PG LNYPS +VVF++    +TYKR 
Sbjct  623  DYISFLCAIGYDSNRIAVFVREPPSSDICSGKVGSPGNLNYPSISVVFQSTSDVVTYKRV  682

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV----PQFADPS  271
            VKNVG   +  Y+V V +P+NV + VSPS+LVFS     LSYE+TF SV    P     +
Sbjct  683  VKNVGGSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTLSYEITFSSVSLDWPTIIPST  742

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSVSD  187
            FGS+ WSDG H V  PIAV W   S  D
Sbjct  743  FGSIEWSDGIHGVRGPIAVKWRQGSSRD  770



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 137/207 (66%), Gaps = 8/207 (4%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y LDNSG+    DL TG  STP  HGSGHVDP  A DPGLVYD   +D
Sbjct  567  PAAIKSALMTTAYNLDNSGK-IFTDLATGEESTPFVHGSGHVDPNRALDPGLVYDIETSD  625

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKRT  439
            YV+FLCTIGYD   IA+F+R+S  V+C  R+L  PG LNYPSF+V F ++    + YKR 
Sbjct  626  YVNFLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLNYPSFSVDFTSDSNGVVKYKRV  685

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS------VPQFAD  277
            VKNVG   N  Y+V V  PS V V+VSP++LVFS+  + LSYE++F S      + +   
Sbjct  686  VKNVGGDSNAVYEVKVNAPSAVEVSVSPAKLVFSEENNSLSYEISFTSKRSEDIMVKGIQ  745

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEARS  196
             +FGS+ WSDG H V SPIAV W  +S
Sbjct  746  SAFGSIEWSDGIHSVRSPIAVRWRYQS  772



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 137/212 (65%), Gaps = 9/212 (4%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y LDNSG+    DL TG  STP  HGSGHVDP  A DPGLVYD   +D
Sbjct  564  PAAVKSALMTTAYNLDNSGK-VFTDLATGQESTPFVHGSGHVDPNRALDPGLVYDIETSD  622

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKRT  439
            YV+FLC+IGYD   +A+F R+S  V+C  R+L  PG LNYPSF+VVF       + YKR 
Sbjct  623  YVNFLCSIGYDGTDVAVFARDSSRVNCSERSLATPGDLNYPSFSVVFTGETNGVVKYKRV  682

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ-------SVPQFA  280
            VKNVGK  +  Y+V V  PS+V V+VSP++LVFS+    LSYE++ +        + +  
Sbjct  683  VKNVGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKQSLSYEISLKGKSSGDLEMVKGI  742

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            + +FGS+ WSDG H V SPIAV W   S + +
Sbjct  743  ESAFGSIEWSDGIHNVRSPIAVRWRHYSAASI  774



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   211 bits (537),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 130/202 (64%), Gaps = 6/202 (3%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y +DN G S + DL TG  S P  HGSGHVDP  A +PGLVYD G +D
Sbjct  569  PAAIKSALMTTAYNVDNIGES-IKDLATGEESNPFVHGSGHVDPNRALNPGLVYDLGTSD  627

Query  615  YVDFLCTIGYDSQKIALFLRNSPL-VDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            YV FLC +GY   +IA+F+R+ P+ VDC  + +G PG LNYPSF+VVF      + Y R 
Sbjct  628  YVAFLCAVGYSPGRIAVFVRDGPVPVDCGAQGMGTPGDLNYPSFSVVFSPGNSVVKYTRV  687

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF----ADPS  271
            VKNVG      Y+V V  P +V V VSPS+LVFS   D LSYEV+F +          P+
Sbjct  688  VKNVGSNAEAVYEVKVNAPPSVEVTVSPSQLVFSQGNDTLSYEVSFTTASGILVGALKPA  747

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            FGSL WSDG HLV SPIAV+W 
Sbjct  748  FGSLEWSDGEHLVRSPIAVVWR  769



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 135/211 (64%), Gaps = 11/211 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMT+ Y LDN+G + + DL TG  STP  HG+GHVDP  A DPGLVYD    
Sbjct  564  SPAAIKSALMTSAYNLDNTG-ANITDLATGAESTPFVHGAGHVDPNRAVDPGLVYDLDTT  622

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLCTIGYDS++I++F +++  VDC       PG LNYPSF+VVF      + Y RT
Sbjct  623  DYIAFLCTIGYDSRRISVFTKDASSVDCDKLGFKTPGNLNYPSFSVVFYGEESVVKYNRT  682

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ---------SVPQ  286
            V NVG   +  Y+V V  P  V V+VSPS+LVFS+  DKLSYEVTF+          +  
Sbjct  683  VTNVGSEVDAVYEVRVGAPPGVEVSVSPSKLVFSETEDKLSYEVTFKSSSSASSGLEIVG  742

Query  285  FADPSFGSLSWSD-GTHLVTSPIAVIWEARS  196
             A  SFGS+ WSD G+HLV SPIA +W   S
Sbjct  743  SAKSSFGSIEWSDGGSHLVRSPIAAVWRTSS  773



>emb|CAN75240.1| hypothetical protein VITISV_014207 [Vitis vinifera]
Length=579

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 131/210 (62%), Gaps = 7/210 (3%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y LDNSG + + DL TG  S+P  HG+GHVDP  A  PGLVYD   ND
Sbjct  371  PAAIKSALMTTAYNLDNSG-NNIADLATGNQSSPFIHGAGHVDPNRALYPGLVYDIDAND  429

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK------NNLQTI  454
            Y+ FLC IGYD+++IA+F+R    VDC    L  PG LNYP+F+VVF       +    I
Sbjct  430  YISFLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFDHDPVHQGNEI  489

Query  453  TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP  274
              KR VKNVG   N  Y+V V  P  + V+VSP +LVFS      SYEV+F SV  +   
Sbjct  490  KLKRVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVSFTSVESYIGS  549

Query  273  SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             FGS+ WSDGTH+V SP+AV +   +VS +
Sbjct  550  RFGSIEWSDGTHIVRSPVAVRFHQDAVSSI  579



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 136/208 (65%), Gaps = 9/208 (4%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y LDNSG+    DL TG  STP  HGSGHVDP  A +PGLVYD   +D
Sbjct  566  PAAIKSALMTTAYNLDNSGK-IFTDLATGEESTPFVHGSGHVDPNRALNPGLVYDIETSD  624

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKRT  439
            YV+FLCTIGYD   IA+F+R+S  V+C  R+L  PG LNYPSFAV F ++    + YKR 
Sbjct  625  YVNFLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLNYPSFAVDFTSDSNGVVKYKRV  684

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS-------VPQFA  280
            VKNVG   N  Y+V V  P  V V+VSP++LVFS+  + LSYE++F S       + +  
Sbjct  685  VKNVGGNPNAVYEVKVNAPLGVEVSVSPAKLVFSEENNSLSYEISFTSKRSEDNIMVKGT  744

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEARS  196
              +FGS+ WSDG H V SPIAV W  +S
Sbjct  745  PSAFGSIEWSDGIHSVRSPIAVRWRYQS  772



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 135/198 (68%), Gaps = 2/198 (1%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P    SA+ TT Y +D++G+  +I+  T  PSTP  HGSGH+DP  A DPGLVYD  ++D
Sbjct  569  PAAIMSAIKTTAYNIDSTGKE-IIEASTLLPSTPFVHGSGHIDPNKAVDPGLVYDLQISD  627

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTV  436
            Y+ FLCTIGYD+++I +  +   +VDC ++ L +PG LNYPSF+VVF+ +   + Y R V
Sbjct  628  YIAFLCTIGYDTKRIHVLFKEPAVVDCASQILSSPGNLNYPSFSVVFRGDTNKVKYTRVV  687

Query  435  KNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGSLS  256
            KNVG  KN  Y+V V+ P NV ++V+P+ L F+  +  LSY++TF S      PSFGS+ 
Sbjct  688  KNVGSSKNAVYKVNVKVPLNVHISVAPTTLAFTSTVQTLSYDITFTST-SIGPPSFGSIE  746

Query  255  WSDGTHLVTSPIAVIWEA  202
            W+DG+H V SPIAV WE+
Sbjct  747  WTDGSHHVRSPIAVQWES  764



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 136/213 (64%), Gaps = 13/213 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG + + DL +G  STP  HG+GHVDP  A +PGLVYD  V+
Sbjct  397  SPAAIKSALMTTAYNLDNSGEN-IKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVS  455

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +YV FLC+IGYD ++I++F+R     D   R L  PG LNYPSF+VVF +N   + YKR 
Sbjct  456  EYVAFLCSIGYDVKRISVFVREPVSSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRV  515

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--------PQF  283
            VKNVG   +  Y+V V  P NV VNV PS+L FS     L+YE+TF SV        PQ 
Sbjct  516  VKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQ  575

Query  282  ADPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            +    GS+ WSDG HLV SPIAV W   SVS +
Sbjct  576  S----GSIEWSDGVHLVRSPIAVRWIQGSVSSM  604



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 137/208 (66%), Gaps = 5/208 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT YTLDNSG++ + DL +   STP  HG+GHVDP +A DPGLVYD   +
Sbjct  566  SPAAIKSALVTTAYTLDNSGKN-IKDLASAEESTPFIHGAGHVDPNSALDPGLVYDMDTS  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC IGYDS +IA+F+R  P  D  +  + +PG LNYPSF+VVF++    +T KR 
Sbjct  625  DYISFLCAIGYDSNRIAVFVREPPSSDICSGKVSSPGNLNYPSFSVVFQSTSDVVTCKRV  684

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV----PQFADPS  271
            VKNVG   +  Y+V V +P+NV + VSPS+LVFS     LSYE+TF SV    P     +
Sbjct  685  VKNVGSSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTLSYEITFSSVGLDWPTIIPST  744

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSVSD  187
            +GS+ WSDG H V  PIAV W   S  D
Sbjct  745  YGSIEWSDGIHGVRGPIAVKWRQGSSRD  772



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 131/210 (62%), Gaps = 7/210 (3%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y LDNSG + + DL TG  S+P  HG+GHVDP  A  PGLVYD   ND
Sbjct  563  PAAIKSALMTTAYNLDNSG-NNIADLATGNQSSPFIHGAGHVDPNRALYPGLVYDIDAND  621

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK------NNLQTI  454
            Y+ FLC IGYD+++IA+F+R    VDC    L  PG LNYP+F+VVF       +    I
Sbjct  622  YISFLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFDHDPVHQGNEI  681

Query  453  TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP  274
              KR VKNVG   N  Y+V V  P  + V+VSP +LVFS      SYEV+F SV  +   
Sbjct  682  KLKRVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVSFTSVESYIGS  741

Query  273  SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             FGS+ WSDGTH+V SP+AV +   +VS +
Sbjct  742  RFGSIEWSDGTHIVRSPVAVRFHQDAVSSI  771



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 132/207 (64%), Gaps = 11/207 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG++ + DL TG  S+P  HGSGHVDP  A +PGLVYD   N
Sbjct  591  SPAAVKSALMTTAYYLDNSGKN-ITDLATGKQSSPFVHGSGHVDPNKALNPGLVYDINAN  649

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+  LC +GY+S +IA+FL+    +DC  +NL   G LNYPSF+VVF++    + Y R 
Sbjct  650  DYISLLCAMGYNSTRIAIFLKEPTTIDCAAKNLSTAGNLNYPSFSVVFESGKNVVKYTRV  709

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV----------P  289
            VKNVG   +  Y+V+V  P NV V+VSP +L FS     LSYE++F S+          P
Sbjct  710  VKNVGSSADAVYEVSVNAPLNVDVSVSPRKLEFSADKQTLSYEISFTSISETYLTGKVKP  769

Query  288  QFADPSFGSLSWSDGTHLVTSPIAVIW  208
                 SFGS+ WSDG+H V SPIAV W
Sbjct  770  ILGTSSFGSIEWSDGSHRVRSPIAVRW  796



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 136/208 (65%), Gaps = 6/208 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN GR+ + DL +G  S+P  HG+GHVDP  A +PGLVYD  V+
Sbjct  574  SPAAIKSALMTTAYNLDNGGRN-IKDLASGDESSPFVHGAGHVDPNRALNPGLVYDIDVD  632

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD--CRNRNLGNPGALNYPSFAVVFKNNLQTITYK  445
            DYV FLC IGY+ ++IA+FLR  P+    C NR +  PG LNYPSF+VV  +N   + Y+
Sbjct  633  DYVGFLCAIGYEPRRIAVFLRE-PMSSTVCANR-MATPGELNYPSFSVVLTSNGDVVKYR  690

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD-PSF  268
            R VKNVG   +  Y+V V  P NV V+VSPS+L FS     LSYE+TF S+   +  P F
Sbjct  691  RVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSSTPKF  750

Query  267  GSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            GS+ W+DGTH V SPIAV W    V  +
Sbjct  751  GSIEWTDGTHRVRSPIAVKWHQELVESI  778



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score =   205 bits (521),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 136/208 (65%), Gaps = 6/208 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN GR+ + DL +G  S+P  HG+GHVDP  A +PGLVYD  V+
Sbjct  625  SPAAIKSALMTTAYNLDNGGRN-IKDLASGDESSPFVHGAGHVDPNRALNPGLVYDIDVD  683

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD--CRNRNLGNPGALNYPSFAVVFKNNLQTITYK  445
            DYV FLC IGY+ ++IA+FLR  P+    C NR +  PG LNYPSF+VV  +N   + Y+
Sbjct  684  DYVGFLCAIGYEPRRIAVFLRE-PMSSTVCANR-MATPGELNYPSFSVVLTSNGDVVKYR  741

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD-PSF  268
            R VKNVG   +  Y+V V  P NV V+VSPS+L FS     LSYE+TF S+   +  P F
Sbjct  742  RVVKNVGSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSSTPKF  801

Query  267  GSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            GS+ W+DGTH V SPIAV W    V  +
Sbjct  802  GSIEWTDGTHRVRSPIAVKWHQELVESI  829



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score =   205 bits (521),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 136/213 (64%), Gaps = 13/213 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG + + DL +G  STP  HG+GHVDP  A +PGLVYD  V+
Sbjct  569  SPAVIKSALMTTAYNLDNSGEN-IKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVS  627

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +YV FLC+IGYD ++I++F+R     D   R L  PG LNYPSF+VVF +N   + YKR 
Sbjct  628  EYVAFLCSIGYDVKRISVFVREPASSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRV  687

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--------PQF  283
            VKNVG   +  Y+V V  P NV VNV PS+L FS     L+YE+TF SV        PQ 
Sbjct  688  VKNVGSSVDAVYEVKVNAPPNVAVNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQ  747

Query  282  ADPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            +    GS+ WSDG HLV SPIAV W   SVS +
Sbjct  748  S----GSIEWSDGVHLVRSPIAVRWIQGSVSSM  776



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 141/215 (66%), Gaps = 12/215 (6%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSALMTT Y LDN G++ + DL TG  STP  HG+GHVDP  A DPGLVYD  VND
Sbjct  570  PAALKSALMTTAYNLDNGGKN-ISDLATGKESTPFVHGAGHVDPNRALDPGLVYDISVND  628

Query  615  YVDFLCTIGYDSQKIALFLRNSPL-VDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            YV+FLC+IGYD + IALF+R+    V+C  ++L +PG LNYPSF+VVFK N     + Y+
Sbjct  629  YVEFLCSIGYDEKMIALFIRDGNTSVNCSAQSLPSPGDLNYPSFSVVFKLNGGKDVVKYR  688

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFADP-  274
            R V NVG   +  Y+  V  P +V ++VSPS+LVFS   ++ SYE+TF+SV  P   +  
Sbjct  689  RVVTNVGDSVDAVYEAKVWGPDSVEISVSPSKLVFSGEEERQSYEITFKSVVPPNETEER  748

Query  273  -----SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
                  FG + WSDG+H V SPIA  W+ + VS +
Sbjct  749  TASASKFGWIEWSDGSHRVRSPIAFWWQPKLVSSI  783



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 139/205 (68%), Gaps = 5/205 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT + LDNSG++ + DL +   STP  HG+GHVDP +A DPGLVYD   +
Sbjct  566  SPAAIKSALVTTAHNLDNSGKN-IKDLASSEESTPFIHGAGHVDPNSALDPGLVYDMDTS  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC IGYDS++IA+F+R  P  D  +  +G+PG LNYPSF+VVF++N   +TY+RT
Sbjct  625  DYIAFLCAIGYDSKRIAVFVREPPSSDICSGKVGSPGNLNYPSFSVVFQSNSDVVTYRRT  684

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA----DPS  271
            VK+VG   +  Y+V V  P+NV + VSPSRLVF+     +SYE+TF SV          +
Sbjct  685  VKSVGNSPDAVYEVEVNAPANVDIKVSPSRLVFNAENKTVSYEITFSSVSSGWSSINSAT  744

Query  270  FGSLSWSDGTHLVTSPIAVIWEARS  196
            FGS+ WS+G H V SPIAV W   S
Sbjct  745  FGSIEWSNGIHRVRSPIAVKWRQGS  769



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 134/209 (64%), Gaps = 6/209 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG   + DL TG  STP   G+GHVDP  A DPGL+YD+ V 
Sbjct  572  SPAAIKSALMTTAYNLDNSGE-IIKDLSTGEESTPFVRGAGHVDPNKALDPGLIYDSQVE  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC IGY +Q+IALF R+   V+C    L +PG LNYP+F+VVF +    +T+ R 
Sbjct  631  DYLAFLCAIGYSTQQIALFTRDETTVNCSAMTLASPGDLNYPAFSVVFSSTSDIVTFSRV  690

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDK-LSYEVTFQSVPQFA---DPS  271
            V+NVG   +  Y+  +  P  V V V+PS+LVF D +D+ LSYE+TF S+   A      
Sbjct  691  VRNVGGPDDAVYEAEISGPPGVNVTVAPSKLVF-DAVDQSLSYEITFASIADAAVAGSNG  749

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            FG +SWSDGTH V SPIAV W    V+ +
Sbjct  750  FGGISWSDGTHSVRSPIAVSWRQSFVASM  778



>gb|KJB57037.1| hypothetical protein B456_009G146000 [Gossypium raimondii]
Length=768

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 134/211 (64%), Gaps = 11/211 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YTLDNSG ST+ DL TG  S+P  HG+GHVDP  A +PGLVYD   +
Sbjct  560  SPAAIKSALMTTAYTLDNSG-STIKDLATGEESSPFGHGAGHVDPNRALNPGLVYDIDND  618

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC+IGYD  +IA+F+R     D     L  PG LNYPSF+VVF +N   + YKRT
Sbjct  619  DYIAFLCSIGYDLNRIAVFVRGPTGSDICEGKLATPGDLNYPSFSVVFYSNDHVVKYKRT  678

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS-------VPQFA  280
            VKNVG   +V Y   V  P+ V +NVSP +L FS     LSYE+TF S       V    
Sbjct  679  VKNVGTSVDVVYTAKVNAPAGVEINVSPCKLEFSGENKTLSYEITFASDGLGLHAVDSLQ  738

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEARSVSD  187
              +FGS+ WSDG HLV SPIAV W A+ + D
Sbjct  739  --AFGSIEWSDGVHLVRSPIAVRW-AQGLKD  766



>gb|ACN34516.1| unknown [Zea mays]
Length=384

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 128/201 (64%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG  T+ DL TG  STP   G+GHVDP  A DPGLVYD G +
Sbjct  177  SPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGSD  235

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCT+GY    I++F +++ + DC  +    PG LNYP+FA VF +   ++TY+R 
Sbjct  236  DYVAFLCTLGYSPSLISIFTQDASVADCSTK-FARPGDLNYPAFAAVFSSYQDSVTYRRV  294

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP--S  271
            V+NVG   +  YQ T+ +P  V V V+PS+L F  +   L YE+T      P   D   S
Sbjct  295  VRNVGSNSSAVYQPTIASPYGVDVTVTPSKLAFDGKQQSLGYEITIAVSGNPVIVDSSYS  354

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  355  FGSITWSDGAHDVTSPIAVTW  375



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 2/198 (1%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P    SA+MTT Y +D++G+  +ID+ T  PSTP   GSGH+DP  A DPGLVYD  V+D
Sbjct  567  PAAIMSAIMTTAYNIDSTGKE-IIDVSTLLPSTPFVRGSGHIDPNKAVDPGLVYDLQVSD  625

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTV  436
            Y+ FLCT GY    I +  +   ++DC ++ L +PG LNYPSF+VVF+     + Y R V
Sbjct  626  YIAFLCTAGYTKNMIRVIFKAPAVIDCASQKLSSPGNLNYPSFSVVFRGATNKVKYTRVV  685

Query  435  KNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGSLS  256
            KNVG  KN  Y+V V+ P NV+++V+PS L F+  +  LSY++TF S  + A  SFGS+ 
Sbjct  686  KNVGSSKNAVYKVNVKAPLNVQISVAPSTLTFTSTVQTLSYDITFTSTSRGAS-SFGSIE  744

Query  255  WSDGTHLVTSPIAVIWEA  202
            WSDG H V SPIA+ W++
Sbjct  745  WSDGNHHVRSPIAIQWKS  762



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 135/202 (67%), Gaps = 6/202 (3%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT Y +DNSG+ T+ DL TG  S+P   GSGHVDP  A  PGLVYD   +DYV F
Sbjct  567  KSALMTTAYNVDNSGK-TITDLATGQESSPFVRGSGHVDPNRALHPGLVYDIESSDYVGF  625

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVG  424
            LC IGY   +I+ F +++  V+C   +L +PG LNYPSF+VVF +    + YKR VKNVG
Sbjct  626  LCAIGYGPSRISPFTKDTSSVNCSEHSLASPGDLNYPSFSVVFMSE-NVVKYKRVVKNVG  684

Query  423  KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVP----QFADPSFGSLS  256
            +  NV Y+V V  PS+V V V+PS+L FS+  + LSYE++F SV     +  + +FGS+ 
Sbjct  685  RNANVVYKVKVNAPSSVEVKVTPSKLSFSEEKNSLSYEISFSSVGSERVKGLESAFGSIE  744

Query  255  WSDGTHLVTSPIAVIWEARSVS  190
            WSDG H V SPIAV W + S +
Sbjct  745  WSDGIHSVRSPIAVRWLSSSAA  766



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 131/201 (65%), Gaps = 5/201 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y+LDNSG +T+ DL TG  S+P  +G+GHVDP  A  PGLVYD    
Sbjct  560  SPAAIKSALMTTAYSLDNSG-NTIKDLATGVESSPFVYGAGHVDPNIALMPGLVYDIDDG  618

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC+IGYDS++IA+F+R     D     L  PG LNYPSF+VVF +N   + YKRT
Sbjct  619  DYVAFLCSIGYDSKRIAIFVREPTGPDVCEGKLATPGNLNYPSFSVVFDSNDHVVKYKRT  678

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS----VPQFADPS  271
            VKNVG   +  Y+  V  P  V ++VSPS+L FS     LSYE+TF S    +   A  +
Sbjct  679  VKNVGPSVDAVYEAKVNAPPGVEISVSPSKLEFSAENQTLSYEITFASDGLALFAVALEA  738

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WSDG HLV SPIAV W
Sbjct  739  FGSIEWSDGVHLVRSPIAVRW  759



>ref|XP_004954115.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG  T+ DL TG  STP   G+GHVDP +A DPGLVYD G +
Sbjct  576  SPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTPFVRGAGHVDPNSALDPGLVYDAGTD  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCT+GY    I++F ++S + DC +R     G LNYP+FA VF +   ++TY R 
Sbjct  635  DYVAFLCTLGYPPSLISIFTKDSSVADC-SRKFARSGDLNYPAFAAVFSSYKDSVTYHRV  693

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP--S  271
            V+NVG   +  Y+  + +PS V V VSPS+LVF D+   L+YE+T      P   D   S
Sbjct  694  VRNVGSNSSAVYESKIVSPSGVDVTVSPSKLVFDDKNRSLAYEITIAVSGNPVIVDAKYS  753

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+SWSDG H VTSPIAV W
Sbjct  754  FGSISWSDGVHNVTSPIAVTW  774



>ref|NP_001146035.1| uncharacterized protein LOC100279566 [Zea mays]
 gb|ACL53074.1| unknown [Zea mays]
Length=503

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 128/201 (64%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG  T+ DL TG  STP   G+GHVDP  A DPGLVYD G +
Sbjct  296  SPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGSD  354

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCT+GY    I++F +++ + DC  +    PG LNYP+FA VF +   ++TY+R 
Sbjct  355  DYVAFLCTLGYSPSLISIFTQDASVADCSTK-FARPGDLNYPAFAAVFSSYQDSVTYRRV  413

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP--S  271
            V+NVG   +  YQ T+ +P  V V V+PS+L F  +   L YE+T      P   D   S
Sbjct  414  VRNVGSNSSAVYQPTIASPYGVDVTVTPSKLAFDGKQQSLGYEITIAVSGNPVIVDSSYS  473

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  474  FGSITWSDGAHDVTSPIAVTW  494



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 136/205 (66%), Gaps = 5/205 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KS+L+TT + LDNSG++ + DL +   STP  HG+GHVDP +A +PGLVYD   +
Sbjct  566  SPAAIKSSLVTTAHNLDNSGKN-IKDLASSEESTPFIHGAGHVDPNSALNPGLVYDMDTS  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC IGYDS++IA+F+R  P  D  +   G+PG LNYPSF+VVF++N   +TY+RT
Sbjct  625  DYIAFLCAIGYDSKRIAVFVREPPSSDICSGKEGSPGNLNYPSFSVVFQSNSDEVTYRRT  684

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF----QSVPQFADPS  271
            VKNVG   +  Y+V V  P+NV + VSPS+LVF+     +SY++TF             +
Sbjct  685  VKNVGNSLDAVYEVEVNAPANVDIKVSPSKLVFNAENKTVSYDITFSSVSSGWSSINSAT  744

Query  270  FGSLSWSDGTHLVTSPIAVIWEARS  196
            FGS+ WS+G H V SPIAV W   S
Sbjct  745  FGSIEWSNGIHRVRSPIAVKWRQGS  769



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score =   197 bits (502),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DNSG S + DL TG  STP  HGSGHV+P  A DPGLVYD G +
Sbjct  581  SPAAIKSALMTTAYNSDNSG-SQITDLATGNKSTPLIHGSGHVNPIGALDPGLVYDIGPD  639

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNL------QT  457
            DYV FLC++GY S+ I +F+R+   V+C ++ +  PG LNYPSF+VVF  +       + 
Sbjct  640  DYVTFLCSVGY-SENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSVVFNADSAVIKRGRV  697

Query  456  ITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD  277
            + +KR V+NVG  KN  Y V V  P +V++NVSPS+LVF+++    SYEVTF SV     
Sbjct  698  VKHKRVVRNVGSSKNAVYSVKVNPPPSVKINVSPSKLVFTEKNQVASYEVTFTSVGASLM  757

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
              FGS+ W+DG+H V SP+AV W 
Sbjct  758  TEFGSIEWTDGSHRVRSPVAVRWH  781



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   197 bits (500),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 131/199 (66%), Gaps = 3/199 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT YTLDNSG + + DL  G  STP  HG+GHVDP  A +PGLVYD  VN
Sbjct  567  SPAAIKSALVTTAYTLDNSG-NKIKDLANGGESTPFVHGAGHVDPNRALNPGLVYDIDVN  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DYV F+C+IGY  ++IA+F+R     D C   +L +PG LNYPSFAVVFK   + + YKR
Sbjct  626  DYVAFMCSIGYGPRQIAVFMRELAGDDICARNSLASPGDLNYPSFAVVFKPGRELVKYKR  685

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF-QSVPQFADPSFG  265
             V NVG V +  Y+V V  P+ V ++V PS+LVFS+     SYEVTF + +       +G
Sbjct  686  VVTNVGSVVDAVYEVNVDAPAGVEISVEPSKLVFSEVNQTQSYEVTFAKGIGYVNGERYG  745

Query  264  SLSWSDGTHLVTSPIAVIW  208
            S+ WSDG H V SP+AV W
Sbjct  746  SIEWSDGRHHVRSPVAVRW  764



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score =   197 bits (500),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 128/208 (62%), Gaps = 4/208 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT   LDNSG   + DL TG  STP   G+GHVDP  A DPGLVYD+ V 
Sbjct  575  SPAAIKSALMTTASNLDNSGE-LIKDLATGKESTPFVRGAGHVDPNKALDPGLVYDSQVE  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC IGY  Q+IALF R+   V+C    L +PG LNYP+F+ VF +    +TY R 
Sbjct  634  DYLAFLCAIGYSPQQIALFTRDEIAVNCSALTLASPGDLNYPAFSAVFSSASDVVTYSRV  693

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA---DPSF  268
            V+NVG   + AY+  V  P  V V V+PS+LVF      LSY++T  S+   A     SF
Sbjct  694  VRNVGGPDDAAYEAEVSCPPGVNVTVTPSKLVFDAVEQSLSYKITLASMADAAVAGSRSF  753

Query  267  GSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            G +SWSDG H+V SPIAV W    VS +
Sbjct  754  GWISWSDGAHIVRSPIAVSWRESLVSSI  781



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score =   196 bits (499),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 134/213 (63%), Gaps = 13/213 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG + + DL +G  STP  HG+GHVDP  A +PGLVYD  V+
Sbjct  569  SPAAIKSALMTTAYNLDNSGEN-IKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVS  627

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +YV FLC+IGYD ++I++F+R     D   R L  PG LNYPSF+VVF +N   + YKR 
Sbjct  628  EYVAFLCSIGYDVKRISVFVREPVSSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRV  687

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--------PQF  283
            VKNVG   +  Y+V V  P NV +NV PS+L FS     L+YE+TF  V        PQ 
Sbjct  688  VKNVGSSVDAVYEVKVNAPPNVAINVWPSKLAFSAEKKALAYEITFSIVGLDGLGVSPQQ  747

Query  282  ADPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            +    GS+ WSDG HLV SPIAV     SVS +
Sbjct  748  S----GSIEWSDGVHLVRSPIAVRGIQGSVSSM  776



>gb|KJB70156.1| hypothetical protein B456_011G061400 [Gossypium raimondii]
Length=764

 Score =   196 bits (498),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 128/201 (64%), Gaps = 5/201 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG  T+ DL TG  ++P  +G+GHVDP  A +PGLVYDT  +
Sbjct  556  SPAAIKSALMTTAYNLDNSGH-TINDLATGEEASPFIYGAGHVDPNRALNPGLVYDTDSS  614

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC+IGYDS++I +F+R     D     L  PG LNYPSF+VVF +N   + Y+R 
Sbjct  615  DYIAFLCSIGYDSKRIEVFVREPNSSDVCATKLATPGDLNYPSFSVVFNSNDHVVKYRRK  674

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS----VPQFADPS  271
            VKNVG      Y+  V  P  V+++VSPS+L FS     LSYEV+F S    +       
Sbjct  675  VKNVGTSAGAVYEAKVNAPPGVKISVSPSKLEFSAVNQTLSYEVSFASDSLGLSSVESQG  734

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WSDG HLV SPIAV W
Sbjct  735  FGSIEWSDGVHLVRSPIAVRW  755



>gb|AFW73751.1| putative subtilase family protein [Zea mays]
Length=783

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 128/201 (64%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG  T+ DL TG  STP   G+GHVDP  A DPGLVYD G +
Sbjct  576  SPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGSD  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCT+GY    I++F +++ + DC  +    PG LNYP+FA VF +   ++TY+R 
Sbjct  635  DYVAFLCTLGYSPSLISIFTQDASVADCSTK-FARPGDLNYPAFAAVFSSYQDSVTYRRV  693

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP--S  271
            V+NVG   +  YQ T+ +P  V V V+PS+L F  +   L YE+T      P   D   S
Sbjct  694  VRNVGSNSSAVYQPTIASPYGVDVTVTPSKLAFDGKQQSLGYEITIAVSGNPVIVDSSYS  753

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  754  FGSITWSDGAHDVTSPIAVTW  774



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 131/212 (62%), Gaps = 8/212 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y +DNSG  TL DL TG  S P  HG+GHVDP  A +PGLVYD GVN
Sbjct  616  SPAAIKSALITTAYDVDNSGE-TLRDLATGEESNPFVHGAGHVDPNRALNPGLVYDAGVN  674

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGA------LNYPSFAVVFKNNLQT  457
            DYV FLC+IGYDS  I++F+R     D   +     GA      LNYPSF+VVF +N Q 
Sbjct  675  DYVAFLCSIGYDSALISIFVREPTSSDICAKTFDKIGALISSGDLNYPSFSVVFDSNRQV  734

Query  456  ITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF-QSVPQFA  280
            + YKR V NVG   +  Y+V+V  P+ V + VSPSRLVF     K ++EVTF  SV    
Sbjct  735  VKYKRVVTNVGSETDAVYEVSVSEPAGVDIKVSPSRLVFRADNQKQTFEVTFTTSVDYIK  794

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
               FGS+ W+DGTH V SP+A  W   S + +
Sbjct  795  SSRFGSVVWTDGTHRVRSPVAFKWRTGSAASM  826



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 127/199 (64%), Gaps = 3/199 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG   + DL TG  S P  HG+GHVDP  A +PGLVYD   N
Sbjct  563  SPAAIKSALMTTAYDVDNSGEK-IKDLGTGKESNPFVHGAGHVDPNRALNPGLVYDLNSN  621

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRN-LGNPGALNYPSFAVVFKNNLQTITYK  445
            DY+ FLC+IGYD++KI +F R     D C  R  L +PG LNYPSF+VVF  N   + YK
Sbjct  622  DYLSFLCSIGYDAKKIQIFTREPTSFDVCEKREKLVSPGNLNYPSFSVVFGVNNGLVKYK  681

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            R V NVG   +  Y V V +P  V V+VSPS+LVFS      ++E+TF  V      SFG
Sbjct  682  RVVTNVGGYVDAVYTVKVNSPFGVDVSVSPSKLVFSGENKTQAFEITFARVGYGGSQSFG  741

Query  264  SLSWSDGTHLVTSPIAVIW  208
            S+ WSDG+H+V SPIAV W
Sbjct  742  SIEWSDGSHIVRSPIAVRW  760



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DNSG S + DL +G  STP  HGSGHV+P  A DPGLVYD G +
Sbjct  561  SPAAIKSALMTTAYNSDNSG-SQITDLASGNKSTPLIHGSGHVNPIGALDPGLVYDIGPD  619

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT----  451
            DYV FLC++GY S+ I +F+R+   V+C ++ +  PG LNYPSF+VVF  +   I     
Sbjct  620  DYVTFLCSVGY-SENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSVVFNADSAVIKRGGV  677

Query  450  --YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD  277
              +KR V+NVG  K+  Y V V +P +V++NVSPS+LVF+++    SYEVTF SV     
Sbjct  678  VKHKRVVRNVGSSKDAVYSVKVNSPPSVKINVSPSKLVFTEKNQVASYEVTFTSVGASLM  737

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
              FGS+ W+DG+H V SP+AV W 
Sbjct  738  TVFGSIEWTDGSHRVRSPVAVRWH  761



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 126/199 (63%), Gaps = 3/199 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG   + DL TG  S P  HG+GHVDP  A +PGLVYD  +N
Sbjct  579  SPAAIKSALMTTAYNVDNSG-GKIKDLGTGKESNPFVHGAGHVDPNKALNPGLVYDLNIN  637

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRN-RNLGNPGALNYPSFAVVFKNNLQTITYK  445
            DY+ FLC+IGYD+++I +F R     + C N R   +PG LNYPSF+VVF  N   + YK
Sbjct  638  DYLAFLCSIGYDAKEIQIFTREPTSYNVCENERKFTSPGDLNYPSFSVVFGANNGLVKYK  697

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            R + NVG   +  Y V V  P  V V+VSPS+LVFS      ++EVTF  +      SFG
Sbjct  698  RVLTNVGDSVDAVYTVKVNAPFGVDVSVSPSKLVFSSENKTQAFEVTFTRIGYGGSQSFG  757

Query  264  SLSWSDGTHLVTSPIAVIW  208
            SL WSDG+H+V SPIA  W
Sbjct  758  SLEWSDGSHIVRSPIAARW  776



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 131/199 (66%), Gaps = 9/199 (5%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT Y +DNSG+ T  DL TG  S+P  HGSGHVDP  A DPGLVYD    DYVDF
Sbjct  574  KSALMTTAYNIDNSGK-TFTDLATGQESSPFVHGSGHVDPNRALDPGLVYDIATRDYVDF  632

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVG  424
            LC IGYD ++I+ F++++  V+C  ++L +PG LNYPS   V  ++   + YKR VKNVG
Sbjct  633  LCAIGYDPKRISPFVKDTSSVNCSEKSLVSPGDLNYPS-FSVVFSSESVVKYKRVVKNVG  691

Query  423  KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA-------DPSFG  265
            +  N AY+V +  P++V V V+P++L FS+    LSYE++F S            + +FG
Sbjct  692  RNTNAAYEVKINAPASVEVKVTPTKLSFSEENKSLSYEISFSSNGSVGLERVKGLESAFG  751

Query  264  SLSWSDGTHLVTSPIAVIW  208
            S+ WSDG H V SPIAV W
Sbjct  752  SIEWSDGIHSVRSPIAVHW  770



>ref|XP_002454656.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
 gb|EES07632.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
Length=787

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 128/201 (64%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG  T+ DL TG  STP   G+GHVDP  A DPGLVYD G++
Sbjct  580  SPAAIKSALMTTAYNLDNSGE-TIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGID  638

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCT+GY    I++F ++  + +C +R     G LNYP+FA VF +   ++TY R 
Sbjct  639  DYVAFLCTLGYSPSLISIFTQDGSVANC-SRKFARSGDLNYPAFAAVFSSYQDSVTYHRV  697

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP--S  271
            V+NVG   +  Y+  + +PS V V VSPS+LVF  +   L YE+T      P   D   S
Sbjct  698  VRNVGSNSSAVYEPKIVSPSGVDVTVSPSKLVFDGKQQSLGYEITIAVSGNPVIVDVSYS  757

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  758  FGSITWSDGAHDVTSPIAVTW  778



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 132/203 (65%), Gaps = 4/203 (2%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSAL+TT YTLDN+G+  + DL TG  STP  HG+GHVDP  A +PGL+YD  VNDYV F
Sbjct  571  KSALITTAYTLDNAGKK-IKDLGTGEESTPFVHGAGHVDPNRALNPGLIYDLNVNDYVAF  629

Query  603  LCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNV  427
            LC+IGY  ++IA+F+      D C   +L +PG LNYPSF+VV  ++   I YKR   NV
Sbjct  630  LCSIGYSPRQIAVFVGKPTGSDMCTRNSLASPGDLNYPSFSVVLSSDQGLIKYKRIATNV  689

Query  426  GKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ-SVPQFADPSFGSLSWS  250
            G   +  Y+VTV  P+ V ++V P +LVFS      SYEVTF+  V       +GS+ W+
Sbjct  690  GGDADAVYEVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTFKRGVGYDGGERYGSIEWT  749

Query  249  DGTHLVTSPIAVIW-EARSVSDL  184
            DG HLV SP+AV W  ARS++ +
Sbjct  750  DGRHLVRSPVAVRWSSARSLASM  772



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 133/203 (66%), Gaps = 4/203 (2%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSAL+TT YTLDN+G+  + DL TG  STP  HG+GHVDP  A +PGLVYD  VNDYV F
Sbjct  609  KSALITTAYTLDNAGKK-INDLGTGEESTPFVHGAGHVDPNRALNPGLVYDLNVNDYVAF  667

Query  603  LCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNV  427
            LC+IGY  ++IA+F+      D C   +L +PG LNYPSF+VV  ++   + YKR   NV
Sbjct  668  LCSIGYSPRQIAVFVGKPTGSDICTRNSLASPGDLNYPSFSVVLSSDQGLVKYKRIATNV  727

Query  426  GKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ-SVPQFADPSFGSLSWS  250
            G   +  Y+VTV  P+ V ++V P +LVFS      SYEVTF+  V   +   +GS+ W+
Sbjct  728  GADADAVYEVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTFKRGVGYDSGERYGSIEWT  787

Query  249  DGTHLVTSPIAVIW-EARSVSDL  184
            DG HLV SP+AV W  ARS++ +
Sbjct  788  DGRHLVRSPVAVRWSSARSLASM  810



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score =   191 bits (484),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 131/208 (63%), Gaps = 4/208 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  D+SG  T+ DL T   STP   G+GHVDP  A DPGLVYD+ V+
Sbjct  567  SPAAIKSALMTTAYNSDDSGE-TIKDLATEAESTPFVRGAGHVDPNRALDPGLVYDSNVD  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC + Y   +IA+F RN   V+C    L +PG LNYP+F+V+F +N   +TYKR 
Sbjct  626  DYLAFLCAMEYSPAQIAVFTRNEISVNCSTAALDSPGDLNYPAFSVIFSSNSDVVTYKRV  685

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA---DPSF  268
            V+NVG     AY+  V +P  V V V+PS LVF      LSYE+TF S+   A     ++
Sbjct  686  VRNVGTSAAAAYEARVSSPPGVDVTVTPSTLVFDAVNVSLSYEITFTSLASQAVAGSYAY  745

Query  267  GSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            GS+SWSDG H V SPIAV W+   VS +
Sbjct  746  GSISWSDGDHDVRSPIAVTWDLSLVSSI  773



>gb|ACJ26761.1| subtilisin-like protein [Nicotiana benthamiana]
Length=191

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 113/169 (67%), Gaps = 8/169 (5%)
 Frame = -1

Query  690  AHGSGHVDPTNAADPGLVYDTGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP  511
             +GSGHVDP  A DPGL+YD   +DYV+FLC+IGYD   +A+F R+S  V+C  R+L  P
Sbjct  14   CYGSGHVDPNRALDPGLIYDIETSDYVNFLCSIGYDGDDVAVFARDSSRVNCSERSLATP  73

Query  510  GALNYPSFAVVFKNNLQ-TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSD  334
            G LNYPSF+VVF       + YKR VKNVGK  +  Y+V V  PS+V VNVSP++LVFS+
Sbjct  74   GDLNYPSFSVVFTGESNGVVKYKRVVKNVGKNTDAVYEVKVNAPSSVEVNVSPAKLVFSE  133

Query  333  RIDKLSYEVTFQS-------VPQFADPSFGSLSWSDGTHLVTSPIAVIW  208
                LSYE++ +S       + +  + +FGS+ WSDG H V SPIAV W
Sbjct  134  EKQSLSYEISLKSKKSGDLQMVKGIESAFGSIEWSDGIHNVRSPIAVRW  182



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 129/196 (66%), Gaps = 3/196 (2%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSAL+TT YTLD+SG+  + DL TG  STP  HG+GHVDP  A +PGL+YD  VNDYV F
Sbjct  571  KSALITTAYTLDDSGKK-IRDLATGKESTPFVHGAGHVDPNRALNPGLIYDLNVNDYVAF  629

Query  603  LCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNV  427
            LC+IGY  ++IA+FL      D C   +L +PG LNYPS +V+  ++   + YKR   NV
Sbjct  630  LCSIGYSPRQIAVFLGKPTGSDICTKNSLASPGDLNYPSLSVILSSDQSLVKYKRVATNV  689

Query  426  GKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF-QSVPQFADPSFGSLSWS  250
            G   +  Y+V V  P+ V ++VSPS+L FS+    LSYEVTF + V       +GS+ W+
Sbjct  690  GGNVDAVYKVNVTAPAGVEISVSPSKLEFSEENQSLSYEVTFRRGVGYDGGERYGSIEWT  749

Query  249  DGTHLVTSPIAVIWEA  202
            DG+HLV SP+AV W +
Sbjct  750  DGSHLVRSPVAVRWSS  765



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 130/209 (62%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y +DNSG S + DL TG  S P  HG+GHVDP  A DPGLVYD  + 
Sbjct  571  SPAMIKSALVTTAYNVDNSGES-IKDLATGKSSNPFIHGAGHVDPNKALDPGLVYDIDMK  629

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GYD   I++F+ +  L + C    L  PG LNYPS   V  ++ + + Y+R
Sbjct  630  EYVAFLCAVGYDWPAISVFIHDPKLFNACETSKLRTPGDLNYPSLVAVLGSSGEVVKYRR  689

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV----PQFADP  274
             VKNVG   +  Y V + +P+NV + VSPSRL FS    +L YEVTF+SV       A+P
Sbjct  690  VVKNVGSKADAVYNVGINSPTNVEIEVSPSRLEFSKEKRELEYEVTFRSVVLGGRVGAEP  749

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSV  193
               FGS+ W+DG H+V SP+A+ W   SV
Sbjct  750  REEFGSIEWTDGDHVVRSPVAIRWSQGSV  778



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 132/206 (64%), Gaps = 3/206 (1%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT+Y+LD+SG S + DL T   S P  HG+GH+DP  A +PGL+YD    
Sbjct  567  SPAAIKSALITTSYSLDSSG-SPIKDLATSEESNPFVHGAGHIDPNQALNPGLIYDLTPQ  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC+IGYDS++IA+F++ S         L NPG LNYPSF+VVF +  + + Y RT
Sbjct  626  DYVSFLCSIGYDSKQIAVFVKGSSYSQLCEHKLSNPGNLNYPSFSVVFDDG-EVVKYTRT  684

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD-PSFGS  262
            V NVG    V Y V V  P  V ++V P++L F+     LSYE+TF  +  F +  SFGS
Sbjct  685  VTNVGDETEVVYGVKVEAPQGVEISVVPNKLEFNKEKTTLSYEITFTKINGFKESASFGS  744

Query  261  LSWSDGTHLVTSPIAVIWEARSVSDL  184
            + WSDG H V SPIAV ++  S++ +
Sbjct  745  IQWSDGIHNVRSPIAVSFKTGSIASM  770



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 128/204 (63%), Gaps = 8/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG + + DL TG  S P  HG+GHVDP  A +PGLVYD  V 
Sbjct  573  SPAAIKSALVTTAYDVENSGEA-IEDLATGKSSNPFIHGAGHVDPNKALNPGLVYDIEVK  631

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+VVF +  +   Y+R
Sbjct  632  EYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSTGEVAKYRR  691

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS------VPQFA  280
             VKNVG   +  Y+V V++P+NV + VSPS+LVFS    +L YEVTF+S      V    
Sbjct  692  VVKNVGSNVDAVYEVGVKSPANVEIEVSPSKLVFSKEKRELEYEVTFKSVVLGGGVGSMP  751

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
               FGS+ W+DG H+V SP+A  W
Sbjct  752  GQEFGSIEWTDGDHVVKSPVAFQW  775



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 133/210 (63%), Gaps = 8/210 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   L DL TG PS    HG+GHVDP  A +PGLVYD  V 
Sbjct  576  SPAAVKSALVTTAYDVENSGE-PLEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIEVK  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFAVVF ++ + + YKR
Sbjct  635  EYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFGSSGEVVKYKR  694

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ----SVPQFADP  274
             VKNVG   +  Y+V V++P+NV ++VSPS+L F+    +L YEVTF+         + P
Sbjct  695  VVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLEFNKEKSELEYEVTFKSVVLGGGVGSVP  754

Query  273  S--FGSLSWSDGTHLVTSPIAVIWEARSVS  190
            S  FGS+ W+DG H+V SP+AV W   S S
Sbjct  755  SQEFGSIEWTDGDHVVKSPVAVQWGKGSSS  784



>gb|ACB87529.1| subtilisin protease [Triticum aestivum]
Length=571

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 124/201 (62%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG   + DL TG  STP   G+GHVDP +A DPGLVYD    
Sbjct  364  SPAAVKSALMTTAYNLDNSGE-IIKDLATGTESTPFVRGAGHVDPNSALDPGLVYDADTA  422

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC +GY   +IA+F R+  + DC  +     G LNYP+FA VF +   ++TY R 
Sbjct  423  DYIGFLCALGYTPSQIAVFTRDGSVADCLKKP-ARSGDLNYPAFAAVFSSYKDSVTYHRV  481

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP--S  271
            V+NVG   +  Y+  V +P+ V   V+P++LVF +    L+YE+T      P   D   S
Sbjct  482  VRNVGSDASAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVSGNPVIVDAKYS  541

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  542  FGSVTWSDGKHNVTSPIAVTW  562



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 126/211 (60%), Gaps = 7/211 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG   + DL TG  S P  HG+GHVDP  A +PGLVYD+ +N
Sbjct  569  SPAAIKSALMTTAYNVDNSG-GNIKDLGTGKESNPFTHGAGHVDPNRALNPGLVYDSDIN  627

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-C-----RNRNLGNPGALNYPSFAVVFKNNLQT  457
            DY+ FLC+IGYD+ +IA+F R     + C     R   L +PG LNYPSF+V        
Sbjct  628  DYLAFLCSIGYDANQIAVFTREPAAANPCEGKVGRTGRLASPGDLNYPSFSVELGRGSDL  687

Query  456  ITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD  277
            + YKR V NVG V +  Y V V  P  V V V+P+ LVFS      ++EV F  V     
Sbjct  688  VKYKRVVTNVGSVVDAVYTVKVNAPPGVDVTVAPNTLVFSGENKTQAFEVAFSRVTPATS  747

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             SFGS+ W+DG+H+V SPIAV W   S S L
Sbjct  748  DSFGSIEWTDGSHVVRSPIAVRWSGDSSSSL  778



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 130/199 (65%), Gaps = 9/199 (5%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT Y +DNSG+ T  DL TG  S+P  HGSGHVDP  A DPGLVYD  + DYV+F
Sbjct  571  KSALMTTAYNVDNSGK-TFTDLATGQESSPFVHGSGHVDPNRALDPGLVYDIEMKDYVNF  629

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVG  424
            LC IGYD ++I+ F++ +  V+C  ++  +PG LNYPS   V  ++   + YKR VKNVG
Sbjct  630  LCAIGYDPKRISPFVKETSSVNCSEKSFVSPGDLNYPS-FSVVFSSESVVKYKRVVKNVG  688

Query  423  KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS-------VPQFADPSFG  265
            +  N  Y+V +  P++V V V+P++L FS+    LSYE++F S         +  + +FG
Sbjct  689  RNTNAVYEVKISVPASVEVKVTPTKLSFSEENKSLSYEISFSSNGSVGLETVKGLESAFG  748

Query  264  SLSWSDGTHLVTSPIAVIW  208
            S+ WSDG H V SPIAV W
Sbjct  749  SIEWSDGIHSVRSPIAVYW  767



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 126/211 (60%), Gaps = 7/211 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG   + DL TG  S P  HG+GHVDP  A +PGLVYD+ +N
Sbjct  601  SPAAIKSALMTTAYNVDNSG-GNIKDLGTGKESNPFTHGAGHVDPNRALNPGLVYDSDIN  659

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-C-----RNRNLGNPGALNYPSFAVVFKNNLQT  457
            DY+ FLC+IGYD+ +IA+F R     + C     R   L +PG LNYPSF+V        
Sbjct  660  DYLAFLCSIGYDANQIAVFTREPAAANPCEGKVGRTGRLASPGDLNYPSFSVELGRGSDL  719

Query  456  ITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD  277
            + YKR V NVG V +  Y V V  P  V V V+P+ LVFS      ++EV F  V     
Sbjct  720  VKYKRVVTNVGSVVDAVYTVKVNAPPGVDVTVAPNTLVFSGENKTQAFEVAFSRVTPATS  779

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             SFGS+ W+DG+H+V SPIAV W   S S L
Sbjct  780  DSFGSIEWTDGSHVVRSPIAVRWSGDSSSSL  810



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 129/204 (63%), Gaps = 8/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   L DL TG PS    HG+GHVDP  A +PGLVYD  V 
Sbjct  575  SPAAVKSALVTTAYDVENSGE-PLEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIEVK  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFAVVF +    + YKR
Sbjct  634  EYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFGSTGDVVKYKR  693

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ----SVPQFADP  274
             VKNVG   +  Y+V V++P+NV ++VSPS+L F+    +L YEVTF+         + P
Sbjct  694  VVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLEFNKEKSELEYEVTFKSVVLGGGVGSVP  753

Query  273  S--FGSLSWSDGTHLVTSPIAVIW  208
            S  FGS+ W+DG H+V SP+AV W
Sbjct  754  SQEFGSIEWTDGDHVVKSPVAVQW  777



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 125/205 (61%), Gaps = 10/205 (5%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   KSAL+TT Y +D++G + + DL TG  S    HG+GHVDP  A DPGLVYD   +D
Sbjct  542  PAAIKSALVTTAYVVDDNG-APISDLATGGKSNSFVHGAGHVDPNRALDPGLVYDIQTSD  600

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTV  436
            YV FLCTIGYD+ +I++F   +   DC    LG PG LNYPSF+ VF      + YKRTV
Sbjct  601  YVAFLCTIGYDANRISVFTDAAYSTDCSAVGLGTPGNLNYPSFSAVFSGRGAVVKYKRTV  660

Query  435  KNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD-------  277
            KNVG   +  Y+V V+ P    V V+PS+L FS    +LS+EV   SV    D       
Sbjct  661  KNVGLNADAVYEVEVKAPIGASVTVTPSKLTFSQNATELSFEVELSSVAGAVDLESSGSS  720

Query  276  -PSFGSLSWSD-GTHLVTSPIAVIW  208
              +FGS+ WSD G+H V SP+AV+W
Sbjct  721  LAAFGSIEWSDGGSHRVRSPVAVLW  745



>gb|KHN01421.1| Subtilisin-like protease [Glycine soja]
Length=387

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 121/204 (59%), Gaps = 9/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG S + DL +G  S P  HG+GHVDP  A +PGLVYD    
Sbjct  178  SPAAIKSALMTTAYNVDNSGGS-IKDLGSGKESNPFIHGAGHVDPNRAINPGLVYDLDTG  236

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD--C-----RNRNLGNPGALNYPSFAVVFKNNLQ  460
            DYV FLC++GYD+ +IA+F R  P  +  C     R   L +PG LNYPSFAV       
Sbjct  237  DYVAFLCSVGYDANQIAVFTRE-PAAESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGD  295

Query  459  TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA  280
             +  KR V NVG   +  Y V V  P  V V VSPS +VFS      ++EVTF  V    
Sbjct  296  LVKNKRVVTNVGSEVDAVYTVKVNPPPGVGVGVSPSTIVFSAENKTQAFEVTFSRVKLDG  355

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
              SFGS+ W+DG+H+V SPIAV W
Sbjct  356  SESFGSIEWTDGSHVVRSPIAVTW  379



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 128/209 (61%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  565  SPAAIKSALVTTAYDIENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIDVK  623

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY    I +FL++  L D C    L   G LNYPSF+V+F + +  + YKR
Sbjct  624  EYVAFLCAVGYSFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVIFGSTVDVVKYKR  683

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA------  280
             VKNVG   +  YQV V++P NV ++VSPS+L FS    +L YEVTF+SV          
Sbjct  684  VVKNVGSNVDAVYQVGVKSPVNVEIDVSPSKLEFSKEKSELEYEVTFKSVVLGGGVGSVP  743

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEARSV  193
               FGS+ W+DG H+V SP+AV W   SV
Sbjct  744  GQEFGSIQWTDGEHVVKSPVAVQWRQSSV  772



>gb|EAY87746.1| hypothetical protein OsI_09161 [Oryza sativa Indica Group]
Length=536

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 125/201 (62%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG + + DL TG  STP   G+GHVDP  A DPGLVYD G  
Sbjct  329  SPAAIKSALMTTAYNVDNSG-AVIKDLATGTESTPFVRGAGHVDPNRALDPGLVYDAGTE  387

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCT+GY    I+LF  +  + +C  +     G LNY +FAVV  +   ++TY R 
Sbjct  388  DYVSFLCTLGYSPSIISLFTTDGSVANCSTK-FPRTGDLNYAAFAVVLSSYKDSVTYHRV  446

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFADP--S  271
            V+NVG   N  Y+  + +PS V V VSPS+LVF +    LSY++T  +   P   D   +
Sbjct  447  VRNVGSNANAVYEAKIDSPSGVDVTVSPSKLVFDESHQSLSYDITIAASGNPVIVDTEYT  506

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  507  FGSVTWSDGVHDVTSPIAVTW  527



>ref|XP_010465286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=789

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 130/205 (63%), Gaps = 9/205 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   L DL TG PS    HG+GHVDP  A +PGLVYD  V 
Sbjct  577  SPAAVKSALVTTAYDVENSGE-PLEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIEVK  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNL-QTITYK  445
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSFAVVF +   + + YK
Sbjct  636  EYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFGSTTGEVVKYK  695

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ----SVPQFAD  277
            R VKNVG   +  Y+V V++P+NV ++VSPS+L FS    +L YEVTF+         + 
Sbjct  696  RVVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLEFSKEKSELEYEVTFKSVVLGGGVGSV  755

Query  276  PS--FGSLSWSDGTHLVTSPIAVIW  208
            PS  FGS+ W+DG H+V SP+AV W
Sbjct  756  PSQEFGSIEWTDGDHVVKSPVAVQW  780



>dbj|BAH20348.1| AT3G14067 [Arabidopsis thaliana]
Length=601

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 129/209 (62%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  391  SPAAIKSALVTTAYDVENSGEP-IEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVK  449

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+VVF +  + + YKR
Sbjct  450  EYVAFLCAVGYEFPGILVFLQDPTLYDACDTSKLRTAGDLNYPSFSVVFASTGEVVKYKR  509

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  Y+V V++P+NV ++VSPS+L FS     L YEVTF+SV          
Sbjct  510  VVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVP  569

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSV  193
               FGS+ W+DG H+V SP+AV W   SV
Sbjct  570  GHEFGSIEWTDGEHVVKSPVAVQWGQGSV  598



>ref|NP_001048301.1| Os02g0779200 [Oryza sativa Japonica Group]
 dbj|BAD19517.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10215.1| Os02g0779200 [Oryza sativa Japonica Group]
 gb|EAZ24820.1| hypothetical protein OsJ_08598 [Oryza sativa Japonica Group]
Length=782

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 125/201 (62%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNS  + + DL TG  STP   G+GHVDP  A DPGLVYD G  
Sbjct  575  SPAAIKSALMTTAYNVDNS-SAVIKDLATGTESTPFVRGAGHVDPNRALDPGLVYDAGTE  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLCT+GY    I+LF  +  + +C  +     G LNYP+FAVV  +   ++TY R 
Sbjct  634  DYVSFLCTLGYSPSIISLFTTDGSVANCSTK-FPRTGDLNYPAFAVVLSSYKDSVTYHRV  692

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFADP--S  271
            V+NVG   N  Y+  + +PS V V VSPS+LVF +    LSY++T  +   P   D   +
Sbjct  693  VRNVGSNANAVYEAKIDSPSGVDVTVSPSKLVFDESHQSLSYDITIAASGNPVIVDTEYT  752

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  753  FGSVTWSDGVHDVTSPIAVTW  773



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 130/212 (61%), Gaps = 8/212 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  567  SPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVK  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L + C    L   G LNYPSF+VVF +  + + YKR
Sbjct  626  EYVAFLCAVGYEFPGILVFLQDPTLFNACETSKLRTAGDLNYPSFSVVFGSTGEVVKYKR  685

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  Y+V V++P+NV ++VSPS+L FS    +L YEVTF+SV          
Sbjct  686  AVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSELEYEVTFKSVVLGGGVGSVP  745

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
               FGS+ W+DG H+V SP+AV W   SV   
Sbjct  746  GHEFGSIEWADGEHVVKSPVAVQWGQGSVQSF  777



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 129/212 (61%), Gaps = 8/212 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  567  SPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVK  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+VVF +  + + YKR
Sbjct  626  EYVAFLCAVGYEFPGILVFLQDPTLYDACETSKLRTAGDLNYPSFSVVFASTGEVVKYKR  685

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  Y+V V++P+NV ++VSPS+L FS     L YEVTF+SV          
Sbjct  686  VVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVP  745

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
               FGS+ W+DG H+V SP+AV W   SV   
Sbjct  746  GHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  777



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 129/212 (61%), Gaps = 8/212 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y ++NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  567  SPAAIKSALVTTAYDVENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVK  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+VVF +  + + YKR
Sbjct  626  EYVAFLCAVGYEFPGILVFLQDPTLYDACETSKLRTAGDLNYPSFSVVFASTGEVVKYKR  685

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  Y+V V++P+NV ++VSPS+L FS     L YEVTF+SV          
Sbjct  686  VVKNVGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVP  745

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
               FGS+ W+DG H+V SP+AV W   SV   
Sbjct  746  GHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  777



>emb|CBI35855.3| unnamed protein product [Vitis vinifera]
Length=1791

 Score =   187 bits (474),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = -1

Query  798   APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
             +P   KSALMTT Y  DNSG S + DL TG  STP  HGSGHV+P  A DPGLVYD G +
Sbjct  983   SPAAIKSALMTTAYNSDNSG-SQITDLATGNKSTPLIHGSGHVNPIGALDPGLVYDIGPD  1041

Query  618   DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
             DYV FLC++GY S+ I +F+R+   V+C ++ +  PG LNYPSF+V            R 
Sbjct  1042  DYVTFLCSVGY-SENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSV------------RV  1087

Query  438   VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGSL  259
             V+NVG  KN  Y V V  P +V++NVSPS+LVF+++    SYEVTF SV       FGS+
Sbjct  1088  VRNVGSSKNAVYSVKVNPPPSVKINVSPSKLVFTEKNQVASYEVTFTSVGASLMTEFGSI  1147

Query  258   SWSDGTHLVTSPIAVIWE  205
              W+DG+H V SP+AV W 
Sbjct  1148  EWTDGSHRVRSPVAVRWH  1165


 Score =   185 bits (469),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 117/196 (60%), Gaps = 7/196 (4%)
 Frame = -1

Query  795   PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
             P   KSALMTT Y LDNSG + + DL TG  S+P  HG+GHVDP  A  PGLVYD   ND
Sbjct  1594  PAAIKSALMTTAYNLDNSG-NNIADLATGNQSSPFIHGAGHVDPNRALYPGLVYDIDAND  1652

Query  615   YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK------NNLQTI  454
             Y+ FLC IGYD+++IA+F+R    VDC    L  PG LNYP+F+VVF       +    I
Sbjct  1653  YISFLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFDHDPVHQGNEI  1712

Query  453   TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP  274
               KR VKNVG   N  Y+V V  P  + V+VSP +LVFS      SYEV+F SV  +   
Sbjct  1713  KLKRVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVSFTSVESYIGS  1772

Query  273   SFGSLSWSDGTHLVTS  226
              FGS+ W     L +S
Sbjct  1773  RFGSIEWKYKLFLCSS  1788



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 127/209 (61%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y  +NSG   + DL TG  S    HG+GHVDP  A +PGLVYD    
Sbjct  565  SPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIHGAGHVDPNKALNPGLVYDVDAK  623

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DYV FLC +GY+   I +FL++  L D C    L   G LNYPSF+VVF +N   + Y+R
Sbjct  624  DYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSNDGVVKYRR  683

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  Y+V V+ P+NV ++VSPS+L FS    ++ YEVTF+SV          
Sbjct  684  VVKNVGSNVDAVYEVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGSVP  743

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSV  193
               FGS+ W+DG H+V SP+AV W   SV
Sbjct  744  GHEFGSIEWTDGEHVVKSPVAVQWSQGSV  772



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 128/209 (61%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y  +NSG   + DL TG  S    HG+GHVDP  A +PGLVYD    
Sbjct  565  SPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIHGAGHVDPNKALNPGLVYDLDAK  623

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+VVF +++  + Y+R
Sbjct  624  EYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSSVDVVKYRR  683

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  YQV V+ P+NV ++VSPS+L FS    ++ YEVTF+SV          
Sbjct  684  VVKNVGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGSVP  743

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSV  193
               FGS+ W+DG H+V SP+AV W   SV
Sbjct  744  GHEFGSIEWTDGEHVVKSPVAVQWSQGSV  772



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 129/212 (61%), Gaps = 8/212 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y  +NSG   + DL TG PS    HG+GHVDP  A +PGLVYD  V 
Sbjct  526  SPAAIKSALVTTAYDTENSGE-PIEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIDVK  584

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DYV FLC +GY+   I +FL++  L + C    L   G LNYPSF+VVF + +  + Y+R
Sbjct  585  DYVAFLCAVGYEFPGILVFLQDPTLYNACETSKLKTSGDLNYPSFSVVFGSTVDVVKYRR  644

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  Y+V V++P+NV ++VSP +L FS    +L YEVTF+SV          
Sbjct  645  VVKNVGTNVDAVYEVGVKSPANVEIDVSPRKLAFSKGEGELEYEVTFRSVVLGGGVGSVP  704

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
               FGS+ W+DG H+V SP+AV W   SV   
Sbjct  705  GHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF  736



>gb|EMT02947.1| Subtilisin-like protease [Aegilops tauschii]
Length=411

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 126/201 (63%), Gaps = 4/201 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+G   + D+ TG  STP A G+GHVDP  A DPGLVYD G++
Sbjct  203  SPAAIKSALMTTAYNMDNAGH-VIGDMATGKASTPFARGAGHVDPNRALDPGLVYDAGMD  261

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNR-NLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DYV FLC +GY + ++A+F R+    +C      G  G  NYP+F  VF +  +TIT  R
Sbjct  262  DYVTFLCALGYTADEVAIFTRDGSSTNCSTLPGSGYVGDHNYPAFVAVFTSRNETITQHR  321

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADPSF  268
             V+NVG   +  Y+ TV +P+ +RV+V P +L FS   +   Y+VTF  ++     + +F
Sbjct  322  MVRNVGNNVDATYRATVTSPAGMRVDVKPQKLQFSTTHNTQEYQVTFSIRAAGSIKEYTF  381

Query  267  GSLSWSDGTHLVTSPIAVIWE  205
            GS++WSDG H VTSP A+ W 
Sbjct  382  GSITWSDGKHTVTSPNAIAWR  402



>gb|AFW73750.1| putative subtilase family protein [Zea mays]
Length=787

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 128/203 (63%), Gaps = 6/203 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y +DN+G   + D+ TG  STP   G+GHVDP  A DPGLVYD G +
Sbjct  579  SPAAVKSAMMTTAYNVDNAG-DIIKDMSTGKASTPFVRGAGHVDPDRAVDPGLVYDAGAD  637

Query  618  DYVDFLCTIGYDSQKIALF-LRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +Y+ FLC IGY +++IA+F  ++ P VDC  R   + G  NYP+F+VV  +    +T +R
Sbjct  638  EYLSFLCAIGYTAEQIAVFRTKDDPAVDCSKRK-ASVGDHNYPAFSVVLNSTRDAVTQRR  696

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP---S  271
             V+NVG      Y  +V +P+ VRV V+P +L FS      +YE+TF S   ++ P   +
Sbjct  697  VVRNVGSSARATYWASVTSPAGVRVTVNPRKLRFSATQKTQAYEITFTSRRMWSVPDKYT  756

Query  270  FGSLSWSDGTHLVTSPIAVIWEA  202
            FGS+ WSDG H VTSPIA+ W A
Sbjct  757  FGSIVWSDGEHKVTSPIAITWPA  779



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 128/209 (61%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y  +NSG   + DL TG  S    HG+GHVDP  A +PGL+YD    
Sbjct  565  SPAAIKSALVTTAYDTENSGE-PIEDLATGESSNSFIHGAGHVDPNKALNPGLIYDLDAK  623

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +YV FLC +GY+   I +FL++  L D C    L   G LNYPSF+VVF +++  + Y+R
Sbjct  624  EYVAFLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSSVDVVKYRR  683

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  YQV V+ P+NV ++VSPS+L FS    ++ YEVTF+SV          
Sbjct  684  VVKNVGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGSVP  743

Query  273  --SFGSLSWSDGTHLVTSPIAVIWEARSV  193
               FGS+ W+DG H+V SP+AV W   SV
Sbjct  744  GHEFGSIEWTDGEHVVKSPVAVQWSQGSV  772



>gb|AGN03879.1| senescence-associated subtilisin protease [Triticum aestivum]
Length=786

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 123/196 (63%), Gaps = 6/196 (3%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT Y +DNSG   + DL TG  STP   G+GHVDP +A +PGLVYD    DY+ F
Sbjct  584  KSALMTTAYNMDNSGE-IIKDLATGTESTPFVRGAGHVDPISALNPGLVYDADTADYIGF  642

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVG  424
            LC +GY   +IA+F R+  + DC ++     G LNYP+FA VF +   ++TY R V+NVG
Sbjct  643  LCALGYTPAQIAVFTRDGSVADC-SKKPARSGDLNYPAFAAVFSSYKDSVTYHRVVRNVG  701

Query  423  KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP--SFGSLS  256
               +  Y+  V +P+ V   V+P++LVF +    L+YE+T      P   D   SFGS++
Sbjct  702  SDASAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVSGNPVIVDAKYSFGSVT  761

Query  255  WSDGTHLVTSPIAVIW  208
            WSDG H VTSPIAV W
Sbjct  762  WSDGKHNVTSPIAVTW  777



>dbj|BAJ93208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   182 bits (463),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 123/201 (61%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG   + DL TG  STP   G+GHVDP +A +PGLVYD    
Sbjct  577  SPAAVKSALMTTAYNLDNSGE-IIKDLATGSQSTPFVRGAGHVDPNSALNPGLVYDADTA  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC +GY   +IA+F R+  + DC ++     G LNYP+FA VF +   ++TY R 
Sbjct  636  DYIGFLCALGYTPSQIAVFTRDGSVADC-SKKPARSGDLNYPAFAAVFSSYKDSVTYHRV  694

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFADP--S  271
            V NVG      Y+  V +P+ V   V+P++LVF +    L+YE+T      P   D   S
Sbjct  695  VSNVGGDPKAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVAGNPVIVDGKYS  754

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  755  FGSVTWSDGVHNVTSPIAVTW  775



>dbj|BAJ87876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   182 bits (462),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 123/201 (61%), Gaps = 6/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG   + DL TG  STP   G+GHVDP +A +PGLVYD    
Sbjct  577  SPAAVKSALMTTAYNLDNSGE-IIKDLATGSQSTPFVRGAGHVDPNSALNPGLVYDADTA  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC +GY   +IA+F R+  + DC ++     G LNYP+FA VF +   ++TY R 
Sbjct  636  DYIGFLCALGYTPSQIAVFTRDGSVADC-SKKPARSGDLNYPAFAAVFSSYKDSVTYHRV  694

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFADP--S  271
            V NVG      Y+  V +P+ V   V+P++LVF +    L+YE+T      P   D   S
Sbjct  695  VSNVGGDPKAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVAGNPVIVDGKYS  754

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WSDG H VTSPIAV W
Sbjct  755  FGSVTWSDGVHNVTSPIAVTW  775



>emb|CDX97539.1| BnaA05g25400D [Brassica napus]
Length=481

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 126/204 (62%), Gaps = 8/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y  +NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  270  SPAAIKSALVTTAYDTENSGEP-IEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIDVK  328

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DYV FLC +GY+   I +FL++  L + C    L   G LNYPSF+VVF + +  + Y+R
Sbjct  329  DYVAFLCAVGYEFPGILVFLQDPTLYNACETSKLRTAGDLNYPSFSVVFGSTVDVVKYRR  388

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG   +  Y+V V++P+NV ++VSP +L FS    +L YEVTF+SV          
Sbjct  389  VVKNVGTNVDAVYEVGVKSPANVEIDVSPRKLAFSKGEGELEYEVTFRSVVLGGGVGSVP  448

Query  273  --SFGSLSWSDGTHLVTSPIAVIW  208
               FGS+ W+DG H+V SP+AV W
Sbjct  449  GHEFGSIEWTDGEHVVKSPVAVQW  472



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease SBT1.7 [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 124/196 (63%), Gaps = 3/196 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT+Y+LD+SG+  + DL T   S P  HG+GH++P  A +PGL+YD    
Sbjct  567  SPAAIKSALITTSYSLDSSGK-PIKDLSTSEESNPFVHGAGHINPNQALNPGLIYDLTPQ  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC+IGYDS++IA+F++ S         L NPG LNYPSF+VVF    + + Y RT
Sbjct  626  DYVSFLCSIGYDSKQIAVFVKGSSYFQLCEHKLTNPGNLNYPSFSVVFDEE-EVVKYTRT  684

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD-PSFGS  262
            V NVG    V Y+V V  P  V ++V P++L F+      SYE+TF  +  F +  SFGS
Sbjct  685  VTNVGDETEVVYEVKVEAPQGVVISVVPNKLEFNKEKTTQSYEITFTKINGFKESASFGS  744

Query  261  LSWSDGTHLVTSPIAV  214
            + W DG H V SPIAV
Sbjct  745  IQWGDGIHSVRSPIAV  760



>gb|KHN39620.1| Subtilisin-like protease, partial [Glycine soja]
Length=618

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 123/206 (60%), Gaps = 9/206 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG   + DL +G  S P  HG+GHVDP  A +PGLVYD   N
Sbjct  409  SPAAIKSALMTTAYNVDNSG-GNIKDLGSGKESNPFIHGAGHVDPNRALNPGLVYDLDSN  467

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD--C-----RNRNLGNPGALNYPSFAVVFKNNLQ  460
            DY+ FLC++GYD+ +IA+F R  P V+  C     R   L +PG LNYPSFAV       
Sbjct  468  DYLAFLCSVGYDANQIAVFTRE-PAVESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGD  526

Query  459  TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA  280
             + Y+R V NVG   +V Y V V  P  V V VSPS LVFS      ++EVTF       
Sbjct  527  LVKYRRVVTNVGSEVDVVYTVKVNAPPGVGVGVSPSTLVFSGENKTQAFEVTFSRAKLDG  586

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEA  202
              SFGS+ W+DG+H+V SPIAV   A
Sbjct  587  SESFGSIEWTDGSHVVRSPIAVTLSA  612



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 123/206 (60%), Gaps = 9/206 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG   + DL +G  S P  HG+GHVDP  A +PGLVYD   N
Sbjct  564  SPAAIKSALMTTAYNVDNSG-GNIKDLGSGKESNPFIHGAGHVDPNRALNPGLVYDLDSN  622

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD--C-----RNRNLGNPGALNYPSFAVVFKNNLQ  460
            DY+ FLC++GYD+ +IA+F R  P V+  C     R   L +PG LNYPSFAV       
Sbjct  623  DYLAFLCSVGYDANQIAVFTRE-PAVESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGD  681

Query  459  TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA  280
             + Y+R V NVG   +V Y V V  P  V V VSPS LVFS      ++EVTF       
Sbjct  682  LVKYRRVVTNVGSEVDVVYTVKVNAPPGVGVGVSPSTLVFSGENKTQAFEVTFSRAKLDG  741

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEA  202
              SFGS+ W+DG+H+V SPIAV   A
Sbjct  742  SESFGSIEWTDGSHVVRSPIAVTLSA  767



>ref|XP_006841679.1| PREDICTED: subtilisin-like protease [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 121/201 (60%), Gaps = 5/201 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+G ST+ DL  G  STP   GSGHVDP  A DPGLVYD    
Sbjct  562  SPAAVKSALMTTAYDSDNNG-STIKDLADGKESTPFVRGSGHVDPNRALDPGLVYDIKPE  620

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV +LC +GYDS +IA+F      VDCR       G LNYPSF++VF        + RT
Sbjct  621  DYVAYLCALGYDSVRIAVFTGGKS-VDCRVVGFAKSGDLNYPSFSMVFGPGKTVAKFSRT  679

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DPSFG  265
            V NVG  ++ AY  ++  P +VR+ V P +LVF  +   LSY VTF+ V  ++  D  FG
Sbjct  680  VTNVGDARS-AYAASINGPDSVRIRVDPEKLVFCAQNQSLSYSVTFEYVEGYSPLDTCFG  738

Query  264  SLSWSDGTHLVTSPIAVIWEA  202
             L+WSDG H V SPIA  WE 
Sbjct  739  LLTWSDGRHDVKSPIAFSWEG  759



>ref|XP_003570496.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=785

 Score =   180 bits (456),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 127/210 (60%), Gaps = 11/210 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DNSG  T+ DL TG  STP   G+GHVDP NA DPGLVYD   +
Sbjct  574  SPAAVKSALMTTAYNEDNSGE-TIKDLATGVESTPFVRGAGHVDPNNALDPGLVYDADAD  632

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC +GY    I++F R+  + DC ++     G LNYP+FA VF ++  T+TY R 
Sbjct  633  DYVGFLCALGYSPSLISVFTRDGSVADC-SKKPARSGDLNYPTFAAVFGSDNDTVTYHRV  691

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP-----  274
            V+NVG   N  Y+    +P+ V V V+PS+L F +    L Y++T  +V    +P     
Sbjct  692  VRNVGSNANAVYEARFVSPAGVDVTVTPSKLAFDEEHQSLGYKITL-AVSTKKNPVIVNA  750

Query  273  --SFGSLSWSDGT-HLVTSPIAVIWEARSV  193
              SFGSL+WSDG  H VTS IAV W + S 
Sbjct  751  KYSFGSLTWSDGAGHNVTSAIAVTWPSSSA  780



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 126/204 (62%), Gaps = 8/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y  +NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  565  SPAAIKSALVTTAYDTENSGE-PIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIDVK  623

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DYV FLC +GY+   I +FL++  L + C    L   G LNYPSF+VVF +++  + Y+R
Sbjct  624  DYVAFLCAVGYEFPGILVFLQDPTLYNACETSKLRTAGDLNYPSFSVVFGSSVDVVKYRR  683

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----  274
             VKNVG      Y+V V++P+NV ++VSP RL FS    +L YEVTF+SV          
Sbjct  684  VVKNVGTNVEAVYEVGVKSPANVEIDVSPRRLAFSKGESELEYEVTFRSVVLGGGVGSVP  743

Query  273  --SFGSLSWSDGTHLVTSPIAVIW  208
               FGS+ W+DG H+V SP+AV W
Sbjct  744  GHEFGSIEWTDGEHVVKSPVAVQW  767



>dbj|BAJ93872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=780

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 125/211 (59%), Gaps = 12/211 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D++G + + D+ TG  STP   G+GHVDP  AADPGLVYD G  
Sbjct  576  SPAAIKSALMTTAYNMDSAG-AVIEDMSTGKASTPFVRGAGHVDPNRAADPGLVYDAGTE  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNR-NLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DY+ FLC +GY ++++A+F   SP  +C  R      G LNYP+F+ VF    + +T +R
Sbjct  635  DYIAFLCALGYSAEQMAVF---SPATNCSTRAGTAAVGDLNYPAFSAVFGPEKRAVTQRR  691

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF-----AD  277
             V+NVG      Y+  + +P+ V V V P +L FS       Y +TF   P+        
Sbjct  692  VVRNVGGNARATYRAKITSPAGVHVTVKPQKLQFSATQGTQQYAITF--APRMFGNVTEK  749

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             +FGS+ WSDG H VTSPIAV W A  V+D+
Sbjct  750  HTFGSIEWSDGEHSVTSPIAVTWPASQVADM  780



>ref|NP_001145849.1| uncharacterized protein LOC100279360 precursor [Zea mays]
 gb|ACL52723.1| unknown [Zea mays]
Length=786

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 128/203 (63%), Gaps = 7/203 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y +DN+G   + D+ TG  STP   G+GHVDP  A DPGLVYD G +
Sbjct  579  SPAAVKSAMMTTAYNVDNAG-DIIKDMSTGKASTPFVRGAGHVDPDRAVDPGLVYDAGAD  637

Query  618  DYVDFLCTIGYDSQKIALF-LRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            +Y+ FLC IGY +++IA+F  ++ P VDC  R   + G  NYP+F+VV  +    +T +R
Sbjct  638  EYLSFLCAIGYTAEQIAVFRTKDDPAVDCSKRK-ASVGDHNYPAFSVVLNSTRDAVT-RR  695

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP---S  271
             V+NVG      Y  +V +P+ VRV V+P +L FS      +YE+TF S   ++ P   +
Sbjct  696  VVRNVGSSARATYWASVTSPAGVRVTVNPRKLRFSATQKTQAYEITFTSRRMWSVPDKYT  755

Query  270  FGSLSWSDGTHLVTSPIAVIWEA  202
            FGS+ WSDG H VTSPIA+ W A
Sbjct  756  FGSIVWSDGEHKVTSPIAITWPA  778



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 121/204 (59%), Gaps = 9/204 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG S + DL +G  S P  HG+GHVDP  A +PGLVYD    
Sbjct  608  SPAAIKSALMTTAYNVDNSGGS-IKDLGSGKESNPFIHGAGHVDPNRAINPGLVYDLDTG  666

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD--C-----RNRNLGNPGALNYPSFAVVFKNNLQ  460
            DYV FLC++GYD+ +IA+F R  P  +  C     R   L +PG LNYPSFAV       
Sbjct  667  DYVAFLCSVGYDANQIAVFTRE-PAAESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGD  725

Query  459  TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA  280
             +  KR V NVG   +  Y V V  P  V V VSPS +VFS      ++EVTF  V    
Sbjct  726  LVKNKRVVTNVGSEVDAVYTVKVNPPPGVGVGVSPSTIVFSAENKTQAFEVTFSRVKLDG  785

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
              SFGS+ W+DG+H+V SPIAV W
Sbjct  786  SESFGSIEWTDGSHVVRSPIAVTW  809



>ref|XP_004954113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=776

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 122/201 (61%), Gaps = 4/201 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+G   + D+ TG  STP   G+GHVDP  A DPGLVYD G +
Sbjct  571  SPAAIKSALMTTAYNVDNAG-DIIKDMSTGEASTPFVRGAGHVDPNCAVDPGLVYDAGTD  629

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC +GY +++IA+  R+  + DC  R+ G+ G  NYP+F+VVF +    +T +R 
Sbjct  630  DYISFLCALGYTAKQIAVLTRDGSVTDCSKRS-GSVGDHNYPAFSVVFSSGDGKVTQRRV  688

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADPSFG  265
            V+NVG      Y  +V +P+ VRV V P  L FS       Y +TF  Q        +FG
Sbjct  689  VRNVGSNAMATYTASVTSPAGVRVTVEPPTLQFSATQKTQEYAITFAAQQGSVTEKYTFG  748

Query  264  SLSWSDGTHLVTSPIAVIWEA  202
            S+ WSDG H VTSPIA+ W A
Sbjct  749  SIVWSDGKHKVTSPIAITWPA  769



>ref|XP_004954114.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=782

 Score =   177 bits (450),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y LDN+G + + D  TG  STP  +G+GHVDP  A DPGLVYD GV 
Sbjct  576  SPAAIKSAMMTTAYVLDNAG-NVIKDTSTGRASTPFVYGAGHVDPNRAVDPGLVYDAGVR  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC +GY S++I +F R+    D  +   G+ G LNYP+F+ VF +++  +T +R 
Sbjct  635  DYISFLCALGYTSKEIGIFTRDDSRADYCSTRTGSSGDLNYPAFSAVFHSDMDEVTQRRV  694

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFADP-SF  268
            V+NVG+  +  Y   + +P+ VRV V P +L F+       Y +TF  +   +  D  +F
Sbjct  695  VRNVGRNVSATYTARIISPAGVRVTVEPRKLQFTATQQTREYVMTFAPRGDARVTDKYTF  754

Query  267  GSLSWSDGTHLVTSPIAVIWEARSVS  190
            GS+ WSDG H VTSPIA+ W    V+
Sbjct  755  GSIVWSDGEHKVTSPIAITWPVSQVA  780



>ref|XP_002452918.1| hypothetical protein SORBIDRAFT_04g034950 [Sorghum bicolor]
 gb|EES05894.1| hypothetical protein SORBIDRAFT_04g034950 [Sorghum bicolor]
Length=780

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 127/209 (61%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+G   + D+ TG  STP   G+GHVDP  A +PGLVYD G +
Sbjct  576  SPAAIKSALMTTAYNVDNAG-DIIKDMSTGTASTPFVRGAGHVDPNRALNPGLVYDVGTD  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC +GY +++IA+  R+    DC  R+ G+ G LNYP+F+V+F +    +T  R 
Sbjct  635  DYVSFLCALGYTARQIAVLTRDGSTTDCSTRS-GSVGDLNYPAFSVLFGSGGDEVTQHRI  693

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ----SVPQFADPS  271
            V+NVG      Y  +V +P+ VRV V P  L FS       Y +TF     SV +    +
Sbjct  694  VRNVGSNVRATYTASVASPAGVRVTVEPPTLKFSATQQTQEYAITFAREQGSVTE--KYT  751

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            FGS+ WSDG H VTSPI+VIW A   +++
Sbjct  752  FGSIVWSDGEHKVTSPISVIWLASQAAEM  780



>ref|XP_008679257.1| PREDICTED: subtilisin-like protease [Zea mays]
 gb|AFW64267.1| putative subtilase family protein [Zea mays]
Length=780

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 126/209 (60%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT + +D++G   + D+ TG  STP   G+GHVDP  A +PGLVYD G +
Sbjct  576  SPAAIKSALMTTAFNVDSAG-DVIRDMSTGGASTPFVRGAGHVDPNRALNPGLVYDAGTD  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC +GY +++IA+  R+  + DC  R  G+ G LNYP+F+VVF +    +T +R 
Sbjct  635  DYVSFLCALGYTARQIAVLTRDGSVTDCSTRP-GSVGDLNYPAFSVVFGSGDDEVTQRRV  693

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ----SVPQFADPS  271
            V+NVG      Y  +V +P+ VRV V P  L FS       Y VTF     SV +    +
Sbjct  694  VRNVGSNARATYTASVASPAGVRVTVEPPTLEFSAAQQTQEYAVTFAPEQGSVAE--KYT  751

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            FGS+ WSDG H VTSPIA+ W A   + +
Sbjct  752  FGSIVWSDGEHKVTSPIAIAWSASQAAAM  780



>dbj|BAJ97136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 124/209 (59%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+G   + D+ +G  STP A G+GH+DP +A DPGLVYD G  
Sbjct  575  SPAAIKSALMTTAYNVDNTG-GVIGDMSSGDASTPFARGAGHIDPNSAVDPGLVYDAGTE  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY+ FLC +GY ++++A+F  +   + C  R     G  NYP+F+VVF  N L  +T +R
Sbjct  634  DYITFLCALGYTARQVAVFGSS---ISCSTRAGSAVGDHNYPAFSVVFTSNKLAVVTQRR  690

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF-QSVPQFADP--S  271
             V+NVG      Y   V  P  VRV VSP  L FS       Y +TF Q  P  A    +
Sbjct  691  VVRNVGSDAEATYTAKVTAPDGVRVRVSPETLRFSTTQKTQEYVLTFAQGSPGSATAKYT  750

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            FGS+ WSDG H VTSPIAV W A  V+++
Sbjct  751  FGSIEWSDGEHSVTSPIAVTWPASKVAEM  779



>ref|XP_012068868.1| PREDICTED: subtilisin-like protease SBT1.7 [Jatropha curcas]
 gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 134/201 (67%), Gaps = 5/201 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL+TT Y+LDNSG + L DL +G  ST   HG+GHVDP +A DPGLVYD    
Sbjct  565  SPAAIKSALITTAYSLDNSGENIL-DLASGKESTAFVHGAGHVDPNSALDPGLVYDLETR  623

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            D++ FLCTIGYDS++I++F+     ++  ++ L +PG LNYPSF+VVF ++   +TYKR 
Sbjct  624  DFILFLCTIGYDSKRISVFIGEPASLNVCDQKLSSPGNLNYPSFSVVFDSSSDVVTYKRV  683

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS----VPQFADPS  271
            VKNVG   N  Y+  V  P+NV + +S S+L FS     LSYE+TF S    +  F   S
Sbjct  684  VKNVGSSVNAVYEAKVNAPANVDIKLSTSKLEFSAENKSLSYEITFSSASLGLSSFGSQS  743

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WSDGTH V SPIAV W
Sbjct  744  FGSIEWSDGTHRVRSPIAVKW  764



>gb|EAY87749.1| hypothetical protein OsI_09164 [Oryza sativa Indica Group]
Length=525

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 121/199 (61%), Gaps = 2/199 (1%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y +DN G + + D+ TG  + P   GSGHVDP  A DPGLVY+T  +
Sbjct  328  SPAAIKSAMMTTAYNVDNDGNA-IKDMATGQAAGPFELGSGHVDPNRALDPGLVYNTTAD  386

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++GY+S +IALF  +    DC  R   + G LNYP+F+VVF  + + +T +R 
Sbjct  387  DYITFLCSLGYNSSQIALFTNDGSTTDCSTRPRRSVGDLNYPAFSVVFARSGEQVTQRRA  446

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS-VPQFADPSFGS  262
            V NVG   NV Y VT+  P    + V+P+RL F  +   L Y +T  +     ++  +GS
Sbjct  447  VTNVGANTNVVYNVTITAPPGTTLTVTPTRLAFDAQRRTLDYSITVSAGATSSSEHQWGS  506

Query  261  LSWSDGTHLVTSPIAVIWE  205
            + WSDG H+V SP+   W+
Sbjct  507  IVWSDGQHMVRSPVVATWQ  525



>ref|XP_003570499.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=780

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 122/207 (59%), Gaps = 13/207 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG S + D+ TG  STP A G+GHVDP  A DPGLVYD   +
Sbjct  571  SPAMIKSALMTTAYNMDNSG-SIIGDMSTGKASTPFARGAGHVDPNRAVDPGLVYDADTD  629

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP-GALNYPSFAVVFK-NNLQTITYK  445
            DYV FLC +GY  +++A+  R++    C  RN+G   G  NYP+FA  F  N    I  +
Sbjct  630  DYVTFLCALGYTDEQVAIMTRDA--TSCSTRNMGAAVGDHNYPAFAATFTINKFAVIKQR  687

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD----  277
            RTV+NVG      Y   V +P+  RV V P  L FS+  + L YEVTF    +  D    
Sbjct  688  RTVRNVGSNARATYSAKVTSPAGTRVTVKPETLRFSETKEMLEYEVTFAQ--RMFDIVTD  745

Query  276  -PSFGSLSWSD-GTHLVTSPIAVIWEA  202
              +FGS+ WSD G H VTSPIA+ W A
Sbjct  746  KHTFGSIEWSDGGEHKVTSPIAITWPA  772



>ref|XP_004954112.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 126/213 (59%), Gaps = 13/213 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+G   + D+ TG  STP   G+GHVDP  AADPGLVYD G +
Sbjct  573  SPAAIKSALMTTAYNVDNAG-DIIRDMSTGQASTPFVRGAGHVDPNRAADPGLVYDAGAD  631

Query  618  DYVDFLCTIGYDSQKIALF-LRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYK  445
            DY+ FLC IGY  ++IA F  +  P V+C  R     G LNYP+F+VVF N+ +  +T +
Sbjct  632  DYMSFLCAIGYTDEQIAKFTTKGDPAVNCSTRR-ATAGDLNYPAFSVVFVNSTKNEVTQR  690

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV------PQF  283
            R V+NVG      Y+V V  P+ VRV V P  L F+ R     Y VTF  +       ++
Sbjct  691  RVVRNVGSNVRAKYRVAVTRPAGVRVTVKPRILRFNRRQRTQEYAVTFMPLVGANVTEKY  750

Query  282  ADPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             D   GS+ WSDG H VTSP+A+ W    V+ +
Sbjct  751  TD---GSIVWSDGKHRVTSPLAITWPVSQVAAM  780



>ref|XP_010088794.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36977.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 129/213 (61%), Gaps = 12/213 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDNSG+  L DL TG  STP AHGSGHVDP+ A DPGL+YD  V 
Sbjct  575  SPAAIKSALMTTAYNLDNSGQR-LKDLATGKTSTPFAHGSGHVDPSRALDPGLIYDMSVT  633

Query  618  DYVDFLCTIGYDSQKIALFLRN--SPLVDCRN--RNLG---NPGALNYPSFAVVFKNN-L  463
            DYV FLC+IGY S+ I++F     SP + C      LG    PG LN PSF+VVFKN+ +
Sbjct  634  DYVGFLCSIGYSSKLISIFFTQTVSPKI-CEETYAALGARVTPGDLNLPSFSVVFKNDQV  692

Query  462  QTITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF  283
            +T+ Y+RTV NVG   +  Y  T   P+ V++ VSP +LVF       +YE+TF      
Sbjct  693  ETVKYRRTVTNVGTNVDAVYSATGVQPAGVKITVSPKKLVFDANNLTQTYEITFSPTGGH  752

Query  282  AD-PSFGSLSWSDGTHLVTSPIAVIWEARSVSD  187
                 FG + WSDG H V S IA  W  R+ +D
Sbjct  753  GKLARFGWIQWSDGIHSVRSTIAFSW-VRATTD  784



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 128/203 (63%), Gaps = 8/203 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGR--STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G   + +    T   +TP A GSGHVDP NAADPGLVYD  
Sbjct  564  SPAAIKSALMTTAYTLNNKGAPIADIGSTSTSKSATPFAFGSGHVDPENAADPGLVYDIT  623

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TIT  451
              DY+ +LC++ Y+S +IALF         +N  L  PG LNYPSF+V+F  + +  ++T
Sbjct  624  AEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVL-QPGDLNYPSFSVLFSKDARNMSVT  682

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFAD  277
            YKRTVKNVGK+ +  Y V V+ P+ V V V P  L F    +KLSY+V+F ++  P   +
Sbjct  683  YKRTVKNVGKIPST-YAVQVKEPTGVSVTVEPRSLGFKKMGEKLSYKVSFVALGGPALTN  741

Query  276  PSFGSLSWSDGTHLVTSPIAVIW  208
             SFG+L+W  G + V SPIAV W
Sbjct  742  SSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 128/203 (63%), Gaps = 8/203 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGR--STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G   + +    T   +TP A GSGHVDP NAADPGLVYD  
Sbjct  564  SPAAIKSALMTTAYTLNNKGAPIADIGSTSTSKSATPFAFGSGHVDPENAADPGLVYDIT  623

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TIT  451
              DY+ +LC++ Y+S +IALF         +N  L  PG LNYPSF+V+F  + +  ++T
Sbjct  624  AEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVL-QPGDLNYPSFSVLFSKDARNMSVT  682

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFAD  277
            YKRTVKNVGK+ +  Y V V+ P+ V V V P  L F    +KLSY+V+F ++  P   +
Sbjct  683  YKRTVKNVGKIPST-YAVQVKEPTGVSVTVEPRSLRFKKMGEKLSYKVSFVALGGPTLTN  741

Query  276  PSFGSLSWSDGTHLVTSPIAVIW  208
             SFG+L+W  G + V SPIAV W
Sbjct  742  SSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_002452917.1| hypothetical protein SORBIDRAFT_04g034940 [Sorghum bicolor]
 gb|EES05893.1| hypothetical protein SORBIDRAFT_04g034940 [Sorghum bicolor]
Length=736

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (61%), Gaps = 6/203 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D++G   + D+ TG  STP   G+GHVDP  A DPGLVYD G +
Sbjct  528  SPAAIKSALMTTAYNVDSAG-DIIKDMSTGKASTPFVRGAGHVDPNRAVDPGLVYDAGAD  586

Query  618  DYVDFLCTIGYDSQKIALF-LRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
             Y  FLC IGY +++IA+F  ++ P+VDC  R   + G  NYP+F+VV  +    +T +R
Sbjct  587  AYFSFLCAIGYTAEQIAVFRTKDDPVVDCSTRT-ASVGDHNYPAFSVVLNSTRDAVTQRR  645

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS---VPQFADPS  271
             V+NVG      Y+ +  +P+ VRV V+P +L FS       YE+TF +   V      +
Sbjct  646  VVRNVGSSARATYRASFTSPAGVRVTVNPRKLRFSVTQKTQEYEITFAARGVVSVTEKYT  705

Query  270  FGSLSWSDGTHLVTSPIAVIWEA  202
            FGS+ WSDG H V SPIA+ W A
Sbjct  706  FGSIVWSDGKHKVASPIAITWPA  728



>gb|EMS59706.1| Subtilisin-like protease [Triticum urartu]
Length=510

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 123/210 (59%), Gaps = 10/210 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D++G   + D+ TG  STP A G+GHVDP  AADPGLVYD G  
Sbjct  306  SPAAIKSALMTTAYNVDSAG-GVVEDMSTGKASTPFARGAGHVDPNRAADPGLVYDAGTE  364

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNR-NLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DY+ FLC +GY ++++A+F   S   +C  R      G LNYP+F+ +F  + + IT  R
Sbjct  365  DYITFLCALGYTTEQMAVF---SAGTNCSTRVGAAAAGDLNYPAFSALFGPDKRAITQHR  421

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD----P  274
             V+NVG      Y+  + +P+ V V V P +L FS       Y +TF     F +     
Sbjct  422  VVRNVGSNARATYRPKITSPAGVHVTVKPRKLQFSATQGTQEYAITFAQ-RTFGNVTEKH  480

Query  273  SFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            +FGS+ WSDG H VTSPI + W A  V+D+
Sbjct  481  TFGSIEWSDGKHSVTSPITITWPASQVADM  510



>gb|EMT01939.1| Subtilisin-like protease [Aegilops tauschii]
Length=698

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 12/211 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D++G + + D+ TG  STP A G+GH  PT AADPGLVYD G  
Sbjct  494  SPAAIKSALMTTAYNVDSAG-AVVEDMSTGKASTPFARGAGHRAPTRAADPGLVYDAGTE  552

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGA--LNYPSFAVVFKNNLQTITYK  445
            DY+ FLC +GY ++++A+F   S   +C  R LG   A  LNYP+F+ +F  + + IT +
Sbjct  553  DYITFLCALGYTTEQMAVF---SGATNCSTR-LGTAAAGDLNYPAFSALFGPDKRAITQR  608

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD----  277
            R VKNVG      Y+  + +P+ V V V P RL FS       Y +TF     F +    
Sbjct  609  RVVKNVGSNARATYRPKITSPAGVHVTVKPRRLQFSATQGTQEYAITFAQR-TFGNVTEK  667

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             +FGS+ WSDG H VTSPIA+ W    V+++
Sbjct  668  HTFGSIEWSDGKHSVTSPIAITWPTSQVAEM  698



>ref|XP_010088796.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36979.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 126/212 (59%), Gaps = 11/212 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN G+  L DL  G  STP AHGSGHVDP+ A DPGL+YD  V 
Sbjct  576  SPAAIKSALMTTAYDLDNDGQR-LRDL-AGKRSTPFAHGSGHVDPSRALDPGLIYDMNVT  633

Query  618  DYVDFLCTIGYDSQKIALFLR---NSPLVDCRNRNLGN---PGALNYPSFAVVFKNNLQT  457
            DYV FLC+IGYDS  I+ F     +S + +     LG    PG LN PSF+ VF+N ++T
Sbjct  634  DYVGFLCSIGYDSTLISKFFTETISSNICEETYAALGGRVTPGDLNVPSFSAVFENGVET  693

Query  456  ITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFAD  277
            + Y+RTV NVG   +  Y  T   P   ++ +SP+RLVF       +YE+TF S     D
Sbjct  694  VKYRRTVTNVGTNVDAVYSATAVAPEGTKITISPNRLVFDANNPTQTYEITFSSTGGNRD  753

Query  276  --PSFGSLSWSDGTHLVTSPIAVIWEARSVSD  187
               +FG + WSDG H V S IA  W  R+ +D
Sbjct  754  KLATFGWIQWSDGIHSVRSTIACSW-VRTTTD  784



>gb|EMT11314.1| hypothetical protein F775_42966 [Aegilops tauschii]
Length=516

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 125/240 (52%), Gaps = 45/240 (19%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DNSG   + DL TG  STP   G+GHVDP +A +PGLVYD    
Sbjct  270  SPTAVKSALMTTAYNMDNSGE-IIKDLATGTESTPFVRGAGHVDPISALNPGLVYDADTA  328

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC +GY   +IA+F R+  + DC ++     G LNYP+FA VF +   ++TY R 
Sbjct  329  DYIGFLCALGYTPAQIAVFTRDGSVADC-SKKPARSGDLNYPAFAAVFSSYKDSVTYPRA  387

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ--------SVPQF  283
            V+NVG   +  Y+  V +P+ V   V+P++LVF +    L+YE+T            P  
Sbjct  388  VRNVGSDASAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVSGNPAKVESPAG  447

Query  282  ADP-----------------------------------SFGSLSWSDGTHLVTSPIAVIW  208
             D                                    SFGS++WSDG H VTSPIAV W
Sbjct  448  VDAKVTPAKLVFDEEHRSLAYEITLAVSGNPVIVDAKYSFGSVTWSDGKHNVTSPIAVTW  507



>tpg|DAA61658.1| TPA: putative subtilase family protein [Zea mays]
Length=548

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 124/202 (61%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+G S L+D  T   +TP A G+GHVDP +A  PGLVYD  V+
Sbjct  348  SPSAIKSALMTTAYTTDNTG-SPLLDAATNTTATPWAFGAGHVDPVSALSPGLVYDASVD  406

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DYV FLCT+G   ++I       P V C  R L +PG LNYPSF+VVF  +++  T+ Y+
Sbjct  407  DYVAFLCTVGVAPRQIQAITAEGPNVTC-TRKLSSPGDLNYPSFSVVFDRRSSRSTVKYR  465

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DP-  274
            R + NVG   +  Y V V  PS++ V V P+RL F    DKL Y VTF+S       DP 
Sbjct  466  RDLTNVGSAGDT-YTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPA  524

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
            +FG L+WS G H V SPI+  W
Sbjct  525  AFGWLTWSSGEHDVRSPISYTW  546



>dbj|BAJ91400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   169 bits (427),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 123/204 (60%), Gaps = 12/204 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D++G + + D+ TG  STP A G+GHVDP  A DPGLVYD G +
Sbjct  575  SPAAIKSALMTTAYNVDSAG-NVIGDMATGKASTPFARGAGHVDPDRALDPGLVYDAGTD  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGAL-----NYPSFAVVFKNNLQTI  454
            DYV FLC +GY + ++A+F R+    +C       PG+      NYP+F  V  +   TI
Sbjct  634  DYVAFLCALGYTADEVAVFTRDGSSTNCS----AAPGSAYVGDHNYPAFVAVLTSRNGTI  689

Query  453  TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFA  280
            T +R V+NVG      Y+ TV +P+ +R+ V P +L FS       Y+VTF  ++     
Sbjct  690  TQRRVVRNVGSDVVATYRATVTSPAGMRITVKPRKLRFSKTHKTQEYQVTFAIRAAGSIK  749

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
            + +FGS+ WSDG H VTSPIA+ W
Sbjct  750  EYTFGSIVWSDGEHKVTSPIAIAW  773



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 125/202 (62%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+G S L+D  T   +TP A G+GHVDP +A  PGLVYD  V+
Sbjct  566  SPSAIKSALMTTAYTTDNTG-SPLLDAATNTTATPWAFGAGHVDPVSALSPGLVYDASVD  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DYV FLCT+G   ++I +     P V C  R L +PG LNYPSF+VVF  +++  T+ Y+
Sbjct  625  DYVAFLCTVGVAPRQIQVITAEGPNVTC-TRKLSSPGDLNYPSFSVVFDRRSSRSTVKYR  683

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DP-  274
            R + NVG   +  Y V V  PS++ V V P+RL F    DKL Y VTF+S       DP 
Sbjct  684  RDLTNVGSAGDT-YTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPA  742

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
            +FG L+WS G H V SPI+  W
Sbjct  743  AFGWLTWSSGEHDVRSPISYTW  764



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 124/202 (61%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+G S L+D  T   +TP A G+GHVDP +A  PGLVYD  V+
Sbjct  566  SPSAIKSALMTTAYTTDNTG-SPLLDAATNTTATPWAFGAGHVDPVSALSPGLVYDASVD  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DYV FLCT+G   ++I       P V C  R L +PG LNYPSF+VVF  +++  T+ Y+
Sbjct  625  DYVAFLCTVGVAPRQIQAITAEGPNVTC-TRKLSSPGDLNYPSFSVVFDRRSSRSTVKYR  683

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DP-  274
            R + NVG   +  Y V V  PS++ V V P+RL F    DKL Y VTF+S       DP 
Sbjct  684  RDLTNVGSAGDT-YTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPA  742

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
            +FG L+WS G H V SPI+  W
Sbjct  743  AFGWLTWSSGEHDVRSPISYTW  764



>dbj|BAD19523.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|EAZ24825.1| hypothetical protein OsJ_08604 [Oryza sativa Japonica Group]
Length=690

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 119/199 (60%), Gaps = 2/199 (1%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y +DN G + + D+ TG  + P   GSGHVDP  A DPGLV +T  +
Sbjct  493  SPAAIKSAMMTTAYNVDNDGNA-IKDMATGQAARPFELGSGHVDPNRALDPGLVNNTTAD  551

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++GY+S +IALF  +    DC  R   + G LNYP+F+VVF  + + +T +R 
Sbjct  552  DYITFLCSLGYNSSQIALFTNDGSTTDCSTRPRRSVGDLNYPAFSVVFVRSGEQVTQRRA  611

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS-VPQFADPSFGS  262
            V NVG   NV Y VT+  P    + V+P+RL F  +   L Y +T  +     ++  +GS
Sbjct  612  VTNVGANTNVMYNVTITAPPGTTLTVTPTRLAFDAQRRTLDYSITVSAGATSSSEHQWGS  671

Query  261  LSWSDGTHLVTSPIAVIWE  205
            + WSDG H V SP+   W+
Sbjct  672  IVWSDGQHTVRSPVVATWQ  690



>gb|EMS46826.1| Subtilisin-like protease [Triticum urartu]
Length=458

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 122/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D++G   + D+ TG  STP A G+GHVDP  A DPGLVYD G  
Sbjct  254  SPAMIKSALMTTAYNMDSAG-GVIGDMSTGKASTPFARGAGHVDPNRAVDPGLVYDAGTE  312

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK-NNLQTITYKR  442
            DY+ FLC +GY  ++IA+F  ++   +C  R   + G  NYP+F+VVF  N +  +  +R
Sbjct  313  DYITFLCALGYTDKQIAVFGSSA---NCSTRAGSSVGDHNYPAFSVVFATNKMAVVRQRR  369

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF-QSV--PQFADPS  271
             ++NVG      Y+  V  P  V V VSP  L F+       Y VTF Q +      + +
Sbjct  370  VIRNVGGDARATYRAKVTAPDGVLVTVSPRTLRFTATQKTQEYVVTFAQRIFGSVTGNHT  429

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
            FGS+ WSD  H VTSPIA+ W A  V+++
Sbjct  430  FGSIEWSDRKHTVTSPIAITWPASQVAEM  458



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 124/202 (61%), Gaps = 11/202 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DNS +S L D   G  STP AHG+GHV+P  A  PGLVYD    
Sbjct  579  SPSAIKSALMTTAYNHDNS-KSPLRDAADGSFSTPLAHGAGHVNPQKALSPGLVYDASTK  637

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y+S++I L ++  P V+C  +   NPG LNYPSF+VVF +  + + Y R 
Sbjct  638  DYITFLCSLNYNSEQIQLIVKR-PSVNC-TKKFANPGQLNYPSFSVVFSSK-RVVRYTRI  694

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            V NVG+  +V Y V V  PS+V + V PSRLVF    ++  Y VTF S  + AD S    
Sbjct  695  VTNVGEAGSV-YNVVVDVPSSVGITVKPSRLVFEKVGERKRYTVTFVS-KKGADASKVRS  752

Query  270  -FGSLSWSDGTHLVTSPIAVIW  208
             FGS+ WS+  H V SPIA  W
Sbjct  753  GFGSILWSNAQHQVRSPIAFAW  774



>ref|NP_001234288.1| SBT2 protein precursor [Solanum lycopersicum]
 emb|CAA67430.1| SBT2 [Solanum lycopersicum]
 emb|CAA07000.1| subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 121/202 (60%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ +S L D  +  PSTP+ HG+GHV+P  A DPGL+YD G  
Sbjct  577  SPAAIKSALMTTAYVHDNTYKS-LKDASSVTPSTPYDHGAGHVNPRKAVDPGLIYDIGAQ  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DY +FLCT      ++ +F + S    C + +L NPG LNYP+ + VF  K  L  +T  
Sbjct  636  DYFEFLCTQELSPSQLMVFGKFSNRT-CHH-SLANPGDLNYPAISAVFPEKTKLSMLTLH  693

Query  444  RTVKNVGK-VKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            RTV NVG  + N  Y V V       V V P RL F+ +  KLSY+VTF++V +   P F
Sbjct  694  RTVTNVGSPISN--YHVVVSAFKGAVVKVEPERLNFTSKNQKLSYKVTFKTVSRQKAPEF  751

Query  267  GSLSWSDGTHLVTSPIAVIWEA  202
            GSL W DGTH V SPIA+ W A
Sbjct  752  GSLIWKDGTHKVRSPIAITWLA  773



>ref|XP_004308418.2| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=773

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 120/202 (59%), Gaps = 6/202 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYT--GYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G S + D  +    P+ P A GSGH DP +AADPGL+YD  
Sbjct  572  SPAAIKSALMTTAYTLNNKG-SPISDFGSNNSQPANPFAFGSGHADPESAADPGLIYDIT  630

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDC-RNRNLGNPGALNYPSFAVVFKNNLQTI--  454
             NDY+ +LC++ Y S +IALF        C  N  +  PG LNYPS +VVF+ + + +  
Sbjct  631  TNDYLLYLCSLNYTSPQIALFSSGISNFTCPSNSTVLQPGNLNYPSLSVVFRRDGRKMSA  690

Query  453  TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP  274
            TY RTV NVG +    Y V V  P  V V V P +LVF    +KLSY+V+F  +    + 
Sbjct  691  TYTRTVTNVGAINPSTYAVQVEAPIGVSVTVEPRKLVFKKMGEKLSYKVSFVGMSATTNS  750

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
            SFGSL W    + V SPIAVIW
Sbjct  751  SFGSLVWVSEKYRVRSPIAVIW  772



>gb|KJB49367.1| hypothetical protein B456_008G115500 [Gossypium raimondii]
Length=769

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 123/204 (60%), Gaps = 10/204 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN G+  + DL +   +TP   GSGHVDP  A+DPGL+YD   +
Sbjct  570  SPAAIKSALMTTAYTIDNKGKP-ISDLKSHALATPFGIGSGHVDPIKASDPGLIYDITAD  628

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNNLQ--TITY  448
            DY+ +LC++ Y+  +IALF      ++C+   L   PG LNYPSFAV F    +  TITY
Sbjct  629  DYISYLCSLKYNESQIALFEEG--FIECKKEQLAMQPGDLNYPSFAVNFNRKARNVTITY  686

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FAD  277
            KRTV NVG  K+  Y+V+V  P    V V P  L F     KLSY+V+F  + +     +
Sbjct  687  KRTVTNVGIPKST-YKVSVEAPKGAYVIVRPKVLSFKKLNQKLSYKVSFIGLSRKKPVVN  745

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
             +FGSL W  G + V SPIAV W+
Sbjct  746  SAFGSLMWVSGNYRVKSPIAVTWK  769



>gb|ABK96588.1| unknown [Populus trichocarpa x Populus deltoides]
Length=218

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 116/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+  S L D   G  S P AHGSGHVDP  A  PGLVYD   +
Sbjct  21   SPSAIKSALMTTAYVSDNTN-SPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISAD  79

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +YV FLC++ Y  + +   ++  P + C +R   NPG LNYPSF+VVF NN + + Y R 
Sbjct  80   EYVAFLCSLDYTIEHVQAIVKR-PNITC-SRKFNNPGNLNYPSFSVVFTNN-RVVRYTRE  136

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG   ++ Y+V V  P  V+V V PS+LVF +  DKL Y VTF   +         F
Sbjct  137  LTNVGAAGSI-YEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEF  195

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G++ W +  H V SP+A  W
Sbjct  196  GAIVWRNAQHQVRSPVAFSW  215



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 124/202 (61%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+  S L+D  T   +TP A G+GHVDP +A  PGLVYD  V+
Sbjct  544  SPSAIKSALMTTAYTVDNT-ESPLLDAATNATATPWAFGAGHVDPVSALSPGLVYDNSVD  602

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DYV FLCT+G   ++I       P V C  R L +PG LNYPSF+VVF  +++  T+ Y+
Sbjct  603  DYVAFLCTVGVAPRQIQAITAAGPNVTC-TRKLSSPGDLNYPSFSVVFGQRSSRSTVKYR  661

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DP-  274
            R + NVG   +  Y V V  PS++ V+V P+RL F    DKL Y VTF+S       DP 
Sbjct  662  RELTNVGNAGDT-YTVKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANARGRMDPA  720

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
            +FG L+WS   H V SPI+  W
Sbjct  721  AFGWLTWSSDEHDVRSPISYTW  742



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 124/202 (61%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+  S L+D  T   +TP A G+GHVDP +A  PGLVYD  V+
Sbjct  574  SPSAIKSALMTTAYTVDNT-ESPLLDAATNATATPWAFGAGHVDPVSALSPGLVYDASVD  632

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DYV FLC +G   ++I       P V C  R L +PG LNYPSF+VVF  +++  T+ Y+
Sbjct  633  DYVAFLCAVGVAPRQIQAITAAGPNVTC-TRKLSSPGDLNYPSFSVVFGRRSSRSTVKYR  691

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DP-  274
            R + NVG   +  Y V V  PS++ V+V P+RL F    DKL Y VTF+S       DP 
Sbjct  692  RELTNVGNAGDT-YTVKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANARGPMDPA  750

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
            +FG L+WS   H+V SPI+  W
Sbjct  751  AFGWLTWSSDEHVVRSPISYTW  772



>gb|EMT11726.1| Subtilisin-like protease [Aegilops tauschii]
Length=781

 Score =   164 bits (414),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 123/212 (58%), Gaps = 13/212 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT   +DN+G   + D+ TG  STP A G+GH+DP +A DPGLVYD G  
Sbjct  576  SPAAIKSALMTTAQNVDNAG-GVIGDMSTGEASTPFARGAGHIDPNSAVDPGLVYDAGTE  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TITYK  445
            DY+ FLC +GY ++++A+F  ++    C      + G  NYP+F+VVF +N +   +T +
Sbjct  635  DYITFLCALGYTAKQVAVFGSST---SCSTHAGSSVGDHNYPAFSVVFTSNKKKAVVTQR  691

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ-----SVPQFA  280
            R V+NVG      Y+V +  P  V V VSP  L FS       Y VTF      SV +  
Sbjct  692  RVVRNVGSDATTTYRVKITAPDGVLVTVSPETLRFSATQKTQGYVVTFAREIGGSVTE--  749

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
              +FGS+ WSDG H VTSPIAV W    V ++
Sbjct  750  KYTFGSIEWSDGEHTVTSPIAVTWPTNQVEEM  781



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YTLDN+  S L D      STP A+GSGHV+P  A  PGLVYD  + 
Sbjct  557  SPSAIKSALMTTAYTLDNT-ESPLRDAMGEALSTPWAYGSGHVNPQKALSPGLVYDADIE  615

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    + L ++  P V+C    L  PG LNYPSF+VVF NN   + YKRT
Sbjct  616  DYIAFLCSLNYSLDHVKLIVKR-PNVNCSTY-LSGPGDLNYPSFSVVFGNNSGVVQYKRT  673

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG+ ++V Y V V  PS V + V+P++LVF    ++ +Y V F S     D S    
Sbjct  674  LTNVGEAESV-YDVAVSGPSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSE  732

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WS+  H V SPIA  W
Sbjct  733  FGSITWSNKQHQVRSPIAFTW  753



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YTLDN+  S L D      STP A+GSGHV+P  A  PGLVYD  + 
Sbjct  557  SPSAIKSALMTTAYTLDNT-ESPLRDAMGEALSTPWAYGSGHVNPQKALSPGLVYDADIE  615

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    + L ++  P V+C    L  PG LNYPSF+VVF NN   + YKRT
Sbjct  616  DYIAFLCSLNYSLDHVKLIVKR-PNVNCSTY-LSGPGDLNYPSFSVVFGNNSGVVQYKRT  673

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG+ ++V Y V V  PS V + V+P++LVF    ++ +Y V F S     D S    
Sbjct  674  LTNVGEAESV-YDVAVSGPSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSE  732

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WS+  H V SPIA  W
Sbjct  733  FGSITWSNKQHQVRSPIAFTW  753



>ref|XP_006362686.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 121/200 (61%), Gaps = 6/200 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ +S L D  +  PSTP+ HG+GH++P  A DPGL+YD G  
Sbjct  577  SPAAIKSALMTTAYVHDNTYKS-LKDASSVTPSTPYDHGAGHINPRKAVDPGLIYDIGAQ  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY +FLCT      ++ +F + S    C + +L NPG LNYP+ + VF   +  +T  RT
Sbjct  636  DYFEFLCTQELSPSQLMVFGKFSNRT-CHH-SLANPGDLNYPAISAVFPEKVSVLTLHRT  693

Query  438  VKNVGK-VKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGS  262
            V NVG  + N  Y V V +     V V P+RL F+ +  KLSY+VTF+++ +   P FGS
Sbjct  694  VTNVGSPISN--YHVVVSSFKGAVVKVEPARLNFTSKNQKLSYQVTFKTISRQKAPEFGS  751

Query  261  LSWSDGTHLVTSPIAVIWEA  202
            L W D TH V SPIA+ W A
Sbjct  752  LIWKDETHKVRSPIAITWLA  771



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score =   165 bits (417),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 116/191 (61%), Gaps = 8/191 (4%)
 Frame = -1

Query  798   APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
             +P   KSAL+TT Y  +NSG   + DL TG  S    HG+GHVDP  A +PGLVYD  V 
Sbjct  1170  SPAAIKSALVTTAYVTENSGEP-IEDLATGKTSNSFIHGAGHVDPNKALNPGLVYDIDVK  1228

Query  618   DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
             DYV FLC +GY+   I +FL++  L + C    L   G LNYPSF+VVF + +  + Y+R
Sbjct  1229  DYVAFLCAVGYEFPGILVFLQDPALYNACETSKLRTAGDLNYPSFSVVFGSTVDVLKYRR  1288

Query  441   TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV------PQFA  280
              VKNVG   +  Y++ V++P+NV + VSPS+L FS    +L +EVTF+SV          
Sbjct  1289  VVKNVGSNVDAVYEIGVKSPANVEIEVSPSKLAFSKEKSELEFEVTFKSVVLGGGDGSMP  1348

Query  279   DPSFGSLSWSD  247
                FGS+ W+D
Sbjct  1349  GHEFGSIEWTD  1359



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   162 bits (411),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ +S L D   G  S P  HGSGHVDP+ A  PGLVYDT   
Sbjct  563  SPSAVKSALMTTAYTHDNT-KSPLRDAADGTLSNPWGHGSGHVDPSKALSPGLVYDTTAE  621

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY+ FLC++ Y ++ +   ++  P V C  R   +PG LNYPSF++ F   N + + Y R
Sbjct  622  DYIAFLCSLEYTNEHVQAIVKR-PNVTCE-RKYSDPGQLNYPSFSIAFGSKNKRVVRYTR  679

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVP---QFADPS  271
             + NVG   +V Y+ +V +PS VR  V P+RLVF++  +K  Y VTF ++P   + A   
Sbjct  680  ELTNVGAAGSV-YRASVTSPSTVRTVVKPTRLVFNNVGEKQKYTVTFMALPGAEKTARSE  738

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ W++  HLV SP+A  W
Sbjct  739  FGSIVWANPQHLVKSPVAFAW  759



>gb|EMT11725.1| Subtilisin-like protease [Aegilops tauschii]
Length=525

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 123/211 (58%), Gaps = 13/211 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D+SG   + D+ T   STP A G+GH+ P +A DPGLVYD    
Sbjct  322  SPAAIKSALMTTAYNVDSSG-GVIGDMSTSDASTPFARGAGHIHPNSAVDPGLVYDASTE  380

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY++FLC +GY ++++A+F  +   + C  R  G+ G  +YP+F+VVF  N +  +T +R
Sbjct  381  DYINFLCALGYTAKQVAVFGSS---ISCSKR-AGSVGDHSYPAFSVVFTSNKVAAVTQRR  436

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ-----SVPQFAD  277
             V+NVG     AY   V  P  VRV VSP  L  S       Y VTF      SV +   
Sbjct  437  VVRNVGSDTAAAYTAKVTAPDGVRVTVSPETLRVSSTEKTQEYVVTFAQRTTGSVTE--K  494

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             +FGS+ WSDG H VTSPIA+ W    V+++
Sbjct  495  YTFGSIEWSDGEHSVTSPIAITWPTSKVAEM  525



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 121/201 (60%), Gaps = 9/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN G S ++D+     +TP A GSGHVDP  A+DPGL+YD    
Sbjct  572  SPAAIKSALMTTAYVTDNKG-SPILDVAFSSSATPFALGSGHVDPERASDPGLIYDISPK  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN-LQTITYKR  442
            DY+ +LC++ Y++ +I+LF+ N     C    +  PG LNYPSFAV FK++  + +TYKR
Sbjct  631  DYIYYLCSLKYNASQISLFVDN---FTCPKHAIMQPGDLNYPSFAVNFKSSAAENVTYKR  687

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FADPS  271
            TV NVG  K+  Y+V V  P  V V V P  L F     KLSY+VTF  + +    A  S
Sbjct  688  TVTNVGTPKST-YKVLVEEPKGVSVIVKPEILTFKMLGKKLSYKVTFIGLKRTKPVAASS  746

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGSL W  G + V SPIA  W
Sbjct  747  FGSLVWVSGKYRVRSPIAASW  767



>ref|XP_010232411.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=815

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 119/201 (59%), Gaps = 5/201 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D SG   + D  T   + P   G+GHVDP +A DPGLV+D G +
Sbjct  602  SPAAIKSALMTTAYNMDRSG-GAIKDTNTSMEAGPFDLGAGHVDPNSALDPGLVFDAGED  660

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVD-CRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
            DY+ FLC +GY  ++IA+F + SP+VD C      + G LNYP+F+V FK+    +T +R
Sbjct  661  DYISFLCALGYTPRQIAIFTKASPVVDVCSKHKGASVGDLNYPAFSVAFKSYTDKVTQRR  720

Query  441  TVKNVGKVKNVAYQVTVRTP-SNVRVNVSPSRLVFSDRIDKLSYEVTFQSV-PQF-ADPS  271
             V+NVG   N  Y ++ R P  NV V V+P RLVF  +     Y VTF ++ P   +   
Sbjct  721  VVRNVGSNVNAVYTISRRGPVGNVGVTVTPDRLVFDAQHQTREYTVTFSTLNPSVKSTEE  780

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
             G+L WSDG H V SP+   W
Sbjct  781  HGALVWSDGKHEVASPMVFTW  801



>ref|XP_006339499.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 126/204 (62%), Gaps = 10/204 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLY--TGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTLD   R+ + D    T   +TP   GSGHVDP  A+DPGL+YD  
Sbjct  566  SPAAIKSALMTTAYTLDKE-RTPIADAVSETSISATPFVFGSGHVDPERASDPGLIYDIS  624

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI--T  451
              DY+ ++C++ Y+S +IAL LR +    C + +  + G LNYPSFAV+F +N Q +  T
Sbjct  625  TEDYLHYICSLNYNSSQIALLLREN--YTCPSHSFQSLGDLNYPSFAVLFDSNNQHLIQT  682

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--D  277
            +KRTV NVG  ++  Y V V+TP  V V V P  L F  +  KL Y+V F +  + +  D
Sbjct  683  FKRTVTNVGTPRST-YSVQVKTPYGVSVTVKPKILKFQKKGQKLRYKVRFVTRGKRSPGD  741

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
             +FGSL+W   TH+V SPIAV W+
Sbjct  742  STFGSLTWISRTHIVRSPIAVTWQ  765



>gb|KHG02130.1| Subtilisin-like protease [Gossypium arboreum]
 gb|KHG03377.1| Subtilisin-like protease [Gossypium arboreum]
Length=775

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 120/203 (59%), Gaps = 9/203 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YTLDN G+  + DL     + P A GSGHVDP  A DPGL+Y+    
Sbjct  577  SPAAIKSALMTTAYTLDNKGKP-IADLAFYTSAAPFAIGSGHVDPIKATDPGLIYNITAE  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TITYK  445
            DY+ +LC++ Y   ++++F           R    PG LNYPSFAV FK   +  T TYK
Sbjct  636  DYISYLCSLHYSDSQVSMFEEGYQCTPTERRM--QPGDLNYPSFAVNFKQKARNVTFTYK  693

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FADP  274
            RTV NVG  K+  Y+V+V  P  V V VSP  L F++  ++LSYEV+F  + +    A  
Sbjct  694  RTVTNVGIPKST-YKVSVEVPKGVSVIVSPKVLSFTELNEELSYEVSFTGLSRNKTVAGS  752

Query  273  SFGSLSWSDGTHLVTSPIAVIWE  205
            SFGSL W  G + V SPIAV W+
Sbjct  753  SFGSLVWVSGNYRVRSPIAVSWK  775



>emb|CDP15538.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 121/214 (57%), Gaps = 21/214 (10%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTG--  625
            +P   KSA+MTT   +DN+GR+ ++D  T   STP AHGSGHVDP  A +PGLVYD G  
Sbjct  546  SPAAIKSAIMTTANNVDNNGRN-IVDRATDVASTPFAHGSGHVDPNKALNPGLVYDMGTR  604

Query  624  ----------VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF  475
                      + DYV FLC+IGY   +IA+F+ N P   CR      PG LNYPSF+VVF
Sbjct  605  AAIKRYQLKLLGDYVQFLCSIGYTPARIAVFVSNPP-ESCRPGI--TPGDLNYPSFSVVF  661

Query  474  KNNLQTITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS  295
                  +T+ R V+NV       Y V    P  V V V+P +L F    D L+Y+VTF S
Sbjct  662  SRQRTVVTHTRRVRNVESTAAAVYTVRWNAPKFVEVKVTPYKLAFDQYSDTLTYQVTFTS  721

Query  294  --VPQFAD--PSFGSLSWSDG-THLVTSPIAVIW  208
              +    D   +FG L W DG  H+V SPIAV+W
Sbjct  722  AAIETIGDTTSAFGYLEWIDGQQHIVRSPIAVLW  755



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 126/204 (62%), Gaps = 10/204 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLY--TGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTLD   R+ + D    T   +TP   GSGHVDP  A+DPGL+YD  
Sbjct  565  SPAAIKSALMTTAYTLDKK-RTPIADAVSETSLSATPFVFGSGHVDPERASDPGLIYDIS  623

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI--T  451
              DY+ ++C++ Y+S +IAL LR +    C + +  + G LNYPSF+V+F +N Q +  T
Sbjct  624  TEDYLHYICSLNYNSSQIALLLREN--YTCPSHSFQSLGNLNYPSFSVLFDSNNQHLIQT  681

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF--AD  277
            +KRTV NVG  ++  Y V V+TP  V V V P  L F  +  KL Y+V F +  +   AD
Sbjct  682  FKRTVTNVGTPRST-YIVQVKTPYGVSVTVKPKILKFHKKGQKLRYKVRFVTKGKRSPAD  740

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
             +FGSL+W   TH+V SPIAV W+
Sbjct  741  STFGSLTWISRTHIVRSPIAVTWQ  764



>ref|XP_010931682.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=794

 Score =   160 bits (405),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 125/209 (60%), Gaps = 15/209 (7%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SA+MTT YT DN G+  ++D  TG  ST  A+ SGHVDP  A DPGLVYD  V+
Sbjct  591  SPAAIRSAMMTTAYTTDNMGQD-MVDERTGNRSTEWAYSSGHVDPEKAVDPGLVYDLTVD  649

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN----LQTIT  451
            DY+DFLC+  Y S  I +  R    V+C N+ +G P  LNYPS AVV + +    L+ + 
Sbjct  650  DYLDFLCSSNYSSATIGMIARRP--VNCSNK-IGRPWDLNYPSIAVVLEGSNTRKLEAVV  706

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP-  274
             +RTV+NVG+ K   Y V ++ P  VR+ V P +LVF  +  K  + V   + P+   P 
Sbjct  707  -RRTVRNVGEEK-AEYSVGIKEPEGVRLVVEPRKLVFRGKGQKQEFAVKVFTEPKKLLPW  764

Query  273  ----SFGSLSWSDGTHLVTSPIAVIWEAR  199
                 FGS++WSDG H V SPIAV W+ +
Sbjct  765  NSWTEFGSVTWSDGKHTVRSPIAVTWQQK  793



>ref|XP_006661279.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=635

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 124/198 (63%), Gaps = 9/198 (5%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTG-YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVD  607
            KSALMTT YT+DN+G S ++D   G   +TP + G+GHVDP  A  PGLVYD  V+DYV 
Sbjct  439  KSALMTTAYTVDNTG-SPILDAAGGNSTATPWSIGAGHVDPVKALSPGLVYDASVDDYVA  497

Query  606  FLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYKRTVK  433
            FLC++G   Q++   +  +P V C+ R L +PG LNYPSF+VVF  +++  ++ Y+R + 
Sbjct  498  FLCSVGTSPQQVQA-ITAAPNVTCQ-RKLSSPGDLNYPSFSVVFGRRSSRSSVKYRRELT  555

Query  432  NVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DPSFGSL  259
            NVG      Y V V  PS++ V V P+RL F    DKL Y VTF+S       D +FG L
Sbjct  556  NVGGDGGSVYTVRVTGPSDIAVAVKPARLAFKAAGDKLRYTVTFKSATPRGPMDSAFGWL  615

Query  258  SWSD-GTHLVTSPIAVIW  208
            +WSD G H V SPI+  W
Sbjct  616  TWSDGGEHDVRSPISYTW  633



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 125/204 (61%), Gaps = 11/204 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+G S ++D  +   +TP + G+GHVDP  A  PGLVYDT V+
Sbjct  569  SPSAIKSALMTTAYTVDNTG-SPIVDAASNTTATPWSIGAGHVDPVKALSPGLVYDTSVD  627

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-----TI  454
            DYV FLC++G    ++   +  +P V C+ R L +PG LNYPSF+VVF          T+
Sbjct  628  DYVAFLCSVGTSPPQVQA-ITAAPNVTCQ-RKLSSPGDLNYPSFSVVFGRRSSSSRSTTV  685

Query  453  TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--  280
             Y+R + NVG  ++V Y   V  PS++ V V P+RL F    DKL Y VTF+S       
Sbjct  686  KYRRELTNVGDGRSV-YTARVTGPSDIAVAVKPARLAFKKAGDKLRYTVTFKSTTPGGPT  744

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
            D +FG L+WS+G H V SPI+  W
Sbjct  745  DAAFGWLTWSNGEHDVRSPISYTW  768



>ref|XP_006849717.1| PREDICTED: subtilisin-like protease [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 120/198 (61%), Gaps = 4/198 (2%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT D +G S L D  TG  STP AHGSGHVDP NA DPGL+YD   +
Sbjct  582  SPAAIKSALMTTAYTRDTTG-SPLRDAATGGLSTPLAHGSGHVDPQNALDPGLIYDLSTS  640

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+DFLC++ Y   ++ +  ++S     R++ L + G LNYPSF+V+F+   + + Y R 
Sbjct  641  DYLDFLCSLNYSDTQVRIVSKHSNFSCPRDKVL-DTGNLNYPSFSVIFRGYEKVVRYSRV  699

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP-SFGS  262
            + NVG+  +V Y V+V  P  V + V P RLVF    +K  Y V F S  + + P  FG 
Sbjct  700  LTNVGEPSSV-YTVSVSAPEGVGITVKPQRLVFKGVGNKQGYTVEFASKIKTSGPMDFGW  758

Query  261  LSWSDGTHLVTSPIAVIW  208
            + WS+  H V SPIA  W
Sbjct  759  ILWSNQKHKVRSPIAFSW  776



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 119/202 (59%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+  ++L D  T  PSTP+ HG+GH++P  A DPGLVYD G  
Sbjct  573  SPAAIKSALMTTAYVHDNT-YNSLKDSSTATPSTPYDHGAGHINPRKAVDPGLVYDIGAQ  631

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            DY +FLCT      ++ +F R S    C + +L NPG LNYP+ + VF  +  + T+T  
Sbjct  632  DYFEFLCTQQLSPSQLMVFARFSNRT-C-HHSLANPGDLNYPAISAVFPEDAKVSTLTLH  689

Query  444  RTVKNVGK-VKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            RT  NVG  + N  Y V V +     V V PSRL F+ +  KLSY+V F++  +   P F
Sbjct  690  RTATNVGSPISN--YHVRVSSFKGAVVKVEPSRLNFTSKHQKLSYKVIFETKSRQKAPEF  747

Query  267  GSLSWSDGTHLVTSPIAVIWEA  202
            GSL W DG H V SPI + W A
Sbjct  748  GSLIWKDGAHKVRSPIVITWLA  769



>ref|XP_006490976.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO85943.1| hypothetical protein CISIN_1g004242mg [Citrus sinensis]
Length=766

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 11/199 (6%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTP----HAHGSGHVDPTNAADPGLVYDTGVND  616
            KSALMTT YTL+N  R++ I    G   TP     A GSGHVDP +A+DPGL+YD    D
Sbjct  573  KSALMTTAYTLNN--RNSPIADVGGSSDTPLATAFAFGSGHVDPESASDPGLIYDIATED  630

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TITYKR  442
            Y+D+LC++ Y S ++ALF   +    C N +  +PG LNYPSFAV FK N++  ++ Y+R
Sbjct  631  YLDYLCSLNYTSLQLALFAGGN--FTCPNPSAFHPGKLNYPSFAVNFKGNVKNMSLEYER  688

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGS  262
            +V NVG      Y V V  P+ V V ++P  L F    + LSY+VTF S+   ++ SFGS
Sbjct  689  SVTNVG-TSYCTYAVKVEEPNGVLVTITPPILSFQKIGEILSYKVTFVSLRGASNESFGS  747

Query  261  LSWSDGTHLVTSPIAVIWE  205
            L+W  G + V SPIAV W+
Sbjct  748  LTWVSGKYAVKSPIAVTWQ  766



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 121/204 (59%), Gaps = 12/204 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYT----GYPSTPHAHGSGHVDPTNAADPGLVYD  631
            +P   KSALMTT Y +DN+  + L D  +    G  S P AHGSGHVDP  A  PGLVYD
Sbjct  566  SPSAIKSALMTTAYVVDNT-HAPLRDAGSTTIPGTLSNPWAHGSGHVDPHKAMSPGLVYD  624

Query  630  TGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT  451
                DYV FLC++GY    + L ++  P V C  R   +PG LNYPSF+VVF N  + + 
Sbjct  625  VSTEDYVAFLCSLGYTIDHVQLIVKR-PNVTCA-RKFSDPGELNYPSFSVVFGNK-RVVR  681

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFA  280
            Y R + NVG+  ++ Y+V V  PS V V+V P++LVF +  DKL Y VTF   + + + A
Sbjct  682  YTRELTNVGEAGSI-YEVEVTAPSTVGVSVKPTKLVFRNVGDKLRYTVTFVAKKGIRKAA  740

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
               FGS+ W +  H V SP+A  W
Sbjct  741  RNGFGSIVWRNAEHQVRSPVAFAW  764



>gb|KJB49366.1| hypothetical protein B456_008G115400 [Gossypium raimondii]
Length=775

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 121/203 (60%), Gaps = 9/203 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YTLDN G+  + DL     ++P A GSGHVDP  A DPGL+Y+    
Sbjct  577  SPAAIKSALMTTAYTLDNKGKP-IADLAFYNSASPFAIGSGHVDPMKATDPGLIYNITAE  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI--TYK  445
            DY+ +LC++ Y   ++++F           R    PG LNYPSFAV FK   + +  TYK
Sbjct  636  DYISYLCSLHYTDSQVSMFEEGYQCTPTELRM--QPGDLNYPSFAVNFKQKARNVMFTYK  693

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FADP  274
            RTV NVG  K+  Y+V+V  P  V V VSP  L F++  ++LSYEV+F  + +    A  
Sbjct  694  RTVTNVGIPKST-YKVSVEVPKGVSVIVSPKVLSFTELNEELSYEVSFTGLSRNKTVAGS  752

Query  273  SFGSLSWSDGTHLVTSPIAVIWE  205
            SFGSL W  G + V SPIAV W+
Sbjct  753  SFGSLVWVSGNYRVRSPIAVSWK  775



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+  S L D   G  S P AHGSGHVDP+ A  PGLVYDT   
Sbjct  563  SPSAVKSALMTTAYTHDNT-NSPLRDAADGTLSNPWAHGSGHVDPSKALSPGLVYDTTAE  621

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY+ FLC++ Y ++ +   ++  P V C  R   +PG LNYPSF++VF   N + + Y R
Sbjct  622  DYIAFLCSLEYTNEHVQAIVKR-PNVTCA-RKYSDPGQLNYPSFSIVFGSKNKRVVRYTR  679

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVP---QFADPS  271
             + NVG   +V Y+ +V +PS VR  V P+RLVF++  +K  Y VTF ++P   + A   
Sbjct  680  ELTNVGAAGSV-YRASVTSPSTVRTIVKPTRLVFNNVGEKQKYTVTFVALPGAXKTARSE  738

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ W++  H V SP+   W
Sbjct  739  FGSIVWANPQHQVKSPVTFAW  759



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 122/201 (61%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ ++ L D   G  S P AHGSGHVDP+ A  PGLVYD    
Sbjct  563  SPSAVKSALMTTAYTHDNT-KAPLRDAADGTISNPWAHGSGHVDPSKALSPGLVYDIATE  621

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKR  442
            DY+ FLC++ Y ++ +   ++  P V C  R   +PG LNYPSF+V+F N  +  ++Y R
Sbjct  622  DYIAFLCSLEYTNEHVQAIVKR-PNVTCA-RKYSDPGQLNYPSFSVMFWNKKKRVVSYTR  679

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPS  271
             + NVG   +V Y+V V +PS VR  V P+RLVF++  +K  Y VTF   Q   + +   
Sbjct  680  ELTNVGPAGSV-YRVAVTSPSMVRTIVKPTRLVFNNVGEKQKYTVTFVASQGAEKTSRSE  738

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WS+  H V SP+A  W
Sbjct  739  FGSIMWSNPQHQVKSPVAFAW  759



>gb|EYU25845.1| hypothetical protein MIMGU_mgv1a013289mg [Erythranthe guttata]
Length=225

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 113/206 (55%), Gaps = 8/206 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+  S L D      STP AHG+GHVDP  A  PGLVYD   +
Sbjct  21   SPSAIKSALMTTAYTVDNAN-SPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPD  79

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF---KNNLQTITY  448
            DYV FLC++ Y    + L  R        +R   +PG LNYPSF+VVF   K N + + Y
Sbjct  80   DYVSFLCSLDYTDDAVQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRY  139

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS---VPQFAD  277
             R + NVG   + AY   +  P  V   V PS+LVF +  DKL Y VTF S   V     
Sbjct  140  TRELTNVGPAGS-AYVAEIEAPPTVVATVKPSKLVFGNVGDKLRYTVTFVSKKDVDYSLT  198

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEAR  199
              FGS++W +  H V SP++  W  R
Sbjct  199  SGFGSITWKNAQHQVRSPVSFSWTLR  224



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 117/204 (57%), Gaps = 8/204 (4%)
 Frame = -1

Query  810  IQVGAPLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYD  631
            IQ G P P    LMTT Y  DN+ +S L D   G  STP AHG+GHV+P  A  PGLVYD
Sbjct  559  IQNGVPAPLNLHLMTTAYVHDNT-KSPLRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYD  617

Query  630  TGVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT  451
              + DY+ FLC++ Y  + I L ++    V+C  R   +PG LNYPSF++ F    + + 
Sbjct  618  ASITDYIKFLCSLDYTPEHIQLIVKRHA-VNC-TRKFSDPGQLNYPSFSIHFGGK-RVVR  674

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP-  274
            Y RT+ NVG+  +V Y VTV  PS V V V P+RLVF    ++  Y VTF S     D  
Sbjct  675  YTRTLTNVGEAGSV-YDVTVDAPSTVEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSG  733

Query  273  --SFGSLSWSDGTHLVTSPIAVIW  208
               FGS+ WS+  H V SP+A  W
Sbjct  734  RYGFGSIMWSNAQHQVRSPVAFSW  757



>gb|EMS60034.1| Subtilisin-like protease [Triticum urartu]
Length=478

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 119/202 (59%), Gaps = 9/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTTTYT+DN+  S+L D     P+TP   G+GHVDP  A  PGLVYD   +
Sbjct  281  SPAAIKSALMTTTYTMDNT-NSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTS  339

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DYV FLC++ Y +  I +  + +  V C  R+   PG LNYPSF+VVF K     + Y+R
Sbjct  340  DYVAFLCSLDYSAAHIRVITKMA-NVSCPPRS--RPGDLNYPSFSVVFRKKPRHVVRYRR  396

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFADPS  271
             + NVG    V Y V V  P++  V V+P+RLVF     K  Y VTF+S    P  A P 
Sbjct  397  ELTNVGPAMAV-YDVKVSGPASAGVTVTPARLVFKKVGQKQRYYVTFESKAAGPGRAKPD  455

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            FG +SW+   H+V SP+A  W+
Sbjct  456  FGWISWASDEHVVRSPVAYTWK  477



>ref|XP_004956934.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 119/197 (60%), Gaps = 8/197 (4%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT YT+DN+  S L+D  T   +TP A G+GHVDP  A  PGLVYD  V+DYV F
Sbjct  578  KSALMTTAYTVDNT-DSPLLDAATNATATPWAFGAGHVDPVRALSPGLVYDATVDDYVAF  636

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYKRTVKN  430
            LCT+G   +++       P V C  R L +PG LNYPSF+VVF  +++  T+ Y+R + N
Sbjct  637  LCTVGVSPRQVQAVAAAGPNVTC-TRKLSSPGDLNYPSFSVVFGRRSSRSTVKYRRELTN  695

Query  429  VGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DP-SFGSL  259
            VG      Y V V  PS+V V+V P+ L F    DKL Y VTF+S       DP +FG L
Sbjct  696  VGDT-GATYTVKVTGPSDVGVSVKPAMLQFRRPGDKLRYTVTFRSKSAKGPMDPAAFGWL  754

Query  258  SWSDGTHLVTSPIAVIW  208
            +WS   H V SPI+  W
Sbjct  755  TWSSDEHEVRSPISYTW  771



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 121/201 (60%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ ++ L D   G  S P AHGSGH+DP+ A  PGLVYD    
Sbjct  563  SPSAVKSALMTTAYTHDNT-KAPLRDAADGTISNPWAHGSGHIDPSKALSPGLVYDIATE  621

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKR  442
            DY+ FLC++ Y  + +   ++  P V C  R   +PG LNYPSF+VVF N  +  ++Y R
Sbjct  622  DYIAFLCSLEYTKEHVQAIVKR-PNVTCA-RKYSDPGQLNYPSFSVVFWNKKKRVVSYTR  679

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPS  271
             + NVG   +V Y+V V +PS VR  V P+RLVF++  +K  Y VTF   +   + +   
Sbjct  680  ELTNVGPAGSV-YRVAVTSPSMVRTIVKPTRLVFNNVGEKQKYRVTFVASRGAEKTSRSE  738

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WS+  H V SP+A  W
Sbjct  739  FGSIMWSNPQHQVKSPVAFAW  759



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 119/200 (60%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ +S L D   G  S P AHGSGHV+P  A  PGLVYD   +
Sbjct  564  SPSAIKSALMTTAYTQDNT-KSPLRDAADGSFSNPWAHGSGHVEPQKALSPGLVYDISTD  622

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++ Y  + +   ++  P V C +R   +PG LNYPSF+VVF N  + + Y R 
Sbjct  623  DYVAFLCSLDYTLEHVQAIVKK-PNVTC-SRKYSDPGQLNYPSFSVVFGNK-RVVRYSRE  679

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG   ++ Y+V V  P  VR+ V P+RLVF +  +K  Y VTF   +   + A   F
Sbjct  680  LTNVGAAGSI-YRVAVTGPQMVRIAVKPTRLVFKNVGEKQKYTVTFVANKGADKTARSEF  738

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ W++  H V SPIA  W
Sbjct  739  GSIVWANPQHQVKSPIAFAW  758



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 117/200 (59%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ +S L D   G  STP AHG+GHV+P  A  PGLVYD  + 
Sbjct  564  SPSAIKSALMTTAYVHDNT-KSPLRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYDASIT  622

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y  + I L ++    V+C  R   +PG LNYPSF++ F    + + Y RT
Sbjct  623  DYIKFLCSLDYTPEHIQLIVKRHA-VNC-TRKFSDPGQLNYPSFSIHFGGK-RVVRYTRT  679

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP---SF  268
            + NVG+  +V Y VTV  PS V V V P+RLVF    ++  Y VTF S     D     F
Sbjct  680  LTNVGEAGSV-YDVTVDAPSTVEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSGRYGF  738

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ WS+  H V SP+A  W
Sbjct  739  GSIMWSNAQHQVRSPVAFSW  758



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 120/201 (60%), Gaps = 9/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DNS +S L D      STP AHG+GHV+P  A  PGLVYD    
Sbjct  576  SPSAIKSALMTTAYTHDNS-KSPLRDAAGKSFSTPWAHGAGHVNPQKAFSPGLVYDASTK  634

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y+ ++I L ++  P V+C N+   NPG LNYPSF+++F +  + + Y R 
Sbjct  635  DYITFLCSLNYNPEQIQLIVKR-PDVNCTNK-FANPGQLNYPSFSIMFSSK-RVVRYTRI  691

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG+  +V Y V V  PS V + V PSRLVF    D+  Y VTF S       S    
Sbjct  692  LTNVGEAGSV-YNVVVDGPSWVDITVKPSRLVFEKVGDRKRYTVTFVSKKGVDTSSVRNG  750

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WS+  H V SPIA  W
Sbjct  751  FGSILWSNTQHQVRSPIAFAW  771



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 124/205 (60%), Gaps = 11/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYP--STPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G + + D+ +     +TP A GSGHV+P NA+DPGLVYD  
Sbjct  538  SPAAIKSALMTTAYTLNNKG-APISDMASDNSPFATPFAFGSGHVNPVNASDPGLVYDIS  596

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TIT  451
              DY+++LC+I Y S +IAL  R   +  C  + L   G LNYPSF+V+F  +    ++T
Sbjct  597  TKDYLNYLCSINYTSSQIALLSRGKFV--CSKKTLLQAGNLNYPSFSVLFGRSASNASVT  654

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FA  280
            Y+R V NVG  ++ AY V +  P+ V V V P +L F     KLSY+VTF S+       
Sbjct  655  YRRVVTNVGNPQS-AYAVKLEQPNGVSVTVEPRKLKFEKVGQKLSYKVTFLSIGGARVAG  713

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SP+AV W+
Sbjct  714  TSSFGSLVWVSGKYKVRSPMAVTWK  738



>dbj|BAJ89916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 119/199 (60%), Gaps = 10/199 (5%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPST---PHAHGSGHVDPTNAADPGLVYDTGVNDY  613
            KSALMTT YT+DN+G S L+D      +    P + GSGHVDP  A  PGLVYDT ++DY
Sbjct  575  KSALMTTAYTVDNTG-SPLLDAAGANATATATPWSFGSGHVDPVKALSPGLVYDTSIDDY  633

Query  612  VDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYKRT  439
            V FLCT+G  S +    +  +P   C+ R L +PG LNYPSF+VVF  + +  T+ Y R 
Sbjct  634  VAFLCTVGGASPRQVQAVTGAPNATCQ-RKLSSPGDLNYPSFSVVFGLRKSRTTVRYHRE  692

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DPSFG  265
            + NVG   +V Y   V  P ++ V+V P+RLVF    DKL Y V F+S  Q    D +FG
Sbjct  693  LTNVGAAGSV-YAAKVTGPPSIVVSVKPARLVFKKAGDKLRYTVAFKSTAQGGPTDAAFG  751

Query  264  SLSWSDGTHLVTSPIAVIW  208
             L+WS G   V SPI+  W
Sbjct  752  WLTWSSGEQDVRSPISYTW  770



>ref|XP_009789180.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=779

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 118/202 (58%), Gaps = 8/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+  S L D  T  PSTP+ HG+GH++P  A DPGLVYD G  
Sbjct  581  SPAAIKSALMTTAYVHDNTCNS-LKDSSTATPSTPYDHGAGHINPRKAVDPGLVYDIGAQ  639

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            DY +FLCT      ++ +F + S    C + +L NPG LNYP+ + VF  +  + T+T  
Sbjct  640  DYFEFLCTQQLSPSQLMVFGKFSNRT-C-HHSLANPGDLNYPAISAVFPEDAKVSTLTLH  697

Query  444  RTVKNVGK-VKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            RTV NV   + N  Y V V +     V V PSRL F+ +  KLSY+V F++  +   P F
Sbjct  698  RTVTNVASPISN--YHVRVSSFEGAVVKVEPSRLNFTSKHQKLSYKVIFETKSRLKAPEF  755

Query  267  GSLSWSDGTHLVTSPIAVIWEA  202
            GSL W DGTH V S I + W A
Sbjct  756  GSLIWKDGTHKVRSTIVITWLA  777



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 118/195 (61%), Gaps = 5/195 (3%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT YT DN+ R  L D  TG PSTP+ HG+GH+ P  A DPGL+YD   +DY +F
Sbjct  621  KSALMTTAYTHDNTFRP-LKDAATGAPSTPYDHGAGHIRPAKAVDPGLIYDISPDDYFEF  679

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN-LQTITYKRTVKNV  427
            LCT      ++ +F ++S    C++R L +PG LNYP+ + VF+      +T  RTV NV
Sbjct  680  LCTQKLTPLQLKVFSKSSNRT-CKHR-LASPGDLNYPAISAVFREQPAPALTLHRTVTNV  737

Query  426  GKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGSLSWSD  247
            G   +  Y V V     V V V P  L F+ +  KLSY+VTF++      P FG+L WSD
Sbjct  738  GPPVST-YHVRVTPFRGVDVAVEPKTLHFTHQNQKLSYKVTFRTKSPQPMPGFGALIWSD  796

Query  246  GTHLVTSPIAVIWEA  202
            G HLV SP+AV W A
Sbjct  797  GIHLVRSPVAVTWLA  811



>ref|XP_008780373.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=765

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YTL NS    ++D+ +G P+TP   GSGHV+P  A++PGLVYD    
Sbjct  570  SPAAIKSALMTTAYTL-NSKNGYIVDVSSGLPATPFVFGSGHVNPERASNPGLVYDISPK  628

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDC-RNRNLGNPGALNYPSFAVVFKNN--LQTITY  448
            DY+D+LC++ Y S ++A   R +    C +NR L N   LNYPSF+V+F++     T+T 
Sbjct  629  DYLDYLCSLNYTSPQLATLARKN--YRCPKNRILRNIRDLNYPSFSVLFESGSPYSTVTQ  686

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
             RTV NVG+ +   Y V VR P  V +NV P  L F +   KLSY+V+F  +   ++ SF
Sbjct  687  PRTVTNVGQAR-CRYTVKVREPKGVTINVDPKELAFVEMGQKLSYKVSFLGL-SGSNSSF  744

Query  267  GSLSWSDGTHLVTSPIAVIWE  205
            G L W  G   V SP+AV W+
Sbjct  745  GELVWVCGEFSVRSPVAVTWQ  765



>ref|NP_001064523.2| Os10g0394200 [Oryza sativa Japonica Group]
 dbj|BAF26437.2| Os10g0394200, partial [Oryza sativa Japonica Group]
Length=230

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 116/201 (58%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+  S+L D   G  +TP A G+GHVDP  A  PGL+YD    
Sbjct  34   SPAAIKSALMTTAYTVDNTN-SSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTK  92

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT-YKR  442
            DYV FLC++ Y +  I +  + S +   R      PG LNYPSF+VVFK   + +  ++R
Sbjct  93   DYVSFLCSLNYTTPHIQVITKMSNITCPRKF---RPGDLNYPSFSVVFKKKSKHVMRFRR  149

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFADPSF  268
             V NVG   +V Y V V  P++V V V+P++LVF+    K  Y V F S      A P F
Sbjct  150  EVTNVGPAMSV-YNVKVSGPASVSVKVTPAKLVFNKVGQKQRYYVIFASTVDASNAKPDF  208

Query  267  GSLSWSDGTHLVTSPIAVIWE  205
            G +SW    H+V SPIA  W+
Sbjct  209  GWISWMSSQHVVRSPIAYTWK  229



>gb|ACN28035.1| unknown [Zea mays]
Length=380

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 111/205 (54%), Gaps = 10/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT Y    SG S+L+D  TG  +TP  +G+GHVDP  A DPGLVYD G  
Sbjct  177  SPAAVRSALMTTAYA-SYSGGSSLLDAATGGMATPFDYGAGHVDPARALDPGLVYDLGTR  235

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK-------NNLQ  460
            DYVDFLC + Y S  IA   R+       N+   + GALNYPSF+V +         +  
Sbjct  236  DYVDFLCALKYSSTMIAAVARSREYACAENKTY-SVGALNYPSFSVAYSTANGDGGGDSA  294

Query  459  TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ-F  283
            T+T+ RT+ NVG         ++     V V+V P+ L F+   +K SY V F S  Q  
Sbjct  295  TVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKSQPS  354

Query  282  ADPSFGSLSWSDGTHLVTSPIAVIW  208
                FG L WSDG H V SPIA  W
Sbjct  355  GTAGFGRLVWSDGKHSVASPIAFTW  379



>ref|XP_006445191.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
 gb|ESR58431.1| hypothetical protein CICLE_v10018512mg [Citrus clementina]
Length=1364

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 11/199 (6%)
 Frame = -1

Query  783   KSALMTTTYTLDNSGRSTLIDLYTGYPSTP----HAHGSGHVDPTNAADPGLVYDTGVND  616
             KSALMTT YTL+N  R++ I    G   TP     A GSGHVDP +A+DPGL+YD    D
Sbjct  1171  KSALMTTAYTLNN--RNSPIADVGGSSDTPLATAFAFGSGHVDPESASDPGLIYDIATED  1228

Query  615   YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TITYKR  442
             Y+D+LC++ Y S ++ALF   +    C N +  +PG LNYPSFAV FK N++  ++ Y+R
Sbjct  1229  YLDYLCSLNYTSLQLALFAGGN--FTCPNPSAFHPGKLNYPSFAVNFKGNVKNMSLEYER  1286

Query  441   TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGS  262
             +V NVG      Y V V  P+ V V ++P  L F    + LSY+VTF S+   ++ SFGS
Sbjct  1287  SVTNVG-TSYCTYAVKVEEPNGVLVTITPPILSFQKIGEILSYKVTFVSLRGASNESFGS  1345

Query  261   LSWSDGTHLVTSPIAVIWE  205
             L+W  G + V SPIAV W+
Sbjct  1346  LTWVSGKYAVKSPIAVTWQ  1364


 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 101/212 (48%), Gaps = 19/212 (9%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT   +     +              A+G+G V+P  A  PGLVYD    
Sbjct  458  SPAAIKSAIMTTAKPMSQRVNN----------EAEFAYGAGQVNPQKAVSPGLVYDMDDM  507

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNN--LQTITY  448
             Y+ FLC  GY+   +A+ L  S  ++C +   G    ALNYP+  V  K+N  L T  +
Sbjct  508  SYIQFLCHEGYNGSSLAV-LVGSKSINCTSLIPGVGYDALNYPTMQVSLKSNGELTTAIF  566

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            +R V NVG   ++ Y  T++ P  V + V P  L FS    K S+ V  ++ P  +    
Sbjct  567  RRRVTNVGPRLSI-YNATIKAPKGVNITVKPMSLSFSRTSHKRSFSVVVKAKPMSSTQVL  625

Query  267  -GSLSWSDGTHLVTSPIAVIWEARSVSDL*TY  175
             GSL W    H+   P  V +E+ S + + T+
Sbjct  626  SGSLEWKSPRHV---PSDVCFESFSATIIDTH  654



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 116/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+  S L D   G  S P AHGSGHVDP  A  PGLVYD   +
Sbjct  571  SPSAIKSALMTTAYVSDNT-NSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISAD  629

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +YV FLC++ Y  + +   ++  P + C +R   NPG LNYPSF+VVF NN + + Y R 
Sbjct  630  EYVAFLCSLDYTIEHVQAIVKR-PNITC-SRKFNNPGNLNYPSFSVVFTNN-RVVRYTRE  686

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG   ++ Y+V V  P  V+V V PS+LVF +  DKL Y VTF   +         F
Sbjct  687  LTNVGAAGSI-YEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEF  745

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G++ W +  H V SP+A  W
Sbjct  746  GAIVWRNAQHQVRSPVAFSW  765



>gb|EAZ24824.1| hypothetical protein OsJ_08603 [Oryza sativa Japonica Group]
Length=720

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 116/202 (57%), Gaps = 10/202 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y +DN G + +  +  G  + P   GSGHVDP NA DPGLVY+   +
Sbjct  525  SPTAIKSAMMTTAYEVDNGGNAIMSSV-NGRAAGPFELGSGHVDPNNALDPGLVYNATTD  583

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP--GALNYPSFAVVFKNNLQTITYK  445
            DY+ FLC +GY   +IA+F R+S    C  R    P  G LNYP+F++VF  +   +T +
Sbjct  584  DYIAFLCGLGYTPNQIAIFTRDSTTTYCSRR----PPIGDLNYPAFSMVFARSGGQVTQR  639

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP--S  271
            RTV NVG   N  Y VT+  P   R+ V+P RL F+ +   L Y +T  S      P  +
Sbjct  640  RTVTNVGANTNAVYDVTITAPPGTRLTVAPMRLTFNAQRKTLDYAITL-SAGSSNSPYNA  698

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            +G + WSDG H+V SP+   W+
Sbjct  699  WGDIVWSDGQHMVRSPVVATWK  720



>gb|KHN13887.1| Subtilisin-like protease [Glycine soja]
Length=687

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 122/205 (60%), Gaps = 11/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPS--TPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G + + D+ +   +  TP A GSGHV+P +A DPGLVYD G
Sbjct  487  SPAAIKSALMTTAYTLNNKG-APISDMASDNKAFATPFAFGSGHVNPVSAFDPGLVYDIG  545

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNL--QTIT  451
              DY+++LC++ Y S +IAL  R      C  + +   G LNYPSFAV+F  +     +T
Sbjct  546  TEDYLNYLCSLNYTSSQIALLSRGK--FACSKKAVLQAGDLNYPSFAVLFDRSALNANVT  603

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FA  280
            Y R V NVGK ++ AY V V+ P  V V V P  L F     KLSY+VTF +V +     
Sbjct  604  YTRVVTNVGKPQS-AYAVKVKQPDGVSVTVEPRVLKFEKVGQKLSYKVTFLAVGKARVAG  662

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SPIA+ W+
Sbjct  663  TSSFGSLIWVSGRYQVRSPIALTWK  687



>ref|XP_002272965.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
 ref|XP_010661615.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 123/206 (60%), Gaps = 11/206 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTG-YPSTPHAHGSGHVDPTNAADPGLVYDTGV  622
            +P   KSALMTT YTLDN  R+++ D+ +G  P+TP A GSGHV+P  A+DPGL+YD   
Sbjct  565  SPAAIKSALMTTAYTLDNK-RASISDMGSGGSPATPFACGSGHVNPEKASDPGLIYDITT  623

Query  621  NDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNNLQ--TIT  451
            +DY++ LC++ Y S +IAL  R      C N  L   PG LNYPS AV+F  N Q  + T
Sbjct  624  DDYLNHLCSLNYTSSQIALVSRGISFT-CPNDTLHLQPGDLNYPSLAVLFNGNAQNNSAT  682

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV----PQF  283
            YKRTV NVG+  +  Y   V+ P  V V V PS L F     +LSY+V+F ++       
Sbjct  683  YKRTVTNVGQPTST-YVAQVQEPDGVSVMVEPSVLKFRKFNQRLSYKVSFVAMGAASASV  741

Query  282  ADPSFGSLSWSDGTHLVTSPIAVIWE  205
               SFGSL W    H V SPIA+ W+
Sbjct  742  PSSSFGSLVWVSKKHRVRSPIAITWQ  767



>ref|XP_009375850.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 128/203 (63%), Gaps = 9/203 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDL--YTGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YT++N  RS + D+   +  P++P A GSGHVDP +AADPGLVYD  
Sbjct  564  SPAEIKSALMTTAYTINNK-RSPISDVGSNSSQPASPFAFGSGHVDPESAADPGLVYDIT  622

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TIT  451
              DY+ +LC++ Y+S +IALF  N     C   ++   G LNYPSF+V+F  + +  ++T
Sbjct  623  TEDYLLYLCSLNYNSSQIALF-SNGVNFTCPGTSVVQSGDLNYPSFSVIFDQDRRKTSVT  681

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFAD  277
            YKRTVKNVG + +  Y V V+ P+ V V+V P  L F    +K+SY+V F ++      +
Sbjct  682  YKRTVKNVGSIPST-YAVQVKEPAGVSVSVEPKTLRFKKMGEKMSYKVRFVALGGATSTN  740

Query  276  PSFGSLSWSDGTHLVTSPIAVIW  208
             SFGSL+     + V SPIAV+W
Sbjct  741  SSFGSLTLVAEKYRVRSPIAVLW  763



>ref|XP_003551824.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=767

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 122/205 (60%), Gaps = 11/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPS--TPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G + + D+ +   +  TP A GSGHV+P +A DPGLVYD G
Sbjct  567  SPAAIKSALMTTAYTLNNKG-APISDMASDNKAFATPFAFGSGHVNPVSAFDPGLVYDIG  625

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNL--QTIT  451
              DY+++LC++ Y S +IAL  R      C  + +   G LNYPSFAV+F  +     +T
Sbjct  626  TEDYLNYLCSLNYTSSQIALLSRGK--FACSKKAVLQAGDLNYPSFAVLFDRSALNANVT  683

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FA  280
            Y R V NVGK ++ AY V V+ P  V V V P  L F     KLSY+VTF +V +     
Sbjct  684  YTRVVTNVGKPQS-AYAVKVKQPDGVSVTVEPRVLKFEKVGQKLSYKVTFLAVGKARVAG  742

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SPIA+ W+
Sbjct  743  TSSFGSLIWVSGRYQVRSPIALTWK  767



>ref|NP_001048303.1| Os02g0780200 [Oryza sativa Japonica Group]
 dbj|BAD19528.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10217.1| Os02g0780200 [Oryza sativa Japonica Group]
 dbj|BAG92086.1| unnamed protein product [Oryza sativa Japonica Group]
Length=790

 Score =   155 bits (391),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/202 (42%), Positives = 116/202 (57%), Gaps = 10/202 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y +DN G + +  +  G  + P   GSGHVDP NA DPGLVY+   +
Sbjct  595  SPTAIKSAMMTTAYEVDNGGNAIMSSV-NGRAAGPFELGSGHVDPNNALDPGLVYNATTD  653

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP--GALNYPSFAVVFKNNLQTITYK  445
            DY+ FLC +GY   +IA+F R+S    C  R    P  G LNYP+F++VF  +   +T +
Sbjct  654  DYIAFLCGLGYTPNQIAIFTRDSTTTYCSRR----PPIGDLNYPAFSMVFARSGGQVTQR  709

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP--S  271
            RTV NVG   N  Y VT+  P   R+ V+P RL F+ +   L Y +T  S      P  +
Sbjct  710  RTVTNVGANTNAVYDVTITAPPGTRLTVAPMRLTFNAQRKTLDYAITL-SAGSSNSPYNA  768

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            +G + WSDG H+V SP+   W+
Sbjct  769  WGDIVWSDGQHMVRSPVVATWK  790



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 123/201 (61%), Gaps = 9/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+G S L+D   G P+TP A+GSGHVDP  A  PGL+YD G  
Sbjct  572  SPSAIKSALMTTAYTDDNTG-SPLVDGAGGSPATPWAYGSGHVDPQKALSPGLIYDIGTG  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY+ FLC++ Y +  I    +++    C +R L NPG LNYPSF+VVF + + + + Y R
Sbjct  631  DYLAFLCSLEYSTDHIQAISKSTNKT-C-SRRLPNPGNLNYPSFSVVFGRRSRRFVKYNR  688

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP---S  271
             + NVG V    Y V V  P  V+V V P++L+F+    KL Y+VTF S  +  DP   +
Sbjct  689  VLTNVG-VPGSVYNVKVGGPPGVKVTVKPTKLIFNQVGQKLRYKVTFTST-KAGDPVDMA  746

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FG ++WS   H V SP++  W
Sbjct  747  FGWITWSSEQHQVRSPVSYRW  767



>ref|XP_010238670.1| PREDICTED: subtilisin-like protease isoform X1 [Brachypodium 
distachyon]
Length=769

 Score =   154 bits (390),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 119/201 (59%), Gaps = 9/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMT++YT+DN+  S+  D     P+ P A G+GHVDP  A  PGLVYD   N
Sbjct  572  SPAAIKSALMTSSYTVDNT-NSSFRDTAGSSPANPFAFGAGHVDPHKALSPGLVYDISTN  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN-LQTITYKR  442
            DYV FLC++ Y    I +  + S  + C  ++   PG LNYPSF+VVF+N     + Y+R
Sbjct  631  DYVVFLCSLDYSVSHIRVVTKMSN-ISCPQKS--RPGDLNYPSFSVVFRNKPKHVVRYRR  687

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFADPS  271
             + NVG   +V Y V V +P++V V VSP +LVF     KL Y VTF S    P  A P 
Sbjct  688  ELTNVGPAMSV-YNVKVSSPASVSVKVSPEKLVFKKLGQKLRYYVTFTSKVVDPNRAKPD  746

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FG +SW +  H+V SP+A  W
Sbjct  747  FGWISWVNNQHVVRSPVAFTW  767



>ref|XP_006574858.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006574859.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=772

 Score =   154 bits (389),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 11/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYP--STPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G + + D+ +     +TP A GSGHV+P +A+DPGLVYD  
Sbjct  572  SPAAIKSALMTTAYTLNNKG-APISDMASNNSPLATPFAFGSGHVNPVSASDPGLVYDIS  630

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQ-TIT  451
              DY+++LC+I Y S +IAL  R   +  C  + +   G LNYPSFAV+  K+ L  ++T
Sbjct  631  TKDYLNYLCSINYTSSQIALLSRGKFV--CSKKAVLQAGDLNYPSFAVLLGKSALNVSVT  688

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FA  280
            Y+R V NVGK ++ AY V +  P+ V V V P +L F     KLSY+VTF S+       
Sbjct  689  YRRVVTNVGKPQS-AYAVKLEQPNGVSVTVEPRKLKFEKVGQKLSYKVTFLSIGGARVAG  747

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SP+AV W+
Sbjct  748  TSSFGSLIWVSGRYQVRSPMAVTWQ  772



>ref|XP_008454764.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008454765.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=768

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 118/203 (58%), Gaps = 7/203 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGR-STLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGV  622
            +P   KSALMTT Y  DN     + +   +G P+ P A GSGHVDP  A+DPGLVYD   
Sbjct  568  SPAAIKSALMTTAYVTDNKNHLISDVGRASGGPADPFAFGSGHVDPEKASDPGLVYDIAP  627

Query  621  NDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-ITYK  445
             DY+ +LC++ Y+S +IAL  R       + R    PG LNYPSF+V  K       T+K
Sbjct  628  QDYITYLCSLKYNSTQIALVSRGKFTCSSK-RTFFQPGDLNYPSFSVFMKKGKNVNSTFK  686

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FADP  274
            RTV NVG +    Y V +  P  +R+ V P +L F    +KLSY+V+F ++ +     D 
Sbjct  687  RTVTNVG-IPRSDYTVRIYNPKGIRIIVKPEKLSFVKLGEKLSYKVSFVALGKRKSLDDF  745

Query  273  SFGSLSWSDGTHLVTSPIAVIWE  205
            SFGSL W  GT++V SPIAV W+
Sbjct  746  SFGSLVWHSGTYVVRSPIAVTWQ  768



>ref|XP_010919195.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
Length=767

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 121/201 (60%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT  TL+N   S ++D+ +G P+TP A GSGHVDP  A++PGLVYD    
Sbjct  572  SPAAIKSALMTTASTLNNKNGS-VVDVSSGQPATPFAFGSGHVDPERASNPGLVYDISPK  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDC-RNRNLGNPGALNYPSFAVVFKNNLQ--TITY  448
            DY+D+LC++ Y S ++A   R +    C  NR LGN   LNYPSF+V+F       T+T 
Sbjct  631  DYLDYLCSLNYTSAQLATLARKN--YSCPNNRILGNIRDLNYPSFSVLFDRGSPNFTVTQ  688

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
             R V NVG+ +   Y V V  P  V +NV P  L F +   KLSY+V+F  + +  D SF
Sbjct  689  TRIVTNVGQAR-CRYTVKVHEPKGVTMNVDPKELDFVELGQKLSYKVSFLGL-RGTDTSF  746

Query  267  GSLSWSDGTHLVTSPIAVIWE  205
            G L W  G + V SP+AV W+
Sbjct  747  GELVWVCGEYSVRSPVAVTWQ  767



>ref|XP_010919194.1| PREDICTED: subtilisin-like protease isoform X1 [Elaeis guineensis]
Length=774

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 121/201 (60%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT  TL+N   S ++D+ +G P+TP A GSGHVDP  A++PGLVYD    
Sbjct  579  SPAAIKSALMTTASTLNNKNGS-VVDVSSGQPATPFAFGSGHVDPERASNPGLVYDISPK  637

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDC-RNRNLGNPGALNYPSFAVVFKNNLQ--TITY  448
            DY+D+LC++ Y S ++A   R +    C  NR LGN   LNYPSF+V+F       T+T 
Sbjct  638  DYLDYLCSLNYTSAQLATLARKN--YSCPNNRILGNIRDLNYPSFSVLFDRGSPNFTVTQ  695

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
             R V NVG+ +   Y V V  P  V +NV P  L F +   KLSY+V+F  + +  D SF
Sbjct  696  TRIVTNVGQAR-CRYTVKVHEPKGVTMNVDPKELDFVELGQKLSYKVSFLGL-RGTDTSF  753

Query  267  GSLSWSDGTHLVTSPIAVIWE  205
            G L W  G + V SP+AV W+
Sbjct  754  GELVWVCGEYSVRSPVAVTWQ  774



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 121/204 (59%), Gaps = 10/204 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLY--TGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTLD   R+ + D    T   +TP   GSGHVDP  A++PGL+YD  
Sbjct  570  SPAAIKSALMTTAYTLDKE-RTPIADAVSETSISATPFGIGSGHVDPEKASNPGLIYDIS  628

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI--T  451
              DY+ ++C++ Y+S +IAL LR +    C +  L +PG LNYPSFAV+F +  + +  T
Sbjct  629  TEDYLRYICSLNYNSSQIALLLRKN--YTCPSHVLKSPGDLNYPSFAVLFDSKSRNLIQT  686

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYE--VTFQSVPQFAD  277
            +KR+V NVG   +  Y V V TPS V V V P  L F  +  KL Y+  V  +      D
Sbjct  687  FKRSVTNVGNPMST-YVVQVNTPSGVSVTVKPKILKFQKKGQKLRYKMRVVARGKRSAGD  745

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
             +FGSL W   TH+V SPIA+ W+
Sbjct  746  STFGSLVWFSRTHIVRSPIAITWQ  769



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 121/204 (59%), Gaps = 10/204 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLY--TGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTLD   R+ + D    T   +TP   GSGHVDP  A++PGL+YD  
Sbjct  568  SPAAIKSALMTTAYTLDKE-RTPIADAVSETSISATPFGIGSGHVDPEKASNPGLIYDIS  626

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI--T  451
              DY+ ++C++ Y+S +IAL LR +    C +  L +PG LNYPSFAV+F +  + +  T
Sbjct  627  TEDYLRYICSLNYNSSQIALLLRKN--YTCPSHVLKSPGDLNYPSFAVLFDSKSRNLIQT  684

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYE--VTFQSVPQFAD  277
            +KR+V NVG   +  Y V V TPS V V V P  L F  +  KL Y+  V  +      D
Sbjct  685  FKRSVTNVGNPMST-YVVQVNTPSGVSVTVKPKILKFQKKGQKLRYKMRVVARGKRSAGD  743

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
             +FGSL W   TH+V SPIA+ W+
Sbjct  744  STFGSLVWFSRTHIVRSPIAITWQ  767



>gb|EAY87753.1| hypothetical protein OsI_09169 [Oryza sativa Indica Group]
Length=773

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 115/202 (57%), Gaps = 10/202 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSA+MTT Y +DN G + +  +  G  + P   GSGHVDP NA DPGLVY+   +
Sbjct  578  SPTAIKSAMMTTAYEVDNGGNAIMSSV-NGRAAGPFELGSGHVDPNNALDPGLVYNATAD  636

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNP--GALNYPSFAVVFKNNLQTITYK  445
            DY+ FLC +GY   +IA+F R+     C  R    P  G LNYP+F++VF  +   +T +
Sbjct  637  DYIAFLCGLGYTPNQIAIFTRDGTTTYCSRR----PPIGDLNYPAFSMVFARSGGQVTQR  692

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP--S  271
            RTV NVG   N  Y VT+  P   R+ V+P RL F+ +   L Y +T  S      P  +
Sbjct  693  RTVTNVGANTNAVYDVTITAPPGTRLTVAPMRLTFNAQRKTLDYAITL-SAGSSNSPYNA  751

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            +G + WSDG H+V SP+   W+
Sbjct  752  WGDIVWSDGQHMVRSPVVATWK  773



>gb|KHN27220.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 11/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYP--STPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTL+N G + + D+ +     +TP A GSGHV+P +A+DPGLVYD  
Sbjct  541  SPAAIKSALMTTAYTLNNKG-APISDMASNNSPLATPFAFGSGHVNPVSASDPGLVYDIS  599

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQ-TIT  451
              DY+++LC+I Y S +IAL  R   +  C  + +   G LNYPSFAV+  K+ L  ++T
Sbjct  600  TKDYLNYLCSINYTSSQIALLSRGKFV--CSKKAVLQAGDLNYPSFAVLLGKSALNVSVT  657

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FA  280
            Y+R V NVGK ++ AY V +  P+ V V V P +L F     KLSY+VTF S+       
Sbjct  658  YRRVVTNVGKPQS-AYAVKLEQPNGVSVTVEPRKLNFEKVGQKLSYKVTFLSIGGARVAG  716

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SP+AV W+
Sbjct  717  TSSFGSLIWVSGRYQVRSPMAVTWQ  741



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 120/201 (60%), Gaps = 10/201 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+ RS L D   G  STP AHGSGHVDP  A  PGLVYD    
Sbjct  579  SPSAIKSALMTTAYDLDNT-RSPLRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAE  637

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    +   ++  P V C +R   +PG LNYPSF+VVF N+ + + Y R 
Sbjct  638  DYIAFLCSLDYTIDHVKTIVKR-PNVTC-SRKFSDPGELNYPSFSVVF-NDKKVVRYTRE  694

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG   ++ Y V+V  PS V V V P +L+F    DK+ Y VTF S  +  +P+    
Sbjct  695  LTNVGAAGSM-YNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVS-KKGTNPTTRSE  752

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WS+  + V SP+A  W
Sbjct  753  FGSIVWSNAQNKVRSPVAYAW  773



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 122/206 (59%), Gaps = 10/206 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+G S L D   G  STP AHGSGHVDP  A  PGLVYD    
Sbjct  578  SPSAIKSALMTTAYNLDNTG-SPLRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAE  636

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    +   ++  P V C +R   +PG LNYPSF+VVF N+ + + Y R 
Sbjct  637  DYIAFLCSLDYTIDHVKAIVKR-PNVTC-SRKFSDPGELNYPSFSVVF-NDKKVVRYTRE  693

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG   ++ Y V+V  PS V V V P +L+F    DK+ Y VTF S  +  +P+    
Sbjct  694  LTNVGAAGSM-YNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVS-KKGTNPTTRSE  751

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSV  193
            FGS+ WS+  + V SP+A  W   ++
Sbjct  752  FGSIVWSNAQNKVRSPVAYAWTKSAI  777



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 116/201 (58%), Gaps = 8/201 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+  S L D      S P A+GSGHV P  A  PGL+YDT   
Sbjct  554  SPSAIKSALMTTAYTRDNT-ESPLRDATGEALSIPWAYGSGHVSPQKALSPGLLYDTDTQ  612

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    + L ++    V+C      +PG LNYPSF+VVF NN   + Y R 
Sbjct  613  DYIAFLCSLNYTLDHVQLIVKRHD-VNCSKYYFADPGDLNYPSFSVVFGNN-SVVQYTRR  670

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG+ K+V Y V V  PS V + V P+RLVF    ++ +Y VTF S     D S    
Sbjct  671  LTNVGEAKSV-YDVVVSGPSTVGITVKPTRLVFEQVGERQTYTVTFISNKDTVDDSVTYE  729

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS++WS+  H V SP+A  W
Sbjct  730  FGSITWSNKRHQVRSPVAFTW  750



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 122/206 (59%), Gaps = 10/206 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+G S L D   G  STP AHGSGHVDP  A  PGLVYD    
Sbjct  578  SPSAIKSALMTTAYNLDNTG-SPLRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAE  636

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    +   ++  P V C +R   +PG LNYPSF+VVF N+ + + Y R 
Sbjct  637  DYIAFLCSLDYTIDHVKAIVKR-PNVTC-SRKFSDPGELNYPSFSVVF-NDKKVVRYTRE  693

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG   ++ Y V+V  PS V V V P +L+F    DK+ Y VTF S  +  +P+    
Sbjct  694  LTNVGAAGSM-YNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVS-KKGTNPTTRSE  751

Query  270  FGSLSWSDGTHLVTSPIAVIWEARSV  193
            FGS+ WS+  + V SP+A  W   ++
Sbjct  752  FGSIVWSNAQNKVRSPVAYAWTKSAI  777



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 118/200 (59%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+  S L D      STP AHG+GHVDP  A  PGLVYD    
Sbjct  568  SPSAIKSALMTTAYTHDNA-NSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPE  626

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++GY  + + +  ++ P + C  R   +PG LNYPSF+V+F+     + Y R 
Sbjct  627  DYVSFLCSLGYTKEMVQIVAKH-PNITCSKR-FHDPGQLNYPSFSVMFRKT-GVVRYSRE  683

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG    + Y+V+V  P NV V+VSPS LVF +  DK  + VTF   + V       F
Sbjct  684  LTNVGPA-GLTYRVSVDAPPNVEVSVSPSTLVFKNVGDKRRFRVTFVWKKEVGPVVRHGF  742

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ WS+  H V+SP+A  W
Sbjct  743  GSIVWSNALHRVSSPVAYSW  762



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 116/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ ++ L D   G  S P AHGSGHV+P  A  PGLVYD   +
Sbjct  564  SPSAIKSALMTTAYTQDNT-KAPLRDAADGSLSNPWAHGSGHVEPQKALSPGLVYDISTD  622

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++ Y  + +   ++  P V C +R   +PG LNYPSF+VVF    + + Y R 
Sbjct  623  DYVAFLCSLDYTLEHVQAIVKK-PNVTC-SRKYSDPGQLNYPSFSVVFGKK-RVVRYSRE  679

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
              NVG   ++ Y+V V  P  VR+ V P+RLVF +  +K  Y VTF   +   + A   F
Sbjct  680  FTNVGAAGSI-YRVAVTGPQMVRIAVKPTRLVFKNVGEKQKYTVTFVANKGADKTARSEF  738

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ W +  H V SPIA  W
Sbjct  739  GSIVWQNPQHQVKSPIAFAW  758



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 118/199 (59%), Gaps = 6/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KS+LMTT Y  DN+ R+ L D  TG PS P  HG+GH++P  A DPGL+YD GV 
Sbjct  584  SPAAIKSSLMTTAYIHDNT-RNPLKDASTGKPSNPFGHGAGHLNPLKALDPGLIYDMGVQ  642

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DY +FLCT      ++ +F ++S    C +  L NPG LNYP+ + VF  ++++  +T  
Sbjct  643  DYFEFLCTQKLTPMQLKVFTKSSNR-SC-HHTLANPGDLNYPAISAVFPEQHSISLLTLH  700

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   +  Y   V       V+V P  L F+ +  KL+Y++TF +  + + P FG
Sbjct  701  RTVTNVGSPVST-YHARVSQFKGASVSVEPKTLQFTSKHRKLAYKITFTTKSRQSMPEFG  759

Query  264  SLSWSDGTHLVTSPIAVIW  208
            +L WSDG H V SPI + W
Sbjct  760  NLIWSDGIHKVRSPIVITW  778



>gb|KJB34438.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=598

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 5/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN   + L D  T   STP+ HG+GH++P  A DPGL+YD    
Sbjct  399  SPAAVKSALMTTAYVHDNI-HNPLQDSSTAAASTPYDHGAGHINPLKALDPGLIYDISAQ  457

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            DY +FLCT    + ++  F ++S +  C +  L  PG LNYP+ +VVF  +  + T+T  
Sbjct  458  DYFEFLCTQKLTAMQLKAFSKHSNM-SCHHNTLATPGDLNYPAISVVFPEDTAISTLTLH  516

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   +  Y V V     V + V P  L F+ R  KLSY+++F        P FG
Sbjct  517  RTVTNVGPPAS-HYHVVVSPFKGVTIKVEPKTLNFTRRNQKLSYKISFTRKSPQTMPEFG  575

Query  264  SLSWSDGTHLVTSPIAVIW  208
             L+W DG H V SPIA+ W
Sbjct  576  GLAWKDGVHKVRSPIAITW  594



>dbj|BAK06243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 118/202 (58%), Gaps = 9/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTTTYT+DN+  S+L D     P+TP   G+GHVDP  A  PGLVYD   N
Sbjct  572  SPAAIKSALMTTTYTMDNT-NSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTN  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKR  442
            DY  FLC++ Y +  I +  + S  V C  R+   PG LNYPSF+VVF+   +  + Y+R
Sbjct  631  DYAAFLCSLDYSATHIRVITKMSN-VSCPPRS--RPGDLNYPSFSVVFRKKARHAVRYRR  687

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF---ADPS  271
             + NVG    V Y V V  P++V V V+P++LVF     K  Y VTF+S       A P 
Sbjct  688  ELTNVGPAMAV-YDVKVSGPASVGVTVTPAKLVFKKVGQKQRYYVTFESKAAGAGRAKPD  746

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            FG +SW    H+V SP+A  W+
Sbjct  747  FGWISWVSDEHVVRSPVAYTWK  768



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 115/200 (58%), Gaps = 5/200 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT+Y LDN+  S L D   G  +TP A+G+GHVDP  A  PGLVYD   +
Sbjct  570  SPAAIKSALMTTSYVLDNT-NSPLRDAAGGSYATPFAYGAGHVDPQRALSPGLVYDITAD  628

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    I    +   +  C +R   +PG LNYPSF+VVF    + + Y+R 
Sbjct  629  DYIAFLCSLNYTIPHIQAITKRPNVTTC-SRRFSDPGNLNYPSFSVVFGKKWRVVKYRRE  687

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF--ADPSFG  265
            + NVG   +  Y+  V  P  V V V P++L+F     KL Y VTF S  +   A  +FG
Sbjct  688  LTNVGSASST-YEAKVSGPGGVAVTVKPAKLMFKHVNQKLKYSVTFASKERGRSAGTAFG  746

Query  264  SLSWSDGTHLVTSPIAVIWE  205
             ++WS+  H V SP+A  W+
Sbjct  747  WITWSNKQHKVRSPVAYTWK  766



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 120/201 (60%), Gaps = 10/201 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+ RS L D   G  STP AHGSGHVDP  A  PGLVYD    
Sbjct  582  SPSAIKSALMTTAYDLDNT-RSPLRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAE  640

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    +   ++  P V C +R   +PG LNYPSF+VVF N+ + + Y R 
Sbjct  641  DYIAFLCSLDYTIDHVKTIVKR-PNVTC-SRKFSDPGELNYPSFSVVF-NDKKVVRYTRE  697

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS----  271
            + NVG   ++ Y V+V  PS V V V P +L+F    DK+ Y VTF S  +  +P+    
Sbjct  698  LTNVGAAGSM-YNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVS-KKGTNPTTRSE  755

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WS+  + V SP+A  W
Sbjct  756  FGSIVWSNAQNKVRSPVAYAW  776



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 115/200 (58%), Gaps = 9/200 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+  S L D   G  S P AHGSGHVDP  A  PGLVYD   +
Sbjct  571  SPSAIKSALMTTAYFSDNT-NSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISTD  629

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++ Y  + +   ++  P + C  +   NPG LNYPSF+VVF NN + + Y R 
Sbjct  630  DYVAFLCSLDYTIEHVQAIVKR-PNITCSRKF--NPGNLNYPSFSVVFTNN-RVVRYTRE  685

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG   ++ Y+V V  P  V+V V PS+LVF +  DKL Y VTF   +         F
Sbjct  686  LTNVGAAGSI-YEVAVTGPQAVQVTVKPSKLVFKNIGDKLRYTVTFVARKGASLTGRSEF  744

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G++ W +  H V SP+A  W
Sbjct  745  GAIMWRNAQHQVRSPVAFSW  764



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 116/203 (57%), Gaps = 10/203 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ +S L D   G  S P AHGSGHVDP  A  PGLVYD    
Sbjct  572  SPSAIKSALMTTAYTRDNT-KSPLRDAAGGAISNPWAHGSGHVDPQKALSPGLVYDATPE  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y   +I +  +  P + C +R   +PG LNYPSF+V+F    + + Y R 
Sbjct  631  DYIAFLCSLDYSIAQIQMITKR-PNITC-SRRFADPGHLNYPSFSVLFSAETRMVRYTRE  688

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ------FAD  277
            + NVG   +V Y V+V  P++V + V P RLVF +  +K  Y V F +  +         
Sbjct  689  LTNVGPAGSV-YDVSVSGPASVGITVKPRRLVFREVGEKQKYSVMFVARKEGTGGRRVGT  747

Query  276  PSFGSLSWSDGTHLVTSPIAVIW  208
             +FG LSWS+  H V SPI+  W
Sbjct  748  TAFGWLSWSNAQHQVRSPISYEW  770



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 118/203 (58%), Gaps = 11/203 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN G + ++D+ +G  +TP   GSGH DP  A+DPGL+YD    
Sbjct  572  SPAAIKSALMTTAYVADNKG-TPILDVASGSSATPFGLGSGHADPERASDPGLIYDISPK  630

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ---TITY  448
            DY+ +LC++ Y   +I+ F+ N     C    +  PG LNYPSF V FK++     T+TY
Sbjct  631  DYIYYLCSLKYTDSQISGFVYN---FTCPKDAIMQPGDLNYPSFVVNFKSSAAENITLTY  687

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FAD  277
             RTV NVG  K+  Y V V  P  V V V+P  L F+   +KLSY+VTF  + +    A 
Sbjct  688  HRTVTNVGTPKST-YDVLVEEPEGVSVVVTPKVLTFNMLGEKLSYKVTFTGLKRTKPVAA  746

Query  276  PSFGSLSWSDGTHLVTSPIAVIW  208
             SFGSL W  G + V SPIA  W
Sbjct  747  SSFGSLVWVSGNYRVRSPIAASW  769



>gb|KJB34439.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=612

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 5/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN   + L D  T   STP+ HG+GH++P  A DPGL+YD    
Sbjct  413  SPAAVKSALMTTAYVHDNI-HNPLQDSSTAAASTPYDHGAGHINPLKALDPGLIYDISAQ  471

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            DY +FLCT    + ++  F ++S +  C +  L  PG LNYP+ +VVF  +  + T+T  
Sbjct  472  DYFEFLCTQKLTAMQLKAFSKHSNM-SCHHNTLATPGDLNYPAISVVFPEDTAISTLTLH  530

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   +  Y V V     V + V P  L F+ R  KLSY+++F        P FG
Sbjct  531  RTVTNVGPPAS-HYHVVVSPFKGVTIKVEPKTLNFTRRNQKLSYKISFTRKSPQTMPEFG  589

Query  264  SLSWSDGTHLVTSPIAVIW  208
             L+W DG H V SPIA+ W
Sbjct  590  GLAWKDGVHKVRSPIAITW  608



>gb|ACN27710.1| unknown [Zea mays]
Length=701

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 110/204 (54%), Gaps = 10/204 (5%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   +SALMTT Y    SG S+L+D  TG  +TP  +G+GHVDP  A DPGLVYD G  D
Sbjct  499  PAAVRSALMTTAYA-SYSGGSSLLDAATGGMATPFDYGAGHVDPARALDPGLVYDLGTRD  557

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK-------NNLQT  457
            YVDFLC + Y S  IA   R+       N+   + GALNYPSF+V +         +  T
Sbjct  558  YVDFLCALKYSSTMIAAVARSREYACAENKTY-SVGALNYPSFSVAYSTANGDGGGDSAT  616

Query  456  ITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ-FA  280
            +T+ RT+ NVG         ++     V V+V P+ L F+   +K SY V F S  Q   
Sbjct  617  VTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKSQPSG  676

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
               FG L WSDG H V SPIA  W
Sbjct  677  TAGFGRLVWSDGKHSVASPIAFTW  700



>gb|AES80028.2| subtilisin-like serine protease [Medicago truncatula]
Length=774

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRS-TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGV  622
            +P   KS+LMTT YTL+N     + + L    P+ P A GSGHV+P +A+DPGLVYD   
Sbjct  576  SPAMIKSSLMTTAYTLNNRKLPISDLALNNSAPANPFAFGSGHVNPESASDPGLVYDINT  635

Query  621  NDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
             DY+++ C++ + S +I +  + +    C  + +   G LNYPSF+V+F      +TYKR
Sbjct  636  KDYLNYFCSLNFTSSEITILTKTN--FKCSKKPVFQVGDLNYPSFSVLFSKTTHNVTYKR  693

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF---ADPS  271
             V NVGK ++ AY V V  P  V VNV P +L F     KLSY+VTF +V +       S
Sbjct  694  VVTNVGKSQS-AYVVEVLEPHGVIVNVEPRKLKFEKFGQKLSYKVTFLAVGKARVTGSSS  752

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            FGS+ W  G + V SPIAV W+
Sbjct  753  FGSIIWVSGKYKVRSPIAVTWQ  774



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 120/204 (59%), Gaps = 10/204 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLY--TGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YTLD   R+ + D    T   +TP A GSGHVDP  A++PGL+YD  
Sbjct  568  SPAAIKSALMTTAYTLDKK-RTPIADAVSETSLSATPFAIGSGHVDPEKASNPGLIYDIS  626

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI--T  451
              DY+ ++C++ Y+S +IAL LR +    C +  + +PG LNYPSFAV+F +  + +  T
Sbjct  627  TEDYLHYICSLNYNSSQIALLLRKN--YTCPSHAIQSPGDLNYPSFAVLFDSKSRNLIQT  684

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF--QSVPQFAD  277
            +KR+  NVG   +  Y V V  PS V V V P  L F  +  KL Y++ F  +      D
Sbjct  685  FKRSATNVGNPMST-YVVQVNAPSGVSVTVKPKILKFEKKGQKLRYKMRFVARGKRSAGD  743

Query  276  PSFGSLSWSDGTHLVTSPIAVIWE  205
             +FGSL W    H+V SPIA+ W+
Sbjct  744  STFGSLVWFSKIHIVRSPIAITWQ  767



>ref|XP_003623810.1| Subtilisin-like protease [Medicago truncatula]
Length=786

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRS-TLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGV  622
            +P   KS+LMTT YTL+N     + + L    P+ P A GSGHV+P +A+DPGLVYD   
Sbjct  588  SPAMIKSSLMTTAYTLNNRKLPISDLALNNSAPANPFAFGSGHVNPESASDPGLVYDINT  647

Query  621  NDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKR  442
             DY+++ C++ + S +I +  + +    C  + +   G LNYPSF+V+F      +TYKR
Sbjct  648  KDYLNYFCSLNFTSSEITILTKTN--FKCSKKPVFQVGDLNYPSFSVLFSKTTHNVTYKR  705

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF---ADPS  271
             V NVGK ++ AY V V  P  V VNV P +L F     KLSY+VTF +V +       S
Sbjct  706  VVTNVGKSQS-AYVVEVLEPHGVIVNVEPRKLKFEKFGQKLSYKVTFLAVGKARVTGSSS  764

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            FGS+ W  G + V SPIAV W+
Sbjct  765  FGSIIWVSGKYKVRSPIAVTWQ  786



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   152 bits (384),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 117/200 (59%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+ +S L D   G  STP AHGSGHV+P  A  PGLVYD    
Sbjct  566  SPSAIKSALMTTAYVVDNT-KSPLHDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTE  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++GY  + +   ++  P + C  R    PG LNYPSF+V+F +  + + Y R 
Sbjct  625  DYIAFLCSLGYTIEHVKAIVKR-PNITC-TRKFNTPGELNYPSFSVLFGDQ-RVVRYTRE  681

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFADPSF  268
            + NVG  +++ Y VTV  PS V ++V P RL+F    +K  Y VTF +     +    +F
Sbjct  682  LTNVGPARSL-YNVTVDGPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAF  740

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ W +  H V SP+A  W
Sbjct  741  GSIVWGNAQHQVRSPVAFSW  760



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 120/200 (60%), Gaps = 9/200 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ ++ L D   G  S P AHGSGHVDP+ A  PGLVYD    
Sbjct  569  SPSAIKSALMTTAYTHDNT-KAPLSDAAGGQFSNPWAHGSGHVDPSRAVSPGLVYDISSV  627

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +YV FLC++GY  Q++    +++  V C  R   +PG LNYPSF+VVF N  + + Y R 
Sbjct  628  EYVAFLCSLGYTIQQVQSIAKSN--VTCA-RKYSDPGQLNYPSFSVVFGNK-RVVRYTRE  683

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG  +++ Y+V V  P  VR  V PS L F+   +K  Y VTF   +S  + +   F
Sbjct  684  LTNVGTARSL-YKVIVSGPPGVRTIVKPSSLFFATVGEKKKYTVTFVSAKSGSRTSRAEF  742

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ W++  HLV SP+A  W
Sbjct  743  GSIVWANTLHLVKSPVAFAW  762



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 110/204 (54%), Gaps = 10/204 (5%)
 Frame = -1

Query  795  PLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVND  616
            P   +SALMTT Y    SG S+L+D  TG  +TP  +G+GHVDP  A DPGLVYD G  D
Sbjct  562  PAAVRSALMTTAYA-SYSGGSSLLDAATGGMATPFDYGAGHVDPARALDPGLVYDLGTRD  620

Query  615  YVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK-------NNLQT  457
            YVDFLC + Y S  IA   R+       N+   + GALNYPSF+V +         +  T
Sbjct  621  YVDFLCALKYSSTMIAAVARSREYACAENKTY-SVGALNYPSFSVAYSTANGDGGGDSAT  679

Query  456  ITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ-FA  280
            +T+ RT+ NVG         ++     V V+V P+ L F+   +K SY V F S  Q   
Sbjct  680  VTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKSQPSG  739

Query  279  DPSFGSLSWSDGTHLVTSPIAVIW  208
               FG L WSDG H V SPIA  W
Sbjct  740  TAGFGRLVWSDGKHSVASPIAFTW  763



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 119/200 (60%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT+YT DN+  S+L D   G  STP AHGSGHVDP  A  PGLVYD   +
Sbjct  570  SPSAIKSALMTTSYTHDNT-NSSLRDAAGGTYSTPWAHGSGHVDPEKALSPGLVYDISTD  628

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++ Y   ++    +  P V C +R   +PG LNYPSF+V+F +  + + Y R 
Sbjct  629  DYVAFLCSLDYTIDQVRAVAKR-PNVTC-SRKFADPGQLNYPSFSVLFGSK-RIVRYTRQ  685

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG   +V Y VTV  P  V V V P +LVF+   D+ SY VTF   + + Q     F
Sbjct  686  LTNVGAAGSV-YAVTVMGPPAVEVTVKPPKLVFAKVGDRRSYTVTFVSKKGMNQTVRSDF  744

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ WS+  + V SP+A  W
Sbjct  745  GSIVWSNAQNEVRSPVAYAW  764



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 111/205 (54%), Gaps = 10/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT Y    SG S+L+D  TG  +TP  +G+GHVDP  A DPGLVYD G  
Sbjct  561  SPAAVRSALMTTAYA-SYSGGSSLLDAATGGMATPFDYGAGHVDPARALDPGLVYDLGTR  619

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK-------NNLQ  460
            DYVDFLC + Y S  IA   R+       N+   + GALNYPSF+V +         +  
Sbjct  620  DYVDFLCALKYSSTMIAAVARSREYACAENKTY-SVGALNYPSFSVAYSTANGDGGGDSA  678

Query  459  TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ-F  283
            T+T+ RT+ NVG         ++     V V+V P+ L F+   +K SY V F S  Q  
Sbjct  679  TVTHTRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKSQPS  738

Query  282  ADPSFGSLSWSDGTHLVTSPIAVIW  208
                FG L WSDG H V SPIA  W
Sbjct  739  GTAGFGRLVWSDGKHSVASPIAFTW  763



>ref|XP_011076276.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   152 bits (383),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 116/199 (58%), Gaps = 6/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+  S L D  T  PSTP+ HG+GH++P  A DPGLVYD G  
Sbjct  583  SPAAIKSALMTTAYVHDNT-HSPLTDASTAAPSTPYDHGAGHINPLKALDPGLVYDIGAQ  641

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT--ITYK  445
            +Y +FLC  G  + ++ +F + S    CR+  L N   LNYP+ + VF  N  T  +T  
Sbjct  642  EYFEFLCAQGLTASELQVFSKFSNRT-CRHA-LANSRDLNYPAISAVFPENTNTTVLTLH  699

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   + +Y V + T     V V PS+L F+    K++Y++TF +  + + P FG
Sbjct  700  RTVTNVGPPVS-SYHVVISTFKGASVKVEPSKLDFTGNRKKMTYKITFTTKSRQSAPEFG  758

Query  264  SLSWSDGTHLVTSPIAVIW  208
            S+ W DG H V SP+ + W
Sbjct  759  SIIWKDGVHRVRSPVVITW  777



>ref|XP_008354238.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=440

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 113/200 (57%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ R  L D      STP+ HG+GH++P  A DPGL+YD    
Sbjct  242  SPAAIKSALMTTAYVHDNT-RKPLQDSSAASISTPYDHGAGHINPVRALDPGLIYDIEAQ  300

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DY++FLCT      ++ +F + S    C+N NL +PG LNYP+ +VVF  + N+  +T  
Sbjct  301  DYLEFLCTQRLTPTQLKVFTKYSNR-SCKN-NLASPGDLNYPALSVVFPXRTNVSVLTLH  358

Query  444  RTVKNVG-KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            RTV NVG  V N  Y   V       V V P  L F+    KLSY++ F +  + A P F
Sbjct  359  RTVTNVGPAVSN--YHAIVSPFKGAYVKVEPRXLKFTXANQKLSYKIIFTTKSRQAVPEF  416

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G L W DG H V SPI V+W
Sbjct  417  GGLVWKDGVHRVRSPIVVVW  436



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   151 bits (381),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 120/200 (60%), Gaps = 9/200 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YTLDN+  S L D      STP AHG+GHVDP  A  PGLVYD    
Sbjct  547  SPSAIKSALMTTAYTLDNT-NSPLKDAADYSISTPWAHGAGHVDPQKALSPGLVYDAKPE  605

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y  + I   +++ P V C  +   +PG LNYPSF+VVF  + + + Y R 
Sbjct  606  DYIAFLCSLDYTMEMIQAIVKH-PNVTCAAK-FRDPGQLNYPSFSVVFGKS-RVVRYTRR  662

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP---SF  268
            + NVG   +V Y+V+V  P NV V+V PS LVF +  D+  Y VTF S  +  DP    F
Sbjct  663  LTNVGAAGSV-YRVSVEAPPNVVVSVKPSNLVFRNVGDRQRYTVTFVS-QKGVDPLHNGF  720

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS++W +  H V SP+A  W
Sbjct  721  GSITWKNEQHQVRSPVAFSW  740



>ref|XP_010937330.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=772

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 117/201 (58%), Gaps = 7/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT Y +D++  S L D   G  +TP A G+GHVDP  A  PGL+YD    
Sbjct  575  SPAAIRSALMTTAYNIDDT-NSPLRDSAGGSVATPFAFGAGHVDPRKALSPGLIYDITTE  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ-TITYKR  442
            DY+ FLC++ Y  Q I + ++  P V C +R+  NPG LNYPSF+VVFK   +  + Y R
Sbjct  634  DYIAFLCSLDYTIQHIQVIVKR-PNVTC-SRSFSNPGELNYPSFSVVFKKKSRNVVKYIR  691

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFADPSF  268
             + NVG   +V Y V +R P NV V V P++L+F     KL Y + F S         +F
Sbjct  692  ELTNVGSAGSV-YNVRIRGPENVSVTVKPAKLIFKHVGQKLKYSIIFASKNGGHLKTTAF  750

Query  267  GSLSWSDGTHLVTSPIAVIWE  205
            G ++WS+  H V SP+A  W+
Sbjct  751  GWITWSNKQHEVRSPVAYTWK  771



>ref|XP_010914489.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=795

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 121/207 (58%), Gaps = 15/207 (7%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN G+  L+D  TG  ST  A+GSGHVDP  A DPGLVYD  V 
Sbjct  592  SPAAIKSALMTTAYVADNMGQD-LVDEGTGNRSTEWAYGSGHVDPEKAVDPGLVYDLTVE  650

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKN----NLQTIT  451
            DY+DF+C+  Y S  I +  +    V+C ++    P  LNYPS  VV +     NL+ + 
Sbjct  651  DYLDFMCSSNYSSAAIRMITKRQ--VNCSDKTR-KPWDLNYPSILVVLEQSGSGNLEALV  707

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS----VPQF  283
            + RTV NVG+ K+  Y V+V+ P  VR+ V P +LVF  +  K  + V   +    +P+ 
Sbjct  708  H-RTVMNVGEEKS-EYSVSVKEPEGVRLVVEPQKLVFEGKGQKQEFAVKVSAEAVNLPRG  765

Query  282  AD-PSFGSLSWSDGTHLVTSPIAVIWE  205
                 FGS++WSDG H V SP+AV W+
Sbjct  766  GSLTEFGSVTWSDGKHRVRSPVAVTWQ  792



>gb|KJB34440.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=778

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 5/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN   + L D  T   STP+ HG+GH++P  A DPGL+YD    
Sbjct  579  SPAAVKSALMTTAYVHDNI-HNPLQDSSTAAASTPYDHGAGHINPLKALDPGLIYDISAQ  637

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            DY +FLCT    + ++  F ++S +  C +  L  PG LNYP+ +VVF  +  + T+T  
Sbjct  638  DYFEFLCTQKLTAMQLKAFSKHSNM-SCHHNTLATPGDLNYPAISVVFPEDTAISTLTLH  696

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   +  Y V V     V + V P  L F+ R  KLSY+++F        P FG
Sbjct  697  RTVTNVGPPAS-HYHVVVSPFKGVTIKVEPKTLNFTRRNQKLSYKISFTRKSPQTMPEFG  755

Query  264  SLSWSDGTHLVTSPIAVIW  208
             L+W DG H V SPIA+ W
Sbjct  756  GLAWKDGVHKVRSPIAITW  774



>gb|EMT24678.1| Subtilisin-like protease [Aegilops tauschii]
Length=596

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 118/203 (58%), Gaps = 8/203 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+G + + D+ TG  STP A G+GHVDP  A DPGLVYD G  
Sbjct  321  SPAMIKSALMTTAYNMDNAG-AVIGDMSTGKASTPFARGAGHVDPNRAVDPGLVYDAGTE  379

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY+ FLC +GY  ++IA+F   S   +C  R   + G  NYP+F+VVF  N L  +  +R
Sbjct  380  DYITFLCALGYTDKQIAVF---SSSTNCSTRAGSSVGDHNYPAFSVVFTTNKLAVVRQRR  436

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF-QSV--PQFADPS  271
             V+NVG      Y+  V  P  V V VSP  L F+       Y VTF Q +      + +
Sbjct  437  VVRNVGGDARATYRAKVTAPDGVLVTVSPRTLRFTATQKTQEYVVTFAQRIFGGVKGNHT  496

Query  270  FGSLSWSDGTHLVTSPIAVIWEA  202
            FGS+ WSD  H VTSPIA+ W A
Sbjct  497  FGSIEWSDRKHTVTSPIAITWPA  519



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 116/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+ +S L D   G  STP AHGSGHV+P  A  PGLVYD    
Sbjct  566  SPSAIKSALMTTAYVVDNT-KSPLHDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTE  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++GY  + +   ++  P + C  R    PG LNYPSF+V+F +  + + Y R 
Sbjct  625  DYVAFLCSLGYTIEHVQAIVKR-PNITC-TRKFNTPGELNYPSFSVLFGDQ-RVVRYTRE  681

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFADPSF  268
            + NVG  +++ Y VT   PS V ++V P RL+F    +K  Y VTF +     +    +F
Sbjct  682  LTNVGPARSL-YNVTADGPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAF  740

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ W +  H V SP+A  W
Sbjct  741  GSIVWGNAQHQVRSPVAFSW  760



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 116/200 (58%), Gaps = 5/200 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+ R  L D  TG PS P+ HG+GH+ P  A DPGL+YD   +
Sbjct  587  SPAAIKSALMTTAYTHDNTFRP-LKDAATGAPSNPYDHGAGHIRPAKAVDPGLIYDISPD  645

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN-LQTITYKR  442
            DY +FLCT      ++ +F ++S    C+ R L +PG LNYP+ + VF+      +T  R
Sbjct  646  DYFEFLCTQKLTPSQLKVFTKSSNRT-CKQR-LASPGDLNYPAISAVFREQPAPVLTLHR  703

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGS  262
            TV NVG   +  Y V V     V V V P  L F+ +  KLSY+VTF++      P  G+
Sbjct  704  TVTNVGPPVST-YHVKVTPFRGVDVAVEPKTLHFTHQNQKLSYKVTFRTKSPQPIPDLGA  762

Query  261  LSWSDGTHLVTSPIAVIWEA  202
            L WSDG HLV SP+ + W A
Sbjct  763  LIWSDGIHLVRSPVVITWLA  782



>gb|ACL52505.1| unknown [Zea mays]
Length=421

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 115/200 (58%), Gaps = 10/200 (5%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT YT+DN+  S+L D   G  +   A+G+GHVDP  A  PGLVYD   +DY  F
Sbjct  224  KSALMTTAYTVDNT-NSSLRDAADGSVANAFAYGAGHVDPQRALSPGLVYDISTHDYAAF  282

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-----ITYKRT  439
            LC++ Y +  + +  + S  V C   N   PG LNYPSF+VVF    +T     + ++R 
Sbjct  283  LCSLNYSAPHVQVITKASN-VSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRRE  341

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ--FADPSFG  265
            + NVG   +V Y V V  P +V V V+P+RL F     KL Y VTF S  +   A P FG
Sbjct  342  LTNVGPAASV-YDVKVVGPESVAVTVTPARLTFRQAGQKLRYYVTFASRARQGHAKPDFG  400

Query  264  SLSWSDGTHLVTSPIAVIWE  205
             +SW +  H+V SP+A  W+
Sbjct  401  WISWVNDEHVVRSPVAYTWK  420



>ref|XP_010238218.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=805

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 118/208 (57%), Gaps = 12/208 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+G   L        +TP + GSGHVDP  A  PGLVYDT ++
Sbjct  597  SPSAIKSALMTTAYAVDNNGSPLLDAAGDNTTATPWSFGSGHVDPVKALSPGLVYDTSID  656

Query  618  DYVDFLCTIGYDS-----QKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQ  460
            DYV FLCT+G  S     Q I           C+ R L +PG LNYPSF+VV+  + +  
Sbjct  657  DYVAFLCTVGGASSPRQIQAITGSRTAKGNATCQ-RKLSSPGDLNYPSFSVVYPLRKSHS  715

Query  459  TITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA  280
            T+ Y+R + NVG   +V        PS+V V V P+RLVF    DKL Y V F+S  Q A
Sbjct  716  TVKYRRELTNVGAAGSVYTVKVTGGPSSVSVAVKPARLVFKKAGDKLKYTVAFKSSAQGA  775

Query  279  --DPSFGSLSWS--DGTHLVTSPIAVIW  208
              D +FG L+WS  DG H V SPI+  W
Sbjct  776  PTDAAFGWLTWSSADGEHDVRSPISYTW  803



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 116/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +DN+ +S L D   G  STP AHGSGHV+P  A  PGLVYD    
Sbjct  585  SPSAIKSALMTTAYVVDNT-KSPLHDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTE  643

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++GY  + +   ++  P + C  R    PG LNYPSF+V+F +  + + Y R 
Sbjct  644  DYVAFLCSLGYTIEHVQAIVKR-PNITC-TRKFNTPGELNYPSFSVLFGDQ-RVVRYTRE  700

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFADPSF  268
            + NVG  +++ Y VT   PS V ++V P RL+F    +K  Y VTF +     +    +F
Sbjct  701  LTNVGPARSL-YNVTADGPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAF  759

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ W +  H V SP+A  W
Sbjct  760  GSIVWGNAQHQVRSPVAFSW  779



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 111/209 (53%), Gaps = 13/209 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT Y   + G S L+D  TG  +TP  +G+GHVDP+ A DPGLVYD G  
Sbjct  567  SPAAVRSALMTTAYATYSGGSSPLLDAATGATATPFDYGAGHVDPSRAVDPGLVYDLGTR  626

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF---------KNN  466
            DYVDFLC + Y    IA   R+       NR   + G LNYPSF+V F          + 
Sbjct  627  DYVDFLCALKYSPAMIATVARSRDFSCAENRTY-SVGGLNYPSFSVAFSTANGEGGESSA  685

Query  465  LQTITYKRTVKNVGKVK--NVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV  292
              T+T+ RT+ NVG      V+  V       V V V P+ L F+   +K SY V F S 
Sbjct  686  AATVTHTRTLTNVGGAGTYKVSTSVAGAAAQGVTVAVEPTELAFTSAGEKKSYTVRFTSR  745

Query  291  PQFADPS-FGSLSWSDGTHLVTSPIAVIW  208
             Q +  S FG L WSDG H V SPIA  W
Sbjct  746  SQPSGTSGFGRLVWSDGKHSVASPIAFTW  774



>ref|XP_002270958.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=774

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 118/199 (59%), Gaps = 7/199 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT Y  DN+ R+ L D  TG PSTP+ HG+GH++P  A DPGL+YD G  
Sbjct  577  SPAAIRSALMTTAYVHDNT-RNPLRDASTGQPSTPYDHGAGHINPLKALDPGLIYDIGPQ  635

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DY +FLC       ++ +F ++     CR+  L + G LNYP+ + VF  K ++ T+T  
Sbjct  636  DYFEFLCKQKLTPIQLKVFGKSK--RSCRH-TLASGGDLNYPAISAVFPDKASVTTLTLH  692

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   +  Y V V     V V + P+ L F+ +  KLSY++T  +  + + P FG
Sbjct  693  RTVTNVGPPMS-KYHVAVSQFKGVAVKIEPAVLNFTSKHQKLSYKITLTTKSRQSSPEFG  751

Query  264  SLSWSDGTHLVTSPIAVIW  208
            SL W DG H V SP+A+ W
Sbjct  752  SLIWKDGVHKVRSPVAITW  770



>gb|KHN31561.1| Subtilisin-like protease [Glycine soja]
Length=646

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 113/202 (56%), Gaps = 9/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+ + TL D  T  PS+P+ HG+GH+DP  A DPGLVYD    
Sbjct  444  SPAAIKSALMTTAYVLDNT-KKTLRDASTAKPSSPYDHGAGHIDPIRALDPGLVYDIVPQ  502

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-----I  454
            DY +FLCT      ++ +F + S    CR+ +L +PG LNYP+ + VF     T     +
Sbjct  503  DYFEFLCTQNLTPTQLKVFAKYSNR-SCRH-SLASPGDLNYPAISSVFTQKTPTSFPSPV  560

Query  453  TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP  274
               RTV NVG   +  Y V V       + V P  L F+ +  KLSY++TF+   +   P
Sbjct  561  IVHRTVTNVGP-PDSKYHVVVSPFKGASIKVEPETLNFTGKHQKLSYKITFKPKVRQTSP  619

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
             FGS+ W DG H V SPI + W
Sbjct  620  EFGSMEWKDGLHTVRSPIVITW  641



>gb|KHN44005.1| Subtilisin-like protease [Glycine soja]
Length=447

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 117/199 (59%), Gaps = 7/199 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT YT+  +G   L D  TG PSTP  HGSGHVDP  A +PGLVYD  V+
Sbjct  253  SPAAVRSALMTTAYTVYKTGEK-LQDSATGKPSTPFDHGSGHVDPVAALNPGLVYDLTVD  311

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC + Y + +I+   +      C      +   LNYPSFAV+F+++   + + RT
Sbjct  312  DYLGFLCALNYSAAEISTLAKRK--FQCDAGKQYSVTDLNYPSFAVLFESSGSVVKHTRT  369

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS--VPQFADPSFG  265
            + NVG        VT  T S V+++V P  L F +  +K ++ VTF S   PQ  + +FG
Sbjct  370  LTNVGPAGTYKASVTSDTAS-VKISVEPQVLSFKEN-EKKTFTVTFSSSGSPQHTENAFG  427

Query  264  SLSWSDGTHLVTSPIAVIW  208
             + WSDG HLV SPI+V W
Sbjct  428  RVEWSDGKHLVGSPISVNW  446



>ref|XP_010482516.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010482517.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=779

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 114/199 (57%), Gaps = 5/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ +  L D     PS+P+ HG+GH+DP  A DPGLVYD G  
Sbjct  580  SPAAIKSALMTTAYVHDNTLKP-LTDASGAAPSSPYDHGAGHIDPLKAIDPGLVYDIGPQ  638

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            DY +FLCT      ++ +F ++S    C++    NPG LNYP+ + +F  N  +++IT +
Sbjct  639  DYFEFLCTQDLSPSQLKVFTKHSNR-SCKHTLAKNPGNLNYPAISALFPENTRVKSITLR  697

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG     +Y+V+V       V V P  L F+ +  KLSY VTF +  +   P FG
Sbjct  698  RTVTNVGP-HIASYKVSVSPFKGASVTVQPKTLSFTSKHQKLSYTVTFTTRMRMKRPEFG  756

Query  264  SLSWSDGTHLVTSPIAVIW  208
             L W   TH V SP+ + W
Sbjct  757  GLVWKSTTHKVRSPVIITW  775



>ref|XP_007139243.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 ref|XP_007139244.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11237.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11238.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
Length=770

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 123/205 (60%), Gaps = 11/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPS--TPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT+YTL+N G + + D+ +   S  TP   GSGHV+P +A+DPGLVYD  
Sbjct  570  SPAAIKSALMTTSYTLNNKG-APISDMASNNSSLATPFVFGSGHVNPVSASDPGLVYDIS  628

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNL--QTIT  451
              DY+++ C+I Y S +IAL  R   +  C  + +   G LNYPSFAV+F  +    ++T
Sbjct  629  TKDYLNYFCSINYTSSQIALLSRRKFV--CSKKAVLQAGDLNYPSFAVLFGRSAFNASVT  686

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV--PQFAD  277
            Y R V NVGK K+ +Y V V  P+ V V+V P +L F     KLSY VTF +   P+   
Sbjct  687  YMRVVTNVGKSKS-SYAVKVEQPNGVSVSVEPRKLKFEKLGQKLSYNVTFFATGGPKVGG  745

Query  276  -PSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W    + V SPIA+ W+
Sbjct  746  TSSFGSLIWVSDRYKVRSPIAITWQ  770



>gb|EMS67510.1| Subtilisin-like protease [Triticum urartu]
Length=574

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 115/198 (58%), Gaps = 5/198 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ R  L D  TG  STP  HG+GH+ P  A +PGLVYD G N
Sbjct  377  SPAQIKSALMTTAYVHDNTYR-VLKDAATGDASTPFEHGAGHIHPVRALNPGLVYDIGQN  435

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-ITYKR  442
            +Y++FLCT      ++  F +NS +  C+     +PG LNYP+ + VF +   T +T +R
Sbjct  436  EYLEFLCTQNLTPTQLKYFTKNSNMT-CKG-TFSSPGDLNYPAISAVFTDQPATPLTVRR  493

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGS  262
            TV NVG   +  Y V V       V V PS L FS    KL+Y+VT ++      P +G+
Sbjct  494  TVTNVGPPSST-YHVKVTKFKGADVVVEPSTLHFSSANQKLAYKVTVRTKAAQKTPEYGA  552

Query  261  LSWSDGTHLVTSPIAVIW  208
            LSWSDG H+V SP+ + W
Sbjct  553  LSWSDGVHVVRSPLVLTW  570



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 117/200 (59%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ +S L D      STP AHG+GHVDP  A  PGLVYD  V+
Sbjct  564  SPSAIKSALMTTAYVTDNT-KSPLRDAEGDQVSTPWAHGAGHVDPQKALSPGLVYDISVD  622

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +Y++FLC++ Y +  I   +++     C ++   +PGALNYPSF+V+F N  + + Y R 
Sbjct  623  EYINFLCSLDYTTDHIQTIVKHRNFT-C-SKKFSDPGALNYPSFSVLFANK-RVVRYTRR  679

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG   +V Y V V  P  V+V V P++L F    ++L Y VTF   +   + +   F
Sbjct  680  LTNVGAAASV-YTVAVNAPPTVKVTVKPAKLAFKSVGERLRYTVTFVASRGAARTSRSEF  738

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ WS+  H V SP A  W
Sbjct  739  GSIVWSNAEHQVRSPAAFAW  758



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 120/202 (59%), Gaps = 9/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSAL TT Y +DN+  S L D   G  +TP A G+GHVDP  A  PGLVYD   +
Sbjct  575  SPAAIKSALTTTAYNIDNT-NSPLRDSAGGSLATPFAFGAGHVDPRKALSPGLVYDITTD  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY+ FLC++ Y  Q I + ++  P V C +R   NPG LNYPSF+V+F K + + + Y+R
Sbjct  634  DYIAFLCSLDYTIQHIQVIVKR-PNVTC-SRRFSNPGDLNYPSFSVIFEKKSRKVVKYRR  691

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP---S  271
             + NVG   +V Y V +  P N+ V V P++L+F     KL Y V F S  +  +P   +
Sbjct  692  ELTNVGSAGSV-YSVKITGPENISVTVKPAKLIFKHVGQKLKYSVIFAS-KKGGNPKNAA  749

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            FG ++WS+  H V SP+A  W+
Sbjct  750  FGWITWSNKQHKVRSPVAYTWK  771



>gb|KFK26784.1| hypothetical protein AALP_AA8G293000 [Arabis alpina]
Length=758

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 114/199 (57%), Gaps = 5/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN  +  + D     PSTP+ HGSGH+DP  A DPGLVYD G  
Sbjct  559  SPAAIKSALMTTAYVHDNMLKP-ITDASGAAPSTPYDHGSGHIDPLKAIDPGLVYDIGPQ  617

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            DY +FLCT      ++ +F ++S    C+N    NPG LNYP+ + +F  N  ++ +T +
Sbjct  618  DYFEFLCTQDLTPAQLKVFTKHSNRT-CKNTLANNPGNLNYPAISALFPENARVKVMTLR  676

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   + +Y+V+V       V V P  L F+ +  KLSY VTF++  +   P FG
Sbjct  677  RTVTNVGPHIS-SYKVSVSPFKGASVTVQPKTLNFTLKHQKLSYTVTFRTKLRMKRPEFG  735

Query  264  SLSWSDGTHLVTSPIAVIW  208
             L W   TH V SP+ + W
Sbjct  736  GLLWKSATHKVRSPVIITW  754



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 120/201 (60%), Gaps = 7/201 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+G S L D   G  + P  +GSG+VDP  A  PGLVYD    
Sbjct  569  SPSAIKSALMTTAYTVDNTG-SLLRDAAGGSNANPWIYGSGYVDPQKALSPGLVYDIAAE  627

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DY  FLC++ Y +  I L +  SP   C +R L +PG LNYPSF+V+F + + + + Y R
Sbjct  628  DYTAFLCSLDYSTNHI-LAISQSPNTTC-SRRLSDPGNLNYPSFSVIFGRKSRRIVRYSR  685

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQF--ADPSF  268
             + NVG   +V Y +T   P +V V V P++LVF    +KL Y VTF S  Q    D +F
Sbjct  686  ELTNVGLSGSV-YNLTYSGPPSVSVTVRPTKLVFKQVGEKLKYTVTFTSKKQGNPTDMAF  744

Query  267  GSLSWSDGTHLVTSPIAVIWE  205
            G +SW +  H V SPI+ +W+
Sbjct  745  GWISWKNEQHQVRSPISYMWQ  765



>ref|XP_002511772.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF50441.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=744

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 118/205 (58%), Gaps = 11/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYT--GYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT Y LDN     + DL       +TP A GSGHVDP +A+DPGL+YD  
Sbjct  544  SPAAIKSALMTTAYVLDNKNLP-IADLGANNSASATPFAFGSGHVDPESASDPGLIYDIT  602

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTI--T  451
              DY+++LC++ Y S ++  F  +     C N  +  PG LNYPSFAV F  N Q I  T
Sbjct  603  TEDYLNYLCSLNYTSAQV--FQVSRRRFSCPNNTIIQPGDLNYPSFAVNFAGNAQNISKT  660

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ---FA  280
            +KRTV NVG   +  Y V V+ P+ V   V+P  L F +  +KLSY+VTF  + +     
Sbjct  661  FKRTVTNVG-TPSCTYAVQVQEPNGVSTVVNPKILRFRNSGEKLSYKVTFIGLKERDSRE  719

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SPIAV W 
Sbjct  720  SHSFGSLVWVSGKYKVKSPIAVTWR  744



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 124/202 (61%), Gaps = 11/202 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPS--TPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YT DN+  S L D  TG  S  TP A+G+GHV+P  A  PGL+YD  
Sbjct  321  SPSAIKSALMTTAYTYDNT-ESPLRDA-TGEESLSTPWAYGAGHVNPQKALSPGLLYDAS  378

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYK  445
              DY+ FLC++ Y    + L +++ P  +C ++   +PG LNYPSF+VVF +N + + Y 
Sbjct  379  TQDYIYFLCSLNYTLDHLRLLVKH-PDANC-SKKFADPGDLNYPSFSVVFGSN-KVVRYT  435

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADP  274
            RT+ NVG+    AY V V  PS V + V+P++L F +  ++ +Y VTF   +SV   A  
Sbjct  436  RTLTNVGE-PGSAYNVAVSAPSTVDITVNPNKLEFGEVGERQTYTVTFVSNRSVNDSATS  494

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
             FGS+ WS+  HLV SP+A  W
Sbjct  495  GFGSIMWSNEQHLVRSPVAFTW  516



>ref|XP_003549134.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 113/202 (56%), Gaps = 9/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+ + TL D  T  PS+P+ HG+GH+DP  A DPGLVYD    
Sbjct  579  SPAAIKSALMTTAYVLDNT-KKTLRDASTAKPSSPYDHGAGHIDPIRALDPGLVYDIVPQ  637

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT-----I  454
            DY +FLCT      ++ +F + S    CR+ +L +PG LNYP+ + VF     T     +
Sbjct  638  DYFEFLCTQNLTPTQLKVFAKYSNR-SCRH-SLASPGDLNYPAISSVFTQKTPTSFPSPV  695

Query  453  TYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP  274
               RTV NVG   +  Y V V       + V P  L F+ +  KLSY++TF+   +   P
Sbjct  696  IVHRTVTNVGP-PDSKYHVVVSPFKGASIKVEPETLNFTGKHQKLSYKITFKPKVRQTSP  754

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
             FGS+ W DG H V SPI + W
Sbjct  755  EFGSMEWKDGLHTVRSPIMITW  776



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 114/200 (57%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+  S L D      S PHAHGSGHVDP  A  PGLVYD    
Sbjct  540  SPSAIKSALMTTAYNLDNT-NSPLRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTE  598

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +Y+ FLC++ Y    I   ++  P V+C N+   NPG LNYPSF+V+F    + + Y R 
Sbjct  599  EYIRFLCSLDYTVDHIVAIVKR-PSVNCSNK-FSNPGQLNYPSFSVLFGGK-RVVRYTRE  655

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            V NVG   +V Y+V V    +V ++V PS+L F    +K  Y VTF   + V       F
Sbjct  656  VTNVGAANSV-YKVVVNGAPSVGISVKPSKLAFRSVGEKKRYTVTFVSKKGVSLTNKAEF  714

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS++WS+  H V SP+A  W
Sbjct  715  GSITWSNPQHQVRSPVAFSW  734



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 115/192 (60%), Gaps = 4/192 (2%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYVDF  604
            KSALMTT Y  DN+ R  + D   G P++P   G+GH+DP  A  PGLVYD   +DY+ F
Sbjct  566  KSALMTTAYVHDNT-RKPITDAADGTPTSPWDLGAGHIDPRKALSPGLVYDLTADDYIAF  624

Query  603  LCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRTVKNVG  424
            +C++ Y  +++   +R +  V C  + L +PG LNYPSF+V+F+ N + + Y R + NVG
Sbjct  625  VCSLNYTIKQVQSTVRRTN-VTCSTK-LSDPGQLNYPSFSVLFRPNRKVVRYSRELTNVG  682

Query  423  KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGSLSWSDG  244
               +V Y+V V+ PS V V V P RLVF    +K  Y VTF +  Q  +   GS++W + 
Sbjct  683  DAGSV-YKVAVQAPSTVAVRVKPRRLVFGKVGEKQRYTVTFVARNQTDETHGGSITWKNR  741

Query  243  THLVTSPIAVIW  208
             H V SP+  +W
Sbjct  742  QHRVRSPVGFLW  753



>ref|XP_012077058.1| PREDICTED: subtilisin-like protease SBT1.7 [Jatropha curcas]
 gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 117/203 (58%), Gaps = 11/203 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDL---YTGYPSTPHAHGSGHVDPTNAADPGLVYDT  628
            +P   KSALMTT Y +DN+  S L D      G  S P AHGSGHVDP  A  PGLVYD 
Sbjct  564  SPSAIKSALMTTAYVVDNT-NSPLRDAGSDVAGAFSNPWAHGSGHVDPHKALTPGLVYDI  622

Query  627  GVNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITY  448
               +Y  FLC++GY    +   ++  P V C ++   +PG LNYPSF+VVF +  + + Y
Sbjct  623  STQEYEAFLCSLGYTIDHVQAIVKR-PNVTC-SKKFRDPGELNYPSFSVVFASK-RVVRY  679

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFAD  277
             R + NVG+  ++ Y+V V  PS V V V P++LVF +  DKL Y VTF   +   Q A 
Sbjct  680  TRELTNVGEAGSI-YEVAVNGPSTVGVTVKPTKLVFKNVGDKLRYTVTFVAKKGANQDAR  738

Query  276  PSFGSLSWSDGTHLVTSPIAVIW  208
              FGS+ W +  H V SPIA  W
Sbjct  739  SEFGSIVWRNAQHQVRSPIAFTW  761



>dbj|BAD94244.1| serine protease like protein [Arabidopsis thaliana]
Length=334

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 115/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+  + L D      S P+AHGSGHVDP  A  PGLVYD    
Sbjct  137  SPSAIKSALMTTAYVLDNT-NAPLHDAADNSLSNPYAHGSGHVDPQKALSPGLVYDISTE  195

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +Y+ FLC++ Y    I   ++  P V+C ++   +PG LNYPSF+V+F    + + Y R 
Sbjct  196  EYIRFLCSLDYTVDHIVAIVKR-PSVNC-SKKFSDPGQLNYPSFSVLFGGK-RVVRYTRK  252

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            V NVG   +V Y+VTV    +V ++V PS+L F    +K  Y VTF   + V       F
Sbjct  253  VTNVGAASSV-YKVTVNGAPSVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEF  311

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS++WS+  H V SP+A  W
Sbjct  312  GSITWSNPQHEVRSPVAFSW  331



>ref|XP_004140440.1| PREDICTED: subtilisin-like protease SBT1.1 [Cucumis sativus]
Length=766

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 118/205 (58%), Gaps = 10/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDL--YTGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT Y  DN   S + D+    G P+TP   GSGHVDP  A+DPGL+YD  
Sbjct  565  SPAAIKSALMTTAYITDNK-MSLISDVGQANGEPATPFTFGSGHVDPEKASDPGLIYDIT  623

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TIT  451
              DY+++LC++ Y+S +IAL  R +     + R +  PG LNYPSF+V  K   +  +IT
Sbjct  624  PQDYINYLCSLKYNSTQIALVSRGNFTCSSK-RTVVKPGDLNYPSFSVFMKKKAKKVSIT  682

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFA  280
             KRTV NVG +    Y V +  P  + V V P +L F    ++LSY+V F S+       
Sbjct  683  LKRTVTNVG-ISRSDYTVKINNPKGITVIVKPEKLSFGSLGEQLSYQVRFVSLGGKEALD  741

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SPIAV W+
Sbjct  742  TFSFGSLVWISGKYAVRSPIAVTWQ  766



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 115/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+  STL D   G  S P AHG+GHVDP  A  PGLVYD    
Sbjct  563  SPSAIKSALMTTAYTQDNT-NSTLRDAADGSLSNPWAHGAGHVDPQKALSPGLVYDISTE  621

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +Y+ FLC++GY    +   ++  P + C  +   +PG LNYPSF+V+F    + + Y R 
Sbjct  622  EYITFLCSLGYTVDHVKTIVKR-PNITCSTK-FKDPGELNYPSFSVLFGGK-RVVRYTRE  678

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            + NVG  +++ Y+VTV  PS V ++V P  L+F    +K  Y VTF   +     A P F
Sbjct  679  LTNVGPARSI-YKVTVNGPSTVGISVRPKTLIFRSVGEKKRYTVTFVAKRGTSPMAKPEF  737

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ W +  + V SP++  W
Sbjct  738  GSIVWGNAQNQVKSPVSFSW  757



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score =   149 bits (376),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 121/202 (60%), Gaps = 10/202 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT Y+    G+  L+D+ TG PSTP  HG+GH DP  A DPGLVYD  V+
Sbjct  546  SPAAIRSALMTTAYSSYKDGQ-ILLDIATGKPSTPFDHGAGHADPVAALDPGLVYDLTVD  604

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQT--ITYK  445
            DY+DFLC + Y   +I+   R     D + +   +   LNYPSFAV F++N  +    Y 
Sbjct  605  DYLDFLCALNYTDDQISGLTRKEFSCDAKKKY--SVTDLNYPSFAVNFQSNGGSSVYNYS  662

Query  444  RTVKNVGKVKNVAYQVTVRTPS-NVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DP  274
            RT+ NVG      Y++++++ + +V+++V P  L FS   +K SY VTF +V   +    
Sbjct  663  RTLTNVGPAGT--YKLSLKSETQSVKISVEPETLSFSHANEKKSYTVTFTAVGSMSPDSK  720

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
            SFG + WSDG H+V SPIA  W
Sbjct  721  SFGRIEWSDGKHIVGSPIAFSW  742



>gb|ADE77855.1| unknown [Picea sitchensis]
Length=394

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 119/205 (58%), Gaps = 16/205 (8%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT YT DN G   +ID  +G  STP   G+GHV P  A DPGL+YD G  
Sbjct  190  SPAAVRSALMTTAYTQDNRGHR-MIDEASGNASTPFDFGAGHVHPERAMDPGLIYDMGTE  248

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK----NNLQTIT  451
            DYV FLC++ Y S+ I +  R      C  R + +PG +NYPSF+ VF       L T+ 
Sbjct  249  DYVRFLCSLNYTSKAIQVITRKP--TRCPARRI-SPGNINYPSFSAVFDLTQPKKLSTVF  305

Query  450  YKRTVKNVGKVKNVAYQVTVRTP-SNVRVNVSPSRLVFSDRIDKLSYEVTFQS-----VP  289
            + RTV NVG   +V Y+V V  P   V V V P +LVF+++  KLSY VT  +     +P
Sbjct  306  F-RTVTNVGPPLSV-YRVRVIHPRGGVTVTVKPRKLVFTEKNQKLSYTVTVTTKHIDLLP  363

Query  288  QFADPSFGSLSWSDGTHLVTSPIAV  214
              AD  F  +SW+DG H+V SPI +
Sbjct  364  GNADTRFCFISWTDGKHVVQSPITI  388



>gb|KGN66306.1| hypothetical protein Csa_1G597040 [Cucumis sativus]
Length=566

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 115/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+  S+L D   G  S P AHG+GHVDP  A  PGL+YD   N
Sbjct  369  SPSAIKSALMTTAYTQDNT-NSSLRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTN  427

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++ Y    +   ++ S  + C +R   +PG LNYPSF+VVF +  + + Y R 
Sbjct  428  DYVAFLCSLDYGIDHVQAIVKRSN-ITC-SRKFADPGQLNYPSFSVVFGSK-RVVRYTRI  484

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            V NVG   +V Y V    P  V+V V PS+LVF+   ++  Y VTF   +   Q     F
Sbjct  485  VTNVGAAGSV-YDVATTAPPVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRFGF  543

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ WS+  H V SP++  W
Sbjct  544  GSIVWSNDQHQVRSPVSFAW  563



>ref|XP_006662325.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=535

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 117/202 (58%), Gaps = 9/202 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+  S+L D   G  + P A G+GHVDP  A  PGLVYD    
Sbjct  338  SPAAIKSALMTTAYTVDNT-NSSLRDAAGGLLANPFAFGAGHVDPQKALSPGLVYDISTK  396

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DYV FLC++ Y +  I +  + S +   R      PG LNYPSF+VVF KN+   + ++R
Sbjct  397  DYVSFLCSLNYSTPHIQVITKMSNITCPRKF---RPGDLNYPSFSVVFKKNSRHVMRFRR  453

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFADPS  271
             V NVG   +V Y V V +P++V V V+PSR+VF+    K  Y VTF +         P 
Sbjct  454  EVTNVGPAMSV-YNVKVTSPASVSVKVTPSRIVFNRVGQKQRYYVTFAAKVDDTGSVKPD  512

Query  270  FGSLSWSDGTHLVTSPIAVIWE  205
            FG +SW    H+V SP+A  W+
Sbjct  513  FGWISWLSNEHVVRSPVAYTWK  534



>ref|XP_008454762.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   149 bits (375),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 119/205 (58%), Gaps = 10/205 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDL--YTGYPSTPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT Y  D S  S + D+    G P+TP   GSGHVDP  A+DPGL+YD  
Sbjct  563  SPAAIKSALMTTAYVTD-SKMSLISDVGQANGEPATPFTFGSGHVDPEKASDPGLIYDIT  621

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQ--TIT  451
              DY+++LC++ Y+S +IAL  R + L     R +  PG LNYPSF+V  K   +  +IT
Sbjct  622  PQDYINYLCSLKYNSSQIALVSRGN-LTCSSKRTVVKPGDLNYPSFSVFMKKKAKKVSIT  680

Query  450  YKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSV---PQFA  280
             KRTV NVG  ++  Y V +  P  V V V P +L F    ++LSY+V+F S+       
Sbjct  681  LKRTVTNVGITRS-DYTVKINNPKGVTVIVKPEKLSFGSLGEQLSYKVSFVSLGGKEALD  739

Query  279  DPSFGSLSWSDGTHLVTSPIAVIWE  205
              SFGSL W  G + V SPI V W+
Sbjct  740  KFSFGSLVWISGKYAVRSPIVVTWQ  764



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   149 bits (375),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 115/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y LDN+  + L D      S PHAHGSGHVDP  A  PGLVYD    
Sbjct  555  SPSAIKSALMTTAYVLDNT-NAPLHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTE  613

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            +Y+ FLC++ Y    I   ++  P V+C ++   +PG LNYPSF+V+F    + + Y R 
Sbjct  614  EYIRFLCSLDYTVDHIVAIVKR-PSVNC-SKKFSDPGQLNYPSFSVLFGGK-RVVRYTRE  670

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            V NVG  +N  Y+VTV    +V ++V PS+L F    +K  Y VTF   + V       F
Sbjct  671  VTNVG-AENSVYKVTVNGAPSVAISVKPSKLAFRSVGEKKRYTVTFVSKKGVSMTNKAEF  729

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS++WS+  H V SP+A  W
Sbjct  730  GSITWSNPQHEVRSPVAFSW  749



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 123/203 (61%), Gaps = 13/203 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT YT   +G   L+D+ TG PSTP  HG+GHVDP +A +PGLVYD   +
Sbjct  567  SPAAIRSALMTTAYTTYRNG-GALLDVATGKPSTPFGHGAGHVDPVSAVNPGLVYDINAD  625

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNL--QTITYK  445
            DY++FLC + Y   +I +  R +    C +  + +   LNYPSF+V F  +    TI Y 
Sbjct  626  DYLNFLCALKYSPSQINIIARRN--FTCDSSKIYSVTDLNYPSFSVAFPADTGSNTIRYS  683

Query  444  RTVKNVGKVKNVAYQVTVRTP-SNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPS-  271
            RT+ NVG   +  Y+V V  P S+V + V P  + F+   +K+SY V+F +  +   PS 
Sbjct  684  RTLTNVG--PSGTYKVAVTLPDSSVEIIVEPETVSFTQINEKISYSVSFTAPSK--PPST  739

Query  270  --FGSLSWSDGTHLVTSPIAVIW  208
              FG + WSDGTHLVTSP+A+ W
Sbjct  740  NVFGKIEWSDGTHLVTSPVAISW  762



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 124/202 (61%), Gaps = 11/202 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYP--STPHAHGSGHVDPTNAADPGLVYDTG  625
            +P   KSALMTT YT DN+  S L D  TG    STP A+G+GHV+P  A  PGLVYD  
Sbjct  563  SPSAIKSALMTTAYTHDNT-ESPLRDA-TGEEALSTPWAYGAGHVNPQKALSPGLVYDAS  620

Query  624  VNDYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYK  445
              DY+ FLC++ Y    + L +++S   +C  +   +PG LNYPSF+VVF +N + + Y 
Sbjct  621  TQDYIAFLCSLNYTLDHLRLVVKHSD-ANCSTK-FADPGDLNYPSFSVVFGSN-KVVQYT  677

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADP  274
            RT+ NVGK  +V Y V V TPS V + V+P+R+ F++  +  +Y+VTF   +SV      
Sbjct  678  RTLTNVGKAASV-YDVVVSTPSTVEITVNPNRVSFAEVGECQTYKVTFVSNRSVSDSVAS  736

Query  273  SFGSLSWSDGTHLVTSPIAVIW  208
             FGS+ WS+  H V SP+A  W
Sbjct  737  EFGSIMWSNEEHEVRSPVAFTW  758



>ref|XP_008354210.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=783

 Score =   149 bits (376),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 113/200 (57%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ R  L D      STP+ HG+GH++P  A DPGL+YD    
Sbjct  585  SPAAIKSALMTTAYVHDNT-RKPLQDSSAASISTPYDHGAGHINPVRALDPGLIYDIEAQ  643

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DY++FLCT      ++ +F + S    C+N NL +PG LNYP+ +VVF  + N+  +T  
Sbjct  644  DYLEFLCTQRLTPTQLKVFTKYSNR-SCKN-NLASPGDLNYPALSVVFPERTNVSVLTLH  701

Query  444  RTVKNVG-KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            RTV NVG  V N  Y   V       V V P  L F+    KLSY++ F +  + A P F
Sbjct  702  RTVTNVGPAVSN--YHAIVSPFKGAYVKVEPRTLKFTKANQKLSYKIIFTTKSRQAVPEF  759

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G L W DG H V SPI V+W
Sbjct  760  GGLVWKDGVHRVRSPIVVVW  779



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 120/203 (59%), Gaps = 11/203 (5%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT YT   +G+  L D+ TG PSTP  HG+GHVDP +A +PGLVYD  V+
Sbjct  573  SPAAIRSALMTTAYTAYKNGQK-LQDVATGKPSTPFDHGAGHVDPISALNPGLVYDLTVD  631

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTIT---Y  448
            DY++FLC + Y + +I+   + S   D + R   +   LNYPSFAV F++   +     Y
Sbjct  632  DYLNFLCALNYSASEISSLAKRSYTCDEKRRY--SVRDLNYPSFAVNFEDRTTSTNVAKY  689

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ---SVPQFAD  277
             RTV NVG+       VT   PS V++ V P  L F    +K +Y VTF    S P  A+
Sbjct  690  TRTVTNVGRAGTYKATVTSDNPS-VKITVEPDTLSFGQVNEKKAYTVTFSASGSAPLNAN  748

Query  276  PSFGSLSWSDGTHLVTSPIAVIW  208
             SFG L WSDG H+V SPIA+ W
Sbjct  749  -SFGRLEWSDGKHVVGSPIAMSW  770



>ref|XP_009343496.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=783

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 113/200 (57%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ R  L D      STP+ HG+GH++P  A DPGL+YD    
Sbjct  585  SPAAIKSALMTTAYVHDNT-RKPLQDSSAASISTPYDHGAGHINPGRALDPGLIYDIEAQ  643

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF--KNNLQTITYK  445
            DY++FLCT      ++ +F + S    C+N NL +PG LNYP+ +VVF  + N+  +T  
Sbjct  644  DYLEFLCTQRLTPTQLKVFTKYSNR-SCKN-NLASPGDLNYPALSVVFPDRTNVSVLTLH  701

Query  444  RTVKNVG-KVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            RTV NVG  V N  Y   V       V V P  L F+    KLSY++ F +  + A P F
Sbjct  702  RTVTNVGPAVSN--YHAIVSPFKGANVKVEPRTLKFTKANQKLSYKIIFTTKSRQAVPEF  759

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G L W DG H V SPI V+W
Sbjct  760  GGLVWKDGVHRVRSPIVVVW  779



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 116/200 (58%), Gaps = 8/200 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT DN+  S+L D   G  S P AHG+GHVDP  A  PGL+YD   N
Sbjct  568  SPSAIKSALMTTAYTQDNT-NSSLRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTN  626

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC++ Y    +   ++ S +  C +R   +PG LNYPSF+VVF +  + + Y R 
Sbjct  627  DYIAFLCSLDYGIDHVQAIVKRSNIT-C-SRKFADPGQLNYPSFSVVFGSK-RVVRYTRI  683

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTF---QSVPQFADPSF  268
            V NVG   +V Y V    PS V+V V PS+LVF+   ++  Y VTF   +   Q     F
Sbjct  684  VTNVGAAGSV-YDVATTAPSVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRFGF  742

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            GS+ WS+  H V SP++  W
Sbjct  743  GSIVWSNDQHQVRSPVSFAW  762



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 117/199 (59%), Gaps = 7/199 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT YT+  +G   L D  TG PSTP  HGSGHVDP  A +PGLVYD  V+
Sbjct  566  SPAAVRSALMTTAYTVYKTGEK-LQDSATGKPSTPFDHGSGHVDPVAALNPGLVYDLTVD  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+ FLC + Y + +I+   +      C      +   LNYPSFAV+F+++   + + RT
Sbjct  625  DYLGFLCALNYSAAEISTLAKRK--FQCDAGKQYSVTDLNYPSFAVLFESSGSVVKHTRT  682

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS--VPQFADPSFG  265
            + NVG        VT  T S V+++V P  L F +  +K ++ VTF S   PQ  + +FG
Sbjct  683  LTNVGPAGTYKASVTSDTAS-VKISVEPQVLSFKEN-EKKTFTVTFSSSGSPQHTENAFG  740

Query  264  SLSWSDGTHLVTSPIAVIW  208
             + WSDG HLV SPI+V W
Sbjct  741  RVEWSDGKHLVGSPISVNW  759



>ref|XP_010540256.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   148 bits (374),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 112/196 (57%), Gaps = 7/196 (4%)
 Frame = -1

Query  783  KSALMTTTYTLDNSGRSTLIDLYTG--YPSTPHAHGSGHVDPTNAADPGLVYDTGVNDYV  610
            KSALMTT  T DN  R  + D+ +G   P+T  A G+GHVDPT AADPGLVYD    DY+
Sbjct  577  KSALMTTASTTDNRNRP-IGDMGSGPTSPATAFALGAGHVDPTRAADPGLVYDITAMDYL  635

Query  609  DFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFK-NNLQTITYKRTVK  433
            ++LC++ Y  ++IALF R +    C        G LNYPSFAV F+  +   +TYKRTV 
Sbjct  636  NYLCSLNYTMERIALFSRTN--YTCTKGVALRSGDLNYPSFAVNFEAGDRSRLTYKRTVT  693

Query  432  NVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGSLSW  253
            NVG      Y+V V  P  V++ V P  L F      LSY VTF S       SFG+L W
Sbjct  694  NVGS-GACEYKVKVEEPRGVKLRVEPDVLRFQKLRQSLSYSVTFLSEASATSSSFGALVW  752

Query  252  SDGTHLVTSPIAVIWE  205
              G + V SPIA  W+
Sbjct  753  ICGNYSVRSPIAATWD  768



>emb|CDY67452.1| BnaCnng55020D [Brassica napus]
Length=748

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 6/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT Y     G+  L+D+ T  PSTP  HG+GHV P  A  PGL+YD    
Sbjct  553  SPAAIRSALMTTAYNTYKDGKP-LLDILTVKPSTPFGHGAGHVSPATAISPGLIYDLTTK  611

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DY+DFLC + Y+S +I    R +    C  R + +   LNYPSF+V    +  T  Y RT
Sbjct  612  DYIDFLCALNYNSSQIGCVTRGN--YACDPRKMYSVADLNYPSFSVSVHGSGGTYKYTRT  669

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFA--DPSFG  265
            V NVG   +   +V   T + V+++V P+ L F    +K SY VTF  V   A    SFG
Sbjct  670  VTNVGGAGSYTVKVISETAA-VKISVEPAVLNFKKVNEKKSYSVTFTVVSSMAPRSNSFG  728

Query  264  SLSWSDGTHLVTSPIAVIW  208
            S+ WSDG H+V SP+A+ W
Sbjct  729  SIEWSDGKHVVASPVAISW  747



>ref|XP_009401756.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=782

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 117/198 (59%), Gaps = 5/198 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+    L D  TG PS+ + HG+GH+ P  A DPGLVYD    
Sbjct  585  SPAAIKSALMTTAYVHDNT-HHPLKDAATGQPSSTYDHGAGHIQPLKAVDPGLVYDITPE  643

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN-LQTITYKR  442
            +Y +FLC+    S ++ +F ++S    C++ +L +PG LNYP+ + VF+     T+T +R
Sbjct  644  EYFEFLCSQKLTSVQMKVFTKHSNRT-CKH-SLASPGDLNYPAMSAVFRQQPATTLTLQR  701

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFGS  262
             V NVG   +  Y V V       V V P  L F+    KLSY+VTF+++   + P FG 
Sbjct  702  VVTNVGPPVST-YSVKVSAFKGADVVVEPKTLHFTRHNQKLSYKVTFRTISPQSSPEFGG  760

Query  261  LSWSDGTHLVTSPIAVIW  208
            L+WSDGTH+V SP+ V W
Sbjct  761  LTWSDGTHVVRSPVVVTW  778



>ref|XP_002864127.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40386.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 115/199 (58%), Gaps = 5/199 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ +  L D     PS+P+ HG+GH+DP  A DPGLVYD G  
Sbjct  541  SPAAIKSALMTTAYVHDNTLKP-LTDASGAAPSSPYDHGAGHIDPLKAIDPGLVYDIGPQ  599

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNN--LQTITYK  445
            +Y +FLCT      ++ +F ++S    C++    NPG LNYP+ + +F  N  ++ +T +
Sbjct  600  EYFEFLCTQDLSPSQLKVFTKHSNRT-CKHTLAKNPGNLNYPAISALFPENTHVKAMTLR  658

Query  444  RTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSFG  265
            RTV NVG   + +Y+V+V       V V P  L F+ +  KLSY VTF++  +   P FG
Sbjct  659  RTVTNVGPHIS-SYKVSVSPFKGASVTVQPKTLNFTSKHQKLSYTVTFRTRMRLKRPEFG  717

Query  264  SLSWSDGTHLVTSPIAVIW  208
             L W   TH V SP+ + W
Sbjct  718  GLVWKSSTHKVRSPVIITW  736



>ref|XP_002519362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42979.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 109/201 (54%), Gaps = 18/201 (9%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   +SALMTT YT+D S  + L D  T   S P A+GSGHVDP  A  PGLVYD    
Sbjct  21   SPSALRSALMTTAYTVD-STNTPLQDAVTAKFSNPWAYGSGHVDPKRALSPGLVYDISPQ  79

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVFKNNLQTITYKRT  439
            DYV FLC++ YD             + C  R   + G LNYPSF+V+F      + Y R 
Sbjct  80   DYVTFLCSLNYDLN-----------LTC-PRKFSDLGELNYPSFSVLFGKKTTAVRYSRE  127

Query  438  VKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADP----S  271
            + NVG  +   Y+V V  PS V V V+P++LVF    +KL Y  TF +      P    +
Sbjct  128  LTNVGTAR-ATYRVAVTAPSEVAVTVAPAKLVFKKVGEKLRYTATFAAKRNAKKPAGGAA  186

Query  270  FGSLSWSDGTHLVTSPIAVIW  208
            FGS+ WS+  + V+SP+A  W
Sbjct  187  FGSIVWSNAKYKVSSPVAFAW  207



>ref|XP_006401917.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
 gb|ESQ43370.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
Length=779

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 116/200 (58%), Gaps = 6/200 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN+ +  L D     PS+P+ HG+GH++P  A DPGL+YD G  
Sbjct  579  SPAAIKSALMTTAYVHDNTFKP-LTDASGAAPSSPYDHGAGHINPLKAIDPGLIYDIGPQ  637

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNN--LQTITY  448
            DY DFLCT      ++ +F ++S    C++   G NPG LNYP+ + +F  N  ++++T 
Sbjct  638  DYFDFLCTQELSPSQLKVFTKHSNR-SCKHSLAGNNPGNLNYPAISALFPENTHVKSMTL  696

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            +RTV NVG     +Y+V+V       V V P  L F+ +  KLSY VTF++  +   P F
Sbjct  697  RRTVTNVGP-HIASYKVSVSPFKGASVTVQPKTLNFTRKHQKLSYTVTFRTKLRLKRPEF  755

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G L W   TH V SP+ + W
Sbjct  756  GGLLWKSATHRVRSPVIITW  775



>ref|XP_009107228.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 114/200 (57%), Gaps = 6/200 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN     L D     PS+P+ HG+GH+DP  A DPGLVYD G  
Sbjct  575  SPAAVKSALMTTAYVHDNM-LEPLTDAAGAEPSSPYDHGAGHIDPLKAIDPGLVYDIGPQ  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNN--LQTITY  448
            +Y DFLCT      ++ +F ++S    CR+   G NPG LNYP+ + +F  N  ++ +T 
Sbjct  634  EYFDFLCTQELSPSQLKVFTKHSNR-SCRHSLAGNNPGNLNYPAISALFPENTHVKAMTL  692

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            +RTV NVG   + +Y+V+V       V V P  L F+ +  KLSY VTF++  +   P F
Sbjct  693  RRTVTNVGPHVS-SYKVSVSPFKGATVTVQPKTLNFTTKHQKLSYTVTFRTKLRMKRPEF  751

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G L W   TH V SP+ + W
Sbjct  752  GGLLWKSATHKVRSPVIITW  771



>emb|CDY00497.1| BnaA10g07760D [Brassica napus]
Length=775

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 114/200 (57%), Gaps = 6/200 (3%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  DN     L D     PS+P+ HG+GH+DP  A DPGLVYD G  
Sbjct  575  SPAAVKSALMTTAYVHDNM-LEPLTDAAGAEPSSPYDHGAGHIDPLKAIDPGLVYDIGPQ  633

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLG-NPGALNYPSFAVVFKNN--LQTITY  448
            +Y DFLCT      ++ +F ++S    CR+   G NPG LNYP+ + +F  N  ++ +T 
Sbjct  634  EYFDFLCTQELSPSQLKVFTKHSNR-SCRHSLAGNNPGNLNYPAISALFPENTHVKAMTL  692

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQFADPSF  268
            +RTV NVG   + +Y+V+V       V V P  L F+ +  KLSY VTF++  +   P F
Sbjct  693  RRTVTNVGPHVS-SYKVSVSPFKGATVTVQPKTLNFTTKHQKLSYTVTFRTKLRMKRPEF  751

Query  267  GSLSWSDGTHLVTSPIAVIW  208
            G L W   TH V SP+ + W
Sbjct  752  GGLLWKSATHKVRSPVIITW  771



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 113/206 (55%), Gaps = 8/206 (4%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT YT+DN+  S L D      STP AHG+GHVDP  A  PGLVYD   +
Sbjct  566  SPSAIKSALMTTAYTVDNA-NSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPD  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF---KNNLQTITY  448
            DYV FLC++ Y    + L  R        +R   +PG LNYPSF+VVF   K N + + Y
Sbjct  625  DYVSFLCSLDYTDDAVQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRY  684

Query  447  KRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQS---VPQFAD  277
             R + NVG   + AY   +  P  V   V PS+LVF +  +KL Y VTF S   V     
Sbjct  685  TRELTNVGPAGS-AYVAELEVPPTVGATVKPSKLVFGNVGEKLRYTVTFVSKKDVDYSLT  743

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEAR  199
              FGS++W +  H V SP++  W  R
Sbjct  744  SGFGSITWKNAQHQVRSPVSFSWTLR  769



>dbj|BAJ97849.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=669

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 124/211 (59%), Gaps = 12/211 (6%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y +D++G   + D+ TG  STP A G+GH+DP  A +PG VYD G  
Sbjct  465  SPAAIKSALMTTAYNVDSTG-GVIGDMSTGAASTPFARGAGHIDPHRAVNPGFVYDAGTE  523

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF-KNNLQTITYKR  442
            DYV FLC +GY ++++A+F  ++   +C  R + + G  NYP+F+VVF  +    +  +R
Sbjct  524  DYVGFLCALGYTAEQVAVFGSSA---NCSVRAVSSVGDHNYPAFSVVFTADKTAAVRQRR  580

Query  441  TVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQ-----SVPQFAD  277
             V+NVG      Y+  V  P  VRV V+P  L FS R     Y VTF      SV +  +
Sbjct  581  VVRNVGGDARATYRAKVTAPDGVRVTVTPRTLRFSARRRTRKYVVTFARRSFGSVTK--N  638

Query  276  PSFGSLSWSDGTHLVTSPIAVIWEARSVSDL  184
             +FGS+ W+D  H VTSPIA+ W    V+++
Sbjct  639  HTFGSIEWTDRKHSVTSPIAITWPVSQVAEM  669



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = -1

Query  798  APLPSKSALMTTTYTLDNSGRSTLIDLYTGYPSTPHAHGSGHVDPTNAADPGLVYDTGVN  619
            +P   KSALMTT Y  D  G   ++D+ TG P+TP   G+GHVDP  A DPGLVYD  V+
Sbjct  566  SPGAIKSALMTTAYA-DYPGGGGILDVATGRPATPFDFGAGHVDPPKALDPGLVYDLTVD  624

Query  618  DYVDFLCTIGYDSQKIALFLRNSPLVDCRNRNLGNPGALNYPSFAVVF---------KNN  466
            DY+DFLC + Y + +IA   R S   +C N+       LNYPSFAV F          + 
Sbjct  625  DYLDFLCALNYTTLQIASVSRRSNF-NCDNKKAYAVSDLNYPSFAVAFATASGAGGGGSA  683

Query  465  LQTITYKRTVKNVGKVKNVAYQVTVRTPSNVRVNVSPSRLVFSDRIDKLSYEVTFQSVPQ  286
              T+ + RT+ NVG      Y+ TV  P   +V V PS L F+   +K SY V F +  Q
Sbjct  684  ATTVKHTRTLTNVGAPGT--YKATVSAPQEAKVTVDPSELSFAAAGEKKSYTVAFSAASQ  741

Query  285  -FADPSFGSLSWSDGTHLVTSPIAVIW  208
                 +FG L WSDG H+V SP++  W
Sbjct  742  PSGTAAFGRLEWSDGKHVVASPLSFTW  768



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1697011271292