BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11961

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775100.1|  PREDICTED: regulator of nonsense transcripts...    233   8e-70   Nicotiana sylvestris
emb|CDO97628.1|  unnamed protein product                                233   1e-69   Coffea canephora [robusta coffee]
ref|XP_009587503.1|  PREDICTED: regulator of nonsense transcripts...    233   1e-69   Nicotiana tomentosiformis
gb|KDO41302.1|  hypothetical protein CISIN_1g0102241mg                  222   2e-68   Citrus sinensis [apfelsine]
ref|XP_006349314.1|  PREDICTED: regulator of nonsense transcripts...    226   2e-67   Solanum tuberosum [potatoes]
ref|XP_011088114.1|  PREDICTED: regulator of nonsense transcripts...    226   3e-67   
ref|XP_011092289.1|  PREDICTED: regulator of nonsense transcripts...    226   4e-67   Sesamum indicum [beniseed]
ref|XP_004230442.1|  PREDICTED: regulator of nonsense transcripts...    225   6e-67   
ref|XP_009775092.1|  PREDICTED: regulator of nonsense transcripts...    225   1e-66   Nicotiana sylvestris
ref|XP_009587502.1|  PREDICTED: regulator of nonsense transcripts...    225   2e-66   Nicotiana tomentosiformis
ref|XP_006431585.1|  hypothetical protein CICLE_v10000901mg             223   5e-66   Citrus clementina [clementine]
ref|XP_007041200.1|  Smg-4/UPF3 family protein, putative isoform 1      223   5e-66   
ref|XP_006492554.1|  PREDICTED: regulator of nonsense transcripts...    223   6e-66   Citrus sinensis [apfelsine]
gb|EYU26453.1|  hypothetical protein MIMGU_mgv1a004529mg                223   7e-66   Erythranthe guttata [common monkey flower]
gb|EYU26454.1|  hypothetical protein MIMGU_mgv1a004529mg                223   8e-66   Erythranthe guttata [common monkey flower]
ref|XP_010246764.1|  PREDICTED: regulator of nonsense transcripts...    223   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010246762.1|  PREDICTED: regulator of nonsense transcripts...    223   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010246761.1|  PREDICTED: regulator of nonsense transcripts...    223   3e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010246760.1|  PREDICTED: regulator of nonsense transcripts...    223   4e-65   Nelumbo nucifera [Indian lotus]
gb|KCW57140.1|  hypothetical protein EUGRSUZ_I02778                     218   2e-64   Eucalyptus grandis [rose gum]
ref|XP_010030190.1|  PREDICTED: regulator of nonsense transcripts...    218   2e-64   Eucalyptus grandis [rose gum]
gb|KJB47868.1|  hypothetical protein B456_008G045900                    217   4e-64   Gossypium raimondii
gb|KJB47864.1|  hypothetical protein B456_008G045900                    217   6e-64   Gossypium raimondii
ref|XP_006598794.1|  PREDICTED: regulator of nonsense transcripts...    218   6e-64   Glycine max [soybeans]
gb|KJB47855.1|  hypothetical protein B456_008G045900                    218   8e-64   Gossypium raimondii
gb|KJB47856.1|  hypothetical protein B456_008G045900                    218   8e-64   Gossypium raimondii
gb|KJB47866.1|  hypothetical protein B456_008G045900                    218   9e-64   Gossypium raimondii
gb|KJB47867.1|  hypothetical protein B456_008G045900                    217   1e-63   Gossypium raimondii
gb|KJB47860.1|  hypothetical protein B456_008G045900                    217   1e-63   Gossypium raimondii
gb|KJB47859.1|  hypothetical protein B456_008G045900                    217   1e-63   Gossypium raimondii
ref|XP_007041201.1|  Smg-4/UPF3 family protein, putative isoform 2      215   1e-63   
gb|KHF99019.1|  upf3a                                                   218   3e-63   Gossypium arboreum [tree cotton]
ref|XP_009786002.1|  PREDICTED: regulator of nonsense transcripts...    214   7e-63   Nicotiana sylvestris
ref|XP_007148572.1|  hypothetical protein PHAVU_006G219800g             214   3e-62   Phaseolus vulgaris [French bean]
ref|XP_009587163.1|  PREDICTED: regulator of nonsense transcripts...    212   4e-62   Nicotiana tomentosiformis
ref|XP_009404844.1|  PREDICTED: regulator of nonsense transcripts...    212   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011047883.1|  PREDICTED: regulator of nonsense transcripts...    211   3e-61   Populus euphratica
ref|XP_011047887.1|  PREDICTED: regulator of nonsense transcripts...    211   3e-61   Populus euphratica
ref|XP_009355335.1|  PREDICTED: regulator of nonsense transcripts...    210   3e-61   
ref|XP_011047886.1|  PREDICTED: regulator of nonsense transcripts...    211   3e-61   Populus euphratica
ref|XP_011047885.1|  PREDICTED: regulator of nonsense transcripts...    211   3e-61   Populus euphratica
ref|XP_009355334.1|  PREDICTED: regulator of nonsense transcripts...    210   3e-61   Pyrus x bretschneideri [bai li]
ref|XP_008218705.1|  PREDICTED: regulator of nonsense transcripts...    210   3e-61   Prunus mume [ume]
ref|XP_007221816.1|  hypothetical protein PRUPE_ppa004923mg             210   4e-61   Prunus persica
ref|XP_006385052.1|  Smg-4/UPF3 family protein                          211   4e-61   
ref|XP_009353786.1|  PREDICTED: regulator of nonsense transcripts...    210   4e-61   
ref|XP_006385051.1|  hypothetical protein POPTR_0004s23450g             211   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_007221815.1|  hypothetical protein PRUPE_ppa004923mg             209   5e-61   Prunus persica
ref|XP_006592654.1|  PREDICTED: regulator of nonsense transcripts...    210   6e-61   Glycine max [soybeans]
ref|XP_006389505.1|  hypothetical protein POPTR_0022s00460g             209   8e-61   Populus trichocarpa [western balsam poplar]
ref|XP_011028362.1|  PREDICTED: regulator of nonsense transcripts...    208   3e-60   Populus euphratica
ref|XP_011028363.1|  PREDICTED: regulator of nonsense transcripts...    208   3e-60   Populus euphratica
ref|XP_011628613.1|  PREDICTED: regulator of nonsense transcripts...    210   3e-60   Amborella trichopoda
ref|XP_006858584.1|  PREDICTED: regulator of nonsense transcripts...    210   3e-60   Amborella trichopoda
ref|XP_002526435.1|  conserved hypothetical protein                     207   4e-60   
ref|XP_012066695.1|  PREDICTED: regulator of nonsense transcripts...    207   6e-60   
ref|XP_012066696.1|  PREDICTED: regulator of nonsense transcripts...    207   6e-60   Jatropha curcas
ref|XP_008802925.1|  PREDICTED: regulator of nonsense transcripts...    207   1e-59   Phoenix dactylifera
ref|XP_010657967.1|  PREDICTED: regulator of nonsense transcripts...    206   2e-59   Vitis vinifera
ref|XP_010657968.1|  PREDICTED: regulator of nonsense transcripts...    206   2e-59   
ref|XP_010657969.1|  PREDICTED: regulator of nonsense transcripts...    206   2e-59   
ref|XP_009403714.1|  PREDICTED: regulator of nonsense transcripts...    206   4e-59   
ref|XP_010930556.1|  PREDICTED: regulator of nonsense transcripts...    206   4e-59   Elaeis guineensis
gb|KJB32869.1|  hypothetical protein B456_005G265700                    202   1e-58   Gossypium raimondii
gb|KJB32868.1|  hypothetical protein B456_005G265700                    202   4e-58   Gossypium raimondii
gb|KJB32861.1|  hypothetical protein B456_005G265700                    202   4e-58   Gossypium raimondii
gb|KJB32864.1|  hypothetical protein B456_005G265700                    202   5e-58   Gossypium raimondii
gb|KJB32858.1|  hypothetical protein B456_005G265700                    202   5e-58   Gossypium raimondii
emb|CAN62711.1|  hypothetical protein VITISV_035617                     198   6e-58   Vitis vinifera
ref|XP_008802926.1|  PREDICTED: regulator of nonsense transcripts...    203   9e-58   Phoenix dactylifera
ref|XP_004485448.1|  PREDICTED: regulator of nonsense transcripts...    201   9e-58   
ref|XP_008802922.1|  PREDICTED: regulator of nonsense transcripts...    202   1e-57   Phoenix dactylifera
ref|XP_010327534.1|  PREDICTED: regulator of nonsense transcripts...    201   1e-57   Solanum lycopersicum
ref|XP_009401110.1|  PREDICTED: regulator of nonsense transcripts...    202   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010327533.1|  PREDICTED: regulator of nonsense transcripts...    201   1e-57   Solanum lycopersicum
ref|XP_010327532.1|  PREDICTED: regulator of nonsense transcripts...    201   1e-57   Solanum lycopersicum
ref|XP_008795266.1|  PREDICTED: regulator of nonsense transcripts...    202   1e-57   Phoenix dactylifera
ref|XP_004248850.2|  PREDICTED: regulator of nonsense transcripts...    201   2e-57   Solanum lycopersicum
ref|XP_006339922.1|  PREDICTED: regulator of nonsense transcripts...    201   2e-57   Solanum tuberosum [potatoes]
ref|XP_006339925.1|  PREDICTED: regulator of nonsense transcripts...    200   2e-57   Solanum tuberosum [potatoes]
ref|XP_004485447.1|  PREDICTED: regulator of nonsense transcripts...    201   2e-57   
ref|XP_010683312.1|  PREDICTED: regulator of nonsense transcripts...    201   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683306.1|  PREDICTED: regulator of nonsense transcripts...    201   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008795263.1|  PREDICTED: regulator of nonsense transcripts...    202   2e-57   Phoenix dactylifera
ref|XP_010327529.1|  PREDICTED: regulator of nonsense transcripts...    200   2e-57   Solanum lycopersicum
ref|XP_010327531.1|  PREDICTED: regulator of nonsense transcripts...    200   2e-57   Solanum lycopersicum
ref|XP_010101271.1|  hypothetical protein L484_011635                   201   3e-57   
ref|XP_007024253.1|  Smg-4/UPF3 family protein, putative isoform 6      198   5e-57   
tpg|DAA37690.1|  TPA: hypothetical protein ZEAMMB73_050614              193   5e-57   
ref|XP_007226163.1|  hypothetical protein PRUPE_ppa015218mg             198   6e-57   
ref|XP_007024252.1|  Smg-4/UPF3 family protein, putative isoform 5      199   7e-57   
ref|XP_007024249.1|  Smg-4/UPF3 family protein, putative isoform 2      199   7e-57   
ref|XP_007024248.1|  Smg-4/UPF3 family protein, putative isoform 1      199   1e-56   
ref|XP_008219049.1|  PREDICTED: regulator of nonsense transcripts...    198   2e-56   Prunus mume [ume]
ref|XP_010912655.1|  PREDICTED: regulator of nonsense transcripts...    199   2e-56   Elaeis guineensis
ref|XP_008786471.1|  PREDICTED: regulator of nonsense transcripts...    199   3e-56   
ref|XP_008786472.1|  PREDICTED: regulator of nonsense transcripts...    199   4e-56   Phoenix dactylifera
ref|XP_010096436.1|  hypothetical protein L484_013119                   197   4e-56   
gb|EPS57826.1|  hypothetical protein M569_16991                         196   8e-56   Genlisea aurea
gb|KJB32862.1|  hypothetical protein B456_005G265700                    195   2e-55   Gossypium raimondii
gb|KJB32865.1|  hypothetical protein B456_005G265700                    195   2e-55   Gossypium raimondii
ref|XP_010910233.1|  PREDICTED: regulator of nonsense transcripts...    196   3e-55   
emb|CAN72659.1|  hypothetical protein VITISV_042717                     193   3e-55   Vitis vinifera
ref|XP_004975685.1|  PREDICTED: regulator of nonsense transcripts...    195   3e-55   
ref|XP_010910195.1|  PREDICTED: regulator of nonsense transcripts...    196   5e-55   Elaeis guineensis
ref|XP_009362405.1|  PREDICTED: regulator of nonsense transcripts...    194   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_009379179.1|  PREDICTED: regulator of nonsense transcripts...    194   7e-55   Pyrus x bretschneideri [bai li]
gb|KJB68168.1|  hypothetical protein B456_010G229700                    192   8e-55   Gossypium raimondii
ref|XP_008368136.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...    195   8e-55   
gb|KJB68172.1|  hypothetical protein B456_010G229700                    192   9e-55   Gossypium raimondii
ref|XP_009379185.1|  PREDICTED: regulator of nonsense transcripts...    194   9e-55   Pyrus x bretschneideri [bai li]
gb|KJB68170.1|  hypothetical protein B456_010G229700                    192   1e-54   Gossypium raimondii
ref|XP_009362402.1|  PREDICTED: regulator of nonsense transcripts...    194   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_009362399.1|  PREDICTED: regulator of nonsense transcripts...    194   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_008459659.1|  PREDICTED: regulator of nonsense transcripts...    193   1e-54   Cucumis melo [Oriental melon]
ref|XP_008459660.1|  PREDICTED: regulator of nonsense transcripts...    193   1e-54   Cucumis melo [Oriental melon]
ref|XP_004141560.1|  PREDICTED: regulator of nonsense transcripts...    193   1e-54   Cucumis sativus [cucumbers]
ref|XP_008669383.1|  PREDICTED: regulator of nonsense transcripts...    193   1e-54   Zea mays [maize]
ref|XP_011656113.1|  PREDICTED: regulator of nonsense transcripts...    193   1e-54   Cucumis sativus [cucumbers]
tpg|DAA37689.1|  TPA: hypothetical protein ZEAMMB73_050614              193   1e-54   
gb|KJB68169.1|  hypothetical protein B456_010G229700                    192   2e-54   Gossypium raimondii
gb|EMT22790.1|  Regulator of nonsense transcripts 3A                    192   2e-54   
ref|XP_008663221.1|  PREDICTED: regulator of nonsense transcripts...    192   2e-54   Zea mays [maize]
ref|XP_008663219.1|  PREDICTED: regulator of nonsense transcripts...    192   2e-54   Zea mays [maize]
ref|XP_008663218.1|  PREDICTED: regulator of nonsense transcripts...    192   2e-54   Zea mays [maize]
ref|XP_008663216.1|  PREDICTED: regulator of nonsense transcripts...    192   2e-54   Zea mays [maize]
dbj|BAJ94892.1|  predicted protein                                      193   3e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008663217.1|  PREDICTED: regulator of nonsense transcripts...    192   3e-54   
ref|XP_008663214.1|  PREDICTED: regulator of nonsense transcripts...    192   4e-54   Zea mays [maize]
ref|XP_011461172.1|  PREDICTED: regulator of nonsense transcripts...    192   4e-54   Fragaria vesca subsp. vesca
ref|XP_002447880.1|  hypothetical protein SORBIDRAFT_06g017380          192   4e-54   
ref|XP_011461169.1|  PREDICTED: regulator of nonsense transcripts...    192   5e-54   Fragaria vesca subsp. vesca
ref|XP_008378738.1|  PREDICTED: regulator of nonsense transcripts...    191   8e-54   
emb|CAH66847.1|  H0525C06.10                                            191   9e-54   Oryza sativa [red rice]
ref|XP_008378737.1|  PREDICTED: regulator of nonsense transcripts...    191   9e-54   
ref|XP_008378736.1|  PREDICTED: regulator of nonsense transcripts...    191   9e-54   
ref|NP_174660.2|  regulator of nonsense transcripts UPF3                190   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891069.1|  ATUPF3/UPF3                                        190   1e-53   
gb|KHG15802.1|  Regulator of nonsense transcripts 3A                    191   1e-53   Gossypium arboreum [tree cotton]
gb|AAG12537.1|AC015446_18  Unknown protein                              190   3e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAE03133.3|  OJ000114_01.14                                         188   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052873.1|  Os04g0440100                                       188   1e-52   
ref|XP_010530121.1|  PREDICTED: regulator of nonsense transcripts...    187   3e-52   
ref|XP_010530119.1|  PREDICTED: regulator of nonsense transcripts...    187   3e-52   
ref|XP_010530120.1|  PREDICTED: regulator of nonsense transcripts...    187   3e-52   
ref|XP_006652316.1|  PREDICTED: regulator of nonsense transcripts...    187   3e-52   Oryza brachyantha
emb|CDY15301.1|  BnaC06g07870D                                          186   3e-52   Brassica napus [oilseed rape]
emb|CDY52194.1|  BnaCnng22070D                                          185   7e-52   Brassica napus [oilseed rape]
ref|XP_009421163.1|  PREDICTED: regulator of nonsense transcripts...    187   8e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010542926.1|  PREDICTED: regulator of nonsense transcripts...    185   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010478812.1|  PREDICTED: regulator of nonsense transcripts...    185   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010499932.1|  PREDICTED: regulator of nonsense transcripts...    185   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010542909.1|  PREDICTED: regulator of nonsense transcripts...    185   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010542917.1|  PREDICTED: regulator of nonsense transcripts...    185   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010463114.1|  PREDICTED: regulator of nonsense transcripts...    184   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_003527584.1|  PREDICTED: regulator of nonsense transcripts...    185   3e-51   Glycine max [soybeans]
ref|XP_006582445.1|  PREDICTED: regulator of nonsense transcripts...    185   3e-51   
ref|XP_006582443.1|  PREDICTED: regulator of nonsense transcripts...    185   3e-51   Glycine max [soybeans]
ref|XP_006582444.1|  PREDICTED: regulator of nonsense transcripts...    184   3e-51   Glycine max [soybeans]
ref|XP_006582442.1|  PREDICTED: regulator of nonsense transcripts...    184   4e-51   Glycine max [soybeans]
ref|XP_006303223.1|  hypothetical protein CARUB_v10012004mg             179   4e-51   
ref|XP_006579008.1|  PREDICTED: regulator of nonsense transcripts...    183   4e-51   
ref|NP_001117406.1|  regulator of nonsense transcripts UPF3             183   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031522.1|  PREDICTED: regulator of nonsense transcripts...    184   5e-51   Populus euphratica
ref|XP_009114779.1|  PREDICTED: regulator of nonsense transcripts...    182   6e-51   Brassica rapa
ref|XP_003522607.1|  PREDICTED: regulator of nonsense transcripts...    184   6e-51   
ref|XP_006579007.1|  PREDICTED: regulator of nonsense transcripts...    184   6e-51   
ref|XP_009114778.1|  PREDICTED: regulator of nonsense transcripts...    182   7e-51   Brassica rapa
emb|CDX93747.1|  BnaA09g23470D                                          182   1e-50   
ref|XP_010239939.1|  PREDICTED: regulator of nonsense transcripts...    182   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_010239938.1|  PREDICTED: regulator of nonsense transcripts...    182   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_006415052.1|  hypothetical protein EUTSA_v10007455mg             182   1e-50   
gb|KHN47094.1|  Regulator of nonsense transcripts 3A                    182   2e-50   Glycine soja [wild soybean]
gb|AES68284.2|  regulator of nonsense transcripts UPF3 protein          182   2e-50   Medicago truncatula
emb|CDY48801.1|  BnaA05g20690D                                          179   2e-49   Brassica napus [oilseed rape]
ref|XP_009145165.1|  PREDICTED: regulator of nonsense transcripts...    178   3e-49   Brassica rapa
ref|XP_009145164.1|  PREDICTED: regulator of nonsense transcripts...    178   3e-49   Brassica rapa
ref|XP_006441553.1|  hypothetical protein CICLE_v10019695mg             178   5e-49   
ref|XP_009107941.1|  PREDICTED: regulator of nonsense transcripts...    176   1e-48   Brassica rapa
ref|XP_009107940.1|  PREDICTED: regulator of nonsense transcripts...    176   1e-48   Brassica rapa
ref|XP_007148608.1|  hypothetical protein PHAVU_005G000800g             177   2e-48   Phaseolus vulgaris [French bean]
emb|CDY46452.1|  BnaA08g06560D                                          176   2e-48   Brassica napus [oilseed rape]
ref|XP_007148607.1|  hypothetical protein PHAVU_005G000800g             177   3e-48   Phaseolus vulgaris [French bean]
ref|XP_003598033.1|  B3 domain-containing protein                       181   3e-48   
ref|XP_002325958.2|  hypothetical protein POPTR_0019s10620g             176   6e-48   Populus trichocarpa [western balsam poplar]
gb|KDO45829.1|  hypothetical protein CISIN_1g009733mg                   175   8e-48   Citrus sinensis [apfelsine]
ref|XP_006478194.1|  PREDICTED: regulator of nonsense transcripts...    175   9e-48   Citrus sinensis [apfelsine]
emb|CDX91795.1|  BnaC08g07140D                                          177   1e-47   
ref|XP_012073511.1|  PREDICTED: regulator of nonsense transcripts...    173   4e-47   Jatropha curcas
gb|KDP36702.1|  hypothetical protein JCGZ_07993                         173   6e-47   Jatropha curcas
ref|XP_006441556.1|  hypothetical protein CICLE_v10019695mg             172   8e-47   
gb|KDO45837.1|  hypothetical protein CISIN_1g009733mg                   169   1e-45   Citrus sinensis [apfelsine]
ref|XP_010910224.1|  PREDICTED: regulator of nonsense transcripts...    169   3e-45   
ref|XP_001778894.1|  predicted protein                                  171   1e-44   
ref|XP_003592906.1|  Regulator of nonsense transcripts 3A               160   3e-43   
ref|XP_009421164.1|  PREDICTED: regulator of nonsense transcripts...    160   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003592907.1|  Regulator of nonsense transcripts 3A               159   4e-42   
gb|ABE91932.1|  Nonsense-mediated decay UPF3                            159   5e-42   Medicago truncatula
gb|AES63156.2|  Smg-4/UPF3 family protein                               159   6e-42   Medicago truncatula
gb|AES63158.2|  Smg-4/UPF3 family protein                               159   7e-42   Medicago truncatula
ref|XP_003592905.1|  Regulator of nonsense transcripts 3A               159   1e-41   
ref|XP_004499563.1|  PREDICTED: regulator of nonsense transcripts...    156   8e-41   Cicer arietinum [garbanzo]
ref|XP_004499558.1|  PREDICTED: regulator of nonsense transcripts...    156   1e-40   
ref|XP_004499559.1|  PREDICTED: regulator of nonsense transcripts...    156   1e-40   
ref|XP_004499561.1|  PREDICTED: regulator of nonsense transcripts...    156   1e-40   
ref|XP_004499560.1|  PREDICTED: regulator of nonsense transcripts...    156   1e-40   
ref|XP_010246763.1|  PREDICTED: regulator of nonsense transcripts...    155   3e-40   Nelumbo nucifera [Indian lotus]
gb|KJB32867.1|  hypothetical protein B456_005G265700                    146   2e-37   Gossypium raimondii
ref|XP_008378998.1|  PREDICTED: regulator of nonsense transcripts...    145   7e-37   
ref|XP_002972412.1|  hypothetical protein SELMODRAFT_97155              135   3e-36   
ref|XP_002984244.1|  hypothetical protein SELMODRAFT_119852             134   6e-36   
ref|XP_002510770.1|  conserved hypothetical protein                     140   1e-35   
ref|XP_006478236.1|  PREDICTED: uncharacterized protein LOC102612273    135   6e-35   
ref|XP_008352807.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...    139   1e-34   
emb|CBI18298.3|  unnamed protein product                                133   4e-34   Vitis vinifera
ref|XP_010930558.1|  PREDICTED: regulator of nonsense transcripts...    136   8e-34   Elaeis guineensis
ref|XP_010930557.1|  PREDICTED: regulator of nonsense transcripts...    136   1e-33   
gb|EMS47492.1|  Regulator of nonsense transcripts 3A                    135   2e-33   Triticum urartu
gb|KJB32866.1|  hypothetical protein B456_005G265700                    134   3e-33   Gossypium raimondii
emb|CBI18294.3|  unnamed protein product                                126   2e-31   Vitis vinifera
gb|KIY98106.1|  hypothetical protein MNEG_9858                          116   8e-29   Monoraphidium neglectum
ref|XP_005644501.1|  hypothetical protein COCSUDRAFT_44353              115   1e-26   Coccomyxa subellipsoidea C-169
ref|XP_002945932.1|  hypothetical protein VOLCADRAFT_48819              103   2e-24   Volvox carteri f. nagariensis
ref|XP_001691099.1|  UPF3 protein                                       107   1e-23   Chlamydomonas reinhardtii
ref|XP_011395745.1|  Regulator of nonsense transcripts 3A               107   1e-23   Auxenochlorella protothecoides
ref|XP_001754467.1|  predicted protein                                  108   3e-23   
ref|XP_005851259.1|  hypothetical protein CHLNCDRAFT_50004              100   7e-23   Chlorella variabilis
ref|XP_006441562.1|  hypothetical protein CICLE_v10024224mg           97.4    4e-22   
gb|KHN22614.1|  Regulator of nonsense transcripts 3A                  97.1    2e-21   Glycine soja [wild soybean]
gb|ACO09703.1|  Regulator of nonsense transcripts 3B                  96.7    3e-20   Osmerus mordax
emb|CCJ29190.1|  unnamed protein product                              96.3    6e-20   Pneumocystis jirovecii
gb|KFM76145.1|  Regulator of nonsense transcripts 3A                  94.7    2e-19   Stegodyphus mimosarum
ref|XP_012050899.1|  hypothetical protein CNAG_03276                  93.6    9e-19   Cryptococcus neoformans var. grubii H99
ref|XP_006441789.1|  hypothetical protein CICLE_v10023375mg           87.8    2e-18   
ref|XP_006441573.1|  hypothetical protein CICLE_v10024086mg           87.4    2e-18   
emb|CAG08354.1|  unnamed protein product                              93.2    2e-18   Tetraodon nigroviridis
emb|CDS12040.1|  hypothetical protein LRAMOSA04235                    92.0    2e-18   Lichtheimia ramosa
emb|CDH57309.1|  wd repeat-containing protein                         91.7    3e-18   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003970655.1|  PREDICTED: regulator of nonsense transcripts 3B  92.0    4e-18   
ref|XP_002404304.1|  regulator of nonsense transcripts 3B, putative   91.3    7e-18   Ixodes scapularis [blacklegged tick]
gb|EPB88698.1|  hypothetical protein HMPREF1544_04457                 90.9    8e-18   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003030982.1|  hypothetical protein SCHCODRAFT_109867           91.3    9e-18   Schizophyllum commune H4-8
gb|ESA18168.1|  hypothetical protein GLOINDRAFT_144398                89.0    1e-17   
emb|CEP19677.1|  hypothetical protein                                 89.7    2e-17   Parasitella parasitica
gb|KDN51831.1|  hypothetical protein RSAG8_00380                      88.6    2e-17   Rhizoctonia solani AG-8 WAC10335
dbj|GAN09940.1|  conserved hypothetical protein                       89.4    3e-17   Mucor ambiguus
ref|XP_007872945.1|  hypothetical protein PNEG_01033                  89.0    3e-17   Pneumocystis murina B123
gb|KEP50606.1|  Smg-4/UPF3 family protein                             90.5    4e-17   Rhizoctonia solani 123E
emb|CEI89159.1|  hypothetical protein RMCBS344292_03527               87.4    5e-17   Rhizopus microsporus
ref|XP_006909398.1|  PREDICTED: regulator of nonsense transcripts...  87.0    8e-17   
gb|KDE06536.1|  hypothetical protein MVLG_03185                       86.3    8e-17   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_974984.1|  PREDICTED: regulator of nonsense transcripts 3A     88.2    8e-17   
ref|XP_010786902.1|  PREDICTED: regulator of nonsense transcripts...  86.7    1e-16   Notothenia coriiceps [yellowbelly rockcod]
gb|EJU05580.1|  hypothetical protein DACRYDRAFT_104067                87.8    1e-16   Dacryopinax primogenitus
ref|XP_004921328.1|  PREDICTED: LOW QUALITY PROTEIN: UPF3 regulat...  87.4    2e-16   
emb|CEG66812.1|  hypothetical protein RMATCC62417_03331               85.9    2e-16   Rhizopus microsporus
gb|EUC62084.1|  Smg-4/UPF3 family protein                             88.6    2e-16   Rhizoctonia solani AG-3 Rhs1AP
gb|EHB01155.1|  Regulator of nonsense transcripts 3A                  87.0    2e-16   Heterocephalus glaber [naked mole rat]
gb|KFH18280.1|  Smg-4/UPF3 family protein                             86.7    2e-16   Toxoplasma gondii MAS
ref|XP_002364750.1|  smg-4/UPF3 family domain protein                 87.8    2e-16   
emb|CDQ87142.1|  unnamed protein product                              87.0    2e-16   Oncorhynchus mykiss
gb|ACO08927.1|  Regulator of nonsense transcripts 3B                  83.2    2e-16   Osmerus mordax
gb|KFG36731.1|  Smg-4/UPF3 family protein                             87.4    3e-16   Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|EXX69496.1|  hypothetical protein RirG_095570                      87.4    3e-16   Rhizophagus irregularis DAOM 197198w
gb|KFG49381.1|  Smg-4/UPF3 family protein                             87.4    3e-16   Toxoplasma gondii p89
gb|KFG66380.1|  Smg-4/UPF3 family protein                             87.4    3e-16   Toxoplasma gondii RUB
gb|KFH02027.1|  Smg-4/UPF3 family protein                             87.4    3e-16   Toxoplasma gondii VAND
gb|KFG56382.1|  Smg-4/UPF3 family protein                             87.4    3e-16   Toxoplasma gondii FOU
gb|EPT25711.1|  Smg-4/UPF3 family protein                             87.4    3e-16   Toxoplasma gondii ME49
gb|EPR58795.1|  Smg-4/UPF3 family protein                             87.0    4e-16   Toxoplasma gondii GT1
gb|ELT94809.1|  hypothetical protein CAPTEDRAFT_137621                82.8    5e-16   Capitella teleta
ref|XP_010738428.1|  PREDICTED: regulator of nonsense transcripts 3A  86.3    5e-16   
gb|KFH73643.1|  hypothetical protein MVEG_00857                       85.5    5e-16   Mortierella verticillata NRRL 6337
ref|XP_006788210.1|  PREDICTED: regulator of nonsense transcripts...  85.9    6e-16   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010903995.1|  PREDICTED: regulator of nonsense transcripts...  86.3    6e-16   Esox lucius
ref|XP_010903997.1|  PREDICTED: regulator of nonsense transcripts...  86.3    6e-16   Esox lucius
gb|AAH95761.1|  Upf3a protein                                         83.2    6e-16   Danio rerio [leopard danio]
ref|XP_004695695.1|  PREDICTED: collagen alpha-1(I) chain-like        86.7    7e-16   
emb|CEG80205.1|  hypothetical protein RMATCC62417_14574               84.3    7e-16   Rhizopus microsporus
ref|XP_006909399.1|  PREDICTED: regulator of nonsense transcripts...  85.5    8e-16   
ref|XP_011377840.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  85.5    9e-16   
ref|XP_008280526.1|  PREDICTED: regulator of nonsense transcripts...  85.1    1e-15   
ref|XP_008280534.1|  PREDICTED: regulator of nonsense transcripts...  85.1    1e-15   
ref|XP_005935879.1|  PREDICTED: regulator of nonsense transcripts...  84.7    1e-15   
ref|XP_008280517.1|  PREDICTED: regulator of nonsense transcripts...  85.1    1e-15   
gb|KDQ56628.1|  hypothetical protein JAAARDRAFT_157752                85.5    1e-15   
ref|XP_005475492.1|  PREDICTED: regulator of nonsense transcripts...  85.1    1e-15   
ref|XP_003451599.1|  PREDICTED: regulator of nonsense transcripts...  84.7    1e-15   
ref|XP_005935877.1|  PREDICTED: regulator of nonsense transcripts...  84.7    1e-15   
ref|XP_004568016.1|  PREDICTED: regulator of nonsense transcripts...  84.7    1e-15   
ref|XP_004568014.1|  PREDICTED: regulator of nonsense transcripts...  84.7    1e-15   
ref|XP_005935878.1|  PREDICTED: regulator of nonsense transcripts...  84.7    1e-15   
ref|XP_005935876.1|  PREDICTED: regulator of nonsense transcripts...  84.7    2e-15   
ref|XP_004568015.1|  PREDICTED: regulator of nonsense transcripts...  84.7    2e-15   
dbj|BAB31954.1|  unnamed protein product                              82.4    2e-15   
ref|XP_004568013.1|  PREDICTED: regulator of nonsense transcripts...  84.7    2e-15   
emb|CDQ69277.1|  unnamed protein product                              85.9    2e-15   
ref|XP_011680225.1|  PREDICTED: regulator of nonsense transcripts 3A  81.6    2e-15   
gb|ACU18923.1|  unknown                                               78.2    3e-15   
ref|XP_008214123.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  84.7    3e-15   
gb|KDQ32779.1|  hypothetical protein PLEOSDRAFT_1073199               84.0    3e-15   
gb|KIM52552.1|  hypothetical protein SCLCIDRAFT_1223619               84.3    3e-15   
ref|XP_007227931.1|  PREDICTED: regulator of nonsense transcripts...  83.6    3e-15   
ref|XP_008326453.1|  PREDICTED: regulator of nonsense transcripts...  83.6    4e-15   
ref|XP_008326452.1|  PREDICTED: regulator of nonsense transcripts...  83.6    4e-15   
ref|XP_007227930.1|  PREDICTED: regulator of nonsense transcripts...  83.6    4e-15   
gb|KDQ17942.1|  hypothetical protein BOTBODRAFT_29260                 84.0    4e-15   
ref|XP_006639007.1|  PREDICTED: regulator of nonsense transcripts...  83.6    4e-15   
ref|XP_007196795.1|  PREDICTED: regulator of nonsense transcripts...  81.3    5e-15   
ref|XP_009550875.1|  hypothetical protein HETIRDRAFT_436258           83.2    6e-15   
ref|XP_008324683.1|  PREDICTED: regulator of nonsense transcripts...  82.8    7e-15   
gb|KIJ16461.1|  hypothetical protein PAXINDRAFT_10911                 82.8    8e-15   
ref|XP_006803274.1|  PREDICTED: regulator of nonsense transcripts...  81.3    8e-15   
gb|EPZ31303.1|  Nucleotide-binding, alpha-beta plait domain-conta...  79.7    1e-14   
ref|XP_008324684.1|  PREDICTED: regulator of nonsense transcripts...  82.4    1e-14   
ref|XP_006003919.1|  PREDICTED: regulator of nonsense transcripts...  82.4    1e-14   
ref|XP_001629977.1|  predicted protein                                77.4    1e-14   
ref|XP_006003920.1|  PREDICTED: regulator of nonsense transcripts...  82.0    1e-14   
ref|XP_007196794.1|  PREDICTED: regulator of nonsense transcripts...  80.5    2e-14   
ref|XP_008431428.1|  PREDICTED: regulator of nonsense transcripts...  81.3    2e-14   
gb|EJT52479.1|  hypothetical protein A1Q1_03995                       80.5    2e-14   
gb|EKD05159.1|  hypothetical protein A1Q2_00545                       80.5    2e-14   
ref|XP_007547253.1|  PREDICTED: regulator of nonsense transcripts...  81.3    2e-14   
ref|XP_007547251.1|  PREDICTED: regulator of nonsense transcripts...  81.3    2e-14   
ref|XP_011231589.1|  PREDICTED: regulator of nonsense transcripts 3A  81.6    2e-14   
ref|XP_007547252.1|  PREDICTED: regulator of nonsense transcripts...  81.3    2e-14   
ref|XP_008771638.1|  PREDICTED: regulator of nonsense transcripts...  80.9    2e-14   
ref|XP_011605288.1|  PREDICTED: regulator of nonsense transcripts 3A  81.3    2e-14   
ref|XP_007547250.1|  PREDICTED: regulator of nonsense transcripts...  81.3    2e-14   
gb|KIK61351.1|  hypothetical protein GYMLUDRAFT_58885                 81.6    2e-14   
ref|XP_005368937.1|  PREDICTED: regulator of nonsense transcripts...  81.3    2e-14   
ref|XP_005733842.1|  PREDICTED: regulator of nonsense transcripts...  80.9    2e-14   
ref|XP_007196793.1|  PREDICTED: regulator of nonsense transcripts...  80.9    2e-14   
ref|XP_008431434.1|  PREDICTED: regulator of nonsense transcripts...  81.3    3e-14   
ref|XP_005368938.1|  PREDICTED: regulator of nonsense transcripts...  81.3    3e-14   
emb|CAG07286.1|  unnamed protein product                              79.0    3e-14   
ref|XP_003445248.1|  PREDICTED: regulator of nonsense transcripts...  80.9    3e-14   
gb|KIP09958.1|  hypothetical protein PHLGIDRAFT_85906                 79.0    3e-14   
ref|XP_005167908.1|  PREDICTED: regulator of nonsense transcripts...  80.9    3e-14   
ref|XP_011501641.1|  PREDICTED: regulator of nonsense transcripts 3A  81.6    3e-14   
ref|XP_004073128.1|  PREDICTED: regulator of nonsense transcripts 3B  80.9    3e-14   
ref|NP_001189377.1|  regulator of nonsense transcripts 3A             80.9    3e-14   
ref|XP_005167907.1|  PREDICTED: regulator of nonsense transcripts...  80.9    3e-14   
ref|XP_005045964.1|  PREDICTED: regulator of nonsense transcripts 3B  79.7    4e-14   
ref|XP_008842329.1|  PREDICTED: regulator of nonsense transcripts...  80.9    4e-14   
gb|AAI21019.1|  UPF3B protein                                         78.2    4e-14   
ref|XP_008842338.1|  PREDICTED: regulator of nonsense transcripts...  80.5    4e-14   
ref|XP_006541457.1|  PREDICTED: regulator of nonsense transcripts...  80.9    4e-14   
gb|EFB18000.1|  hypothetical protein PANDA_015590                     79.7    4e-14   
ref|XP_011558669.1|  PREDICTED: regulator of nonsense transcripts 3B  80.5    4e-14   
ref|XP_005810870.1|  PREDICTED: regulator of nonsense transcripts...  80.5    4e-14   
ref|XP_005810871.1|  PREDICTED: regulator of nonsense transcripts...  80.5    4e-14   
ref|XP_005810868.1|  PREDICTED: regulator of nonsense transcripts...  80.5    5e-14   
ref|XP_005810869.1|  PREDICTED: regulator of nonsense transcripts...  80.5    5e-14   
ref|NP_080849.1|  regulator of nonsense transcripts 3B                80.5    5e-14   
ref|XP_006257517.1|  PREDICTED: regulator of nonsense transcripts...  80.5    5e-14   
ref|XP_004710123.1|  PREDICTED: regulator of nonsense transcripts...  80.5    5e-14   
ref|XP_004710124.1|  PREDICTED: regulator of nonsense transcripts...  80.5    5e-14   
gb|KIK82630.1|  hypothetical protein PAXRUDRAFT_153590                80.5    5e-14   
ref|XP_008827115.1|  PREDICTED: regulator of nonsense transcripts...  79.7    5e-14   
gb|EHB07949.1|  Regulator of nonsense transcripts 3B                  78.2    5e-14   
ref|XP_011576325.1|  PREDICTED: regulator of nonsense transcripts...  79.0    5e-14   
gb|KIY64156.1|  hypothetical protein CYLTODRAFT_402264                80.1    5e-14   
ref|NP_001129345.1|  regulator of nonsense transcripts 3B             80.1    5e-14   
gb|ENN72156.1|  hypothetical protein YQE_11213                        80.1    5e-14   
ref|XP_008326455.1|  PREDICTED: regulator of nonsense transcripts...  79.7    6e-14   
gb|EAW89843.1|  UPF3 regulator of nonsense transcripts homolog B ...  78.2    6e-14   
ref|XP_005083175.1|  PREDICTED: regulator of nonsense transcripts...  80.1    6e-14   
ref|XP_010730280.1|  PREDICTED: regulator of nonsense transcripts 3B  80.1    6e-14   
ref|XP_005083176.1|  PREDICTED: regulator of nonsense transcripts...  80.1    6e-14   
gb|EAX09249.1|  UPF3 regulator of nonsense transcripts homolog A ...  77.8    6e-14   
ref|XP_011533151.1|  PREDICTED: regulator of nonsense transcripts...  77.8    7e-14   
ref|XP_004672656.1|  PREDICTED: regulator of nonsense transcripts...  80.1    7e-14   
ref|XP_004672655.1|  PREDICTED: regulator of nonsense transcripts...  80.1    7e-14   
ref|XP_006993663.1|  PREDICTED: regulator of nonsense transcripts...  80.1    7e-14   
ref|XP_006993662.1|  PREDICTED: regulator of nonsense transcripts...  80.1    7e-14   
ref|XP_008638737.1|  PREDICTED: regulator of nonsense transcripts 3B  79.7    7e-14   
ref|XP_008274193.1|  PREDICTED: regulator of nonsense transcripts 3B  79.7    8e-14   
ref|XP_003641170.1|  PREDICTED: regulator of nonsense transcripts 3B  79.7    8e-14   
emb|CAG32693.1|  hypothetical protein RCJMB04_32p8                    79.7    8e-14   
ref|XP_004631262.1|  PREDICTED: regulator of nonsense transcripts 3A  79.3    8e-14   
dbj|BAC28207.1|  unnamed protein product                              77.0    9e-14   
ref|XP_006176815.1|  PREDICTED: regulator of nonsense transcripts 3A  79.3    9e-14   
gb|KIJ64775.1|  hypothetical protein HYDPIDRAFT_28135                 79.7    9e-14   
ref|XP_008683241.1|  PREDICTED: regulator of nonsense transcripts 3A  79.7    9e-14   
ref|XP_009556246.1|  PREDICTED: regulator of nonsense transcripts 3A  79.3    9e-14   
ref|XP_849752.2|  PREDICTED: regulator of nonsense transcripts 3A...  79.7    9e-14   
gb|EHB12834.1|  Regulator of nonsense transcripts 3B                  79.7    1e-13   
ref|XP_005266257.1|  PREDICTED: regulator of nonsense transcripts...  77.4    1e-13   
ref|NP_001040320.1|  Upf3 regulator of nonsense transcripts-like ...  79.7    1e-13   
ref|NP_001069879.1|  regulator of nonsense transcripts 3B             77.8    1e-13   
ref|XP_011581843.1|  PREDICTED: regulator of nonsense transcripts...  79.0    1e-13   
ref|XP_003706689.1|  PREDICTED: regulator of nonsense transcripts...  79.7    1e-13   
ref|XP_009953366.1|  PREDICTED: regulator of nonsense transcripts...  77.4    1e-13   
ref|XP_004872225.1|  PREDICTED: regulator of nonsense transcripts...  79.3    1e-13   
gb|KFQ13921.1|  Regulator of nonsense transcripts 3A                  77.0    1e-13   
ref|XP_010713774.1|  PREDICTED: regulator of nonsense transcripts 3B  79.0    1e-13   
ref|XP_005526268.1|  PREDICTED: regulator of nonsense transcripts 3B  79.3    1e-13   
ref|XP_004900219.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  79.3    1e-13   
ref|XP_011487599.1|  PREDICTED: regulator of nonsense transcripts...  79.0    1e-13   
emb|CAX18772.1|  UPF3 regulator of nonsense transcripts homolog A...  75.5    1e-13   
ref|XP_004872226.1|  PREDICTED: regulator of nonsense transcripts...  79.0    1e-13   
gb|EHJ71109.1|  Upf3 regulator of nonsense transcripts-like prote...  79.3    1e-13   
ref|XP_011533148.1|  PREDICTED: regulator of nonsense transcripts...  77.4    1e-13   
dbj|BAB30093.1|  unnamed protein product                              76.6    1e-13   
gb|ERE61331.1|  regulator of nonsense transcripts 3B-like protein     78.2    1e-13   
gb|KFB51374.1|  AGAP006649-PA-like protein                            79.7    1e-13   
ref|XP_011487598.1|  PREDICTED: regulator of nonsense transcripts...  79.0    1e-13   
ref|XP_009088614.1|  PREDICTED: regulator of nonsense transcripts 3B  79.0    1e-13   
ref|XP_005007180.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  78.6    2e-13   
ref|XP_006218264.1|  PREDICTED: regulator of nonsense transcripts 3A  78.6    2e-13   
ref|XP_009233484.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  77.4    2e-13   
ref|XP_005659004.1|  PREDICTED: regulator of nonsense transcripts...  78.6    2e-13   
ref|XP_006676092.1|  hypothetical protein BATDEDRAFT_84963            79.0    2e-13   
ref|XP_005484494.1|  PREDICTED: regulator of nonsense transcripts 3B  79.0    2e-13   
ref|XP_010573973.1|  PREDICTED: regulator of nonsense transcripts...  78.6    2e-13   
ref|XP_011581842.1|  PREDICTED: regulator of nonsense transcripts...  78.6    2e-13   
pdb|1UW4|A  Chain A, The Structural Basis Of The Interaction Betw...  73.6    2e-13   
gb|AAI58354.1|  upf3b protein                                         76.3    2e-13   
gb|KFO73940.1|  Regulator of nonsense transcripts 3A                  78.2    2e-13   
ref|XP_010573972.1|  PREDICTED: regulator of nonsense transcripts...  78.2    2e-13   
ref|XP_011581841.1|  PREDICTED: regulator of nonsense transcripts...  78.2    2e-13   
ref|XP_004621431.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  79.0    2e-13   
ref|XP_005299007.1|  PREDICTED: regulator of nonsense transcripts 3B  78.6    2e-13   
ref|XP_005420088.1|  PREDICTED: regulator of nonsense transcripts 3A  78.2    2e-13   
ref|XP_011348594.1|  PREDICTED: regulator of nonsense transcripts 3A  79.0    2e-13   
ref|XP_008827114.1|  PREDICTED: regulator of nonsense transcripts...  78.2    2e-13   
ref|XP_005488045.1|  PREDICTED: regulator of nonsense transcripts 3A  78.2    2e-13   
ref|XP_009083697.1|  PREDICTED: regulator of nonsense transcripts 3A  78.2    2e-13   
ref|XP_011576324.1|  PREDICTED: regulator of nonsense transcripts...  78.6    2e-13   
ref|XP_010567259.1|  PREDICTED: regulator of nonsense transcripts 3B  78.6    2e-13   
ref|XP_005151571.1|  PREDICTED: regulator of nonsense transcripts 3A  78.2    3e-13   
ref|XP_006822949.1|  PREDICTED: regulator of nonsense transcripts...  78.6    3e-13   
ref|XP_005913206.1|  PREDICTED: regulator of nonsense transcripts...  78.2    3e-13   
ref|XP_007610143.1|  PREDICTED: regulator of nonsense transcripts...  78.2    3e-13   
ref|XP_002593359.1|  hypothetical protein BRAFLDRAFT_70868            78.6    3e-13   
ref|XP_002161632.2|  PREDICTED: uncharacterized protein LOC100202729  78.6    3e-13   
ref|XP_008494601.1|  PREDICTED: regulator of nonsense transcripts 3A  78.2    3e-13   
ref|XP_011163835.1|  PREDICTED: regulator of nonsense transcripts 3A  78.2    3e-13   
ref|XP_010591894.1|  PREDICTED: regulator of nonsense transcripts...  76.6    3e-13   
ref|XP_005722959.1|  PREDICTED: regulator of nonsense transcripts...  78.2    3e-13   
ref|XP_011804102.1|  PREDICTED: regulator of nonsense transcripts 3B  77.0    3e-13   
ref|XP_002192806.2|  PREDICTED: regulator of nonsense transcripts 3A  78.2    3e-13   
ref|XP_010573971.1|  PREDICTED: regulator of nonsense transcripts...  78.2    3e-13   
ref|XP_006268616.1|  PREDICTED: regulator of nonsense transcripts 3A  78.2    3e-13   
ref|XP_011303993.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  78.6    3e-13   
ref|XP_004545823.1|  PREDICTED: regulator of nonsense transcripts...  77.8    3e-13   
ref|XP_011581840.1|  PREDICTED: regulator of nonsense transcripts...  78.2    3e-13   
ref|XP_007638940.1|  PREDICTED: regulator of nonsense transcripts...  77.8    3e-13   
ref|XP_007610142.1|  PREDICTED: regulator of nonsense transcripts...  77.8    3e-13   
ref|XP_007610144.1|  PREDICTED: regulator of nonsense transcripts...  77.8    4e-13   
ref|XP_009247103.1|  PREDICTED: regulator of nonsense transcripts...  77.0    4e-13   
ref|XP_009324538.1|  PREDICTED: regulator of nonsense transcripts...  77.0    4e-13   
ref|XP_003250077.1|  PREDICTED: regulator of nonsense transcripts...  78.2    4e-13   
ref|XP_416933.2|  PREDICTED: regulator of nonsense transcripts 3A     77.8    4e-13   
ref|XP_006612476.1|  PREDICTED: regulator of nonsense transcripts...  78.2    4e-13   
ref|XP_007869712.1|  hypothetical protein GLOTRDRAFT_123003           77.0    4e-13   
ref|XP_009274368.1|  PREDICTED: regulator of nonsense transcripts...  76.6    5e-13   
ref|XP_008142232.1|  PREDICTED: regulator of nonsense transcripts 3A  77.4    5e-13   
ref|XP_009074647.1|  PREDICTED: regulator of nonsense transcripts 3A  77.4    5e-13   
ref|XP_011630833.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  77.8    5e-13   
ref|XP_005366306.1|  PREDICTED: regulator of nonsense transcripts 3A  76.3    5e-13   
ref|XP_007466431.1|  PREDICTED: regulator of nonsense transcripts 3A  77.4    5e-13   
ref|XP_004365162.1|  hypothetical protein CAOG_00291                  77.4    5e-13   
gb|KFO85250.1|  Regulator of nonsense transcripts 3A                  77.0    5e-13   
ref|XP_009274367.1|  PREDICTED: regulator of nonsense transcripts...  76.6    6e-13   
ref|XP_009324537.1|  PREDICTED: regulator of nonsense transcripts...  76.6    6e-13   
gb|EMD37045.1|  hypothetical protein CERSUDRAFT_95309                 77.4    6e-13   
gb|EHH31036.1|  Nonsense mRNA reducing factor 3B                      77.0    6e-13   
ref|XP_008468950.1|  PREDICTED: regulator of nonsense transcripts...  75.9    6e-13   
ref|XP_006884026.1|  PREDICTED: regulator of nonsense transcripts 3A  76.3    6e-13   
ref|XP_011861506.1|  PREDICTED: regulator of nonsense transcripts 3A  77.4    7e-13   
ref|XP_005516633.1|  PREDICTED: regulator of nonsense transcripts 3A  77.0    7e-13   
ref|XP_007002827.1|  hypothetical protein TREMEDRAFT_60453            76.6    7e-13   
gb|KFP26474.1|  Regulator of nonsense transcripts 3A                  76.3    7e-13   
ref|XP_006508923.1|  PREDICTED: regulator of nonsense transcripts...  76.3    7e-13   
gb|KFZ62679.1|  Regulator of nonsense transcripts 3A                  76.3    7e-13   
gb|KFV01435.1|  Regulator of nonsense transcripts 3A                  76.6    7e-13   
gb|EMC84924.1|  Regulator of nonsense transcripts 3A                  76.3    7e-13   
gb|KFP98881.1|  Regulator of nonsense transcripts 3A                  76.3    8e-13   
gb|KFV66008.1|  Regulator of nonsense transcripts 3A                  76.3    8e-13   
ref|XP_007902641.1|  PREDICTED: regulator of nonsense transcripts...  76.6    8e-13   
ref|XP_004577654.1|  PREDICTED: regulator of nonsense transcripts 3A  75.9    8e-13   
ref|XP_005410488.1|  PREDICTED: regulator of nonsense transcripts...  76.6    8e-13   
ref|XP_005295966.1|  PREDICTED: regulator of nonsense transcripts...  76.6    8e-13   
gb|KFQ76887.1|  Regulator of nonsense transcripts 3A                  76.3    8e-13   
gb|KFQ19617.1|  Regulator of nonsense transcripts 3A                  76.3    8e-13   
ref|XP_004092554.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  76.6    8e-13   
ref|XP_006277435.1|  PREDICTED: regulator of nonsense transcripts 3B  76.6    8e-13   
gb|KFZ54071.1|  Regulator of nonsense transcripts 3A                  76.3    8e-13   
gb|KFP83156.1|  Regulator of nonsense transcripts 3A                  76.3    8e-13   
gb|KFO60811.1|  Regulator of nonsense transcripts 3A                  76.3    9e-13   
ref|XP_005673918.1|  PREDICTED: regulator of nonsense transcripts...  76.6    9e-13   
gb|KFW82906.1|  Regulator of nonsense transcripts 3A                  76.3    9e-13   
gb|KFQ85454.1|  Regulator of nonsense transcripts 3A                  76.3    9e-13   
ref|XP_011962847.1|  PREDICTED: regulator of nonsense transcripts...  76.6    9e-13   
gb|KFV54761.1|  Regulator of nonsense transcripts 3A                  76.3    9e-13   
ref|XP_009663817.1|  PREDICTED: regulator of nonsense transcripts 3A  76.6    9e-13   
gb|KFU89802.1|  Regulator of nonsense transcripts 3A                  76.3    9e-13   
ref|XP_010793255.1|  PREDICTED: regulator of nonsense transcripts...  76.6    9e-13   



>ref|XP_009775100.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana sylvestris]
Length=508

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+VLRHLPP + +S L EQ+ SRF+GRY+W SFRPGK+SQKHQ YSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVVSRFTGRYNWFSFRPGKSSQKHQTYSRAYVDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QRAP++WSKKDGREG ILKDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRAPKRWSKKDGREGTILKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP+  LP
Sbjct  121  FLEFIAKPIENLP  133



>emb|CDO97628.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+VLRHLPP++ +S+L +Q+++RFSGRY+W+SFRPGKTSQK Q YSRAYI+F
Sbjct  1    MKGPLDRTKVVLRHLPPSISQSSLMDQVETRFSGRYNWVSFRPGKTSQKRQSYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKT+VEY P QR P+QWSKKDGREG ILKDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTVVEYGPSQRVPKQWSKKDGREGTILKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>ref|XP_009587503.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=508

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+VLRHLPP + +S L EQ+ SRF+GRY+W SFRPGK+SQKHQ YSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVLSRFTGRYNWFSFRPGKSSQKHQTYSRAYVDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QRAP++WSKKDGREG ILKDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRAPKRWSKKDGREGTILKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP+  LP
Sbjct  121  FLEFIAKPIENLP  133



>gb|KDO41302.1| hypothetical protein CISIN_1g0102241mg, partial [Citrus sinensis]
 gb|KDO41303.1| hypothetical protein CISIN_1g0102241mg, partial [Citrus sinensis]
Length=260

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+V+R+LPPA+ +   +EQID  F GRY+W+SFR GKTSQKHQ  +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFVNEKG QFKTIVEYAP QR P+QWSKKDGREG +LKDPEYLE
Sbjct  61   KKPEDVLEFAEFFNGHVFVNEKGVQFKTIVEYAPSQRVPKQWSKKDGREGTLLKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KPV  LP
Sbjct  121  FLEFISKPVENLP  133



>ref|XP_006349314.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Solanum 
tuberosum]
Length=483

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDR+K+VLRHLPP + +S L +Q+DSRF+GRY+W  F PGK+SQKHQ YSRAYI F
Sbjct  1    MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRFAGRYNWFCFLPGKSSQKHQTYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ WSKKDGREG ILKDPEYLE
Sbjct  61   KMPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRVPKHWSKKDGREGTILKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP+  LP
Sbjct  121  FLEFISKPIENLP  133



>ref|XP_011088114.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=515

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+VLRHLPP + +S L E +DSRF GRY WL FRPGK+S KH  YSRAYI+F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSNLVEHVDSRFVGRYLWLVFRPGKSSLKHPKYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV+EFAEFFNGHVFVNEKGSQFKTIVEYAP QR P+QWSKKDGREG ILKDPEYLE
Sbjct  61   NKPEDVIEFAEFFNGHVFVNEKGSQFKTIVEYAPSQRVPKQWSKKDGREGTILKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KP+  LP
Sbjct  121  FLEFLAKPIENLP  133



>ref|XP_011092289.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092290.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092291.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=518

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+VLRHLPP + +S L + +DSRFSGRY W +FRPGK+SQKH  YSRAYI+F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSNLFDHVDSRFSGRYRWSAFRPGKSSQKHLTYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV+EFAEFFNGHVFVNEKG+QFK IVEYAP QR P+QWSKKDGREG ILKDPEYLE
Sbjct  61   NRPEDVLEFAEFFNGHVFVNEKGTQFKAIVEYAPSQRVPKQWSKKDGREGTILKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>ref|XP_004230442.1| PREDICTED: regulator of nonsense transcripts UPF3 [Solanum lycopersicum]
Length=485

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDR+K+VLRHLPP + +S L +Q+DSRF+GRY+W  F PGK+SQKHQ YSRAYI F
Sbjct  1    MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRFAGRYNWFCFLPGKSSQKHQTYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ WSKKDGREG ILKDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRVPQHWSKKDGREGTILKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP+  LP
Sbjct  121  FLEFISKPIENLP  133



>ref|XP_009775092.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana sylvestris]
Length=517

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 9/142 (6%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKT---------SQKHQ  414
            MKGPLDRTK+VLRHLPP + +S L EQ+ SRF+GRY+W SFRPGK+         SQKHQ
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVVSRFTGRYNWFSFRPGKSRPSPQIFSCSQKHQ  60

Query  415  PYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGA  594
             YSRAY++FK PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QRAP++WSKKDGREG 
Sbjct  61   TYSRAYVDFKRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRAPKRWSKKDGREGT  120

Query  595  ILKDPEYLEFLEFIGKPVVYLP  660
            ILKDPEYLEFLEFI KP+  LP
Sbjct  121  ILKDPEYLEFLEFIAKPIENLP  142



>ref|XP_009587502.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=517

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 9/142 (6%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKT---------SQKHQ  414
            MKGPLDRTK+VLRHLPP + +S L EQ+ SRF+GRY+W SFRPGK+         SQKHQ
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVLSRFTGRYNWFSFRPGKSRPSPQIFSCSQKHQ  60

Query  415  PYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGA  594
             YSRAY++FK PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QRAP++WSKKDGREG 
Sbjct  61   TYSRAYVDFKRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRAPKRWSKKDGREGT  120

Query  595  ILKDPEYLEFLEFIGKPVVYLP  660
            ILKDPEYLEFLEFI KP+  LP
Sbjct  121  ILKDPEYLEFLEFIAKPIENLP  142



>ref|XP_006431585.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
 gb|ESR44825.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
Length=514

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+V+R+LPPA+ +   +EQID  F GRY+W+SFR GKTSQKHQ  +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFVNEKG QFKTIVEYAP QR P+QWSKKDGREG +LKDPEYLE
Sbjct  61   KKPEDVLEFAEFFNGHVFVNEKGVQFKTIVEYAPSQRVPKQWSKKDGREGTLLKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KPV  LP
Sbjct  121  FLEFISKPVENLP  133



>ref|XP_007041200.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97031.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
Length=514

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPPA+  + L EQ+D+ FSGRY+WLSFRPGK+SQKHQ YSRAYI+F
Sbjct  1    MKGALDRTKVILRHLPPAITEAMLVEQVDTAFSGRYNWLSFRPGKSSQKHQSYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K  EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP QR P++ SKKDGREG ILKD EYLE
Sbjct  61   KRSEDVLEFAEFFNGHVFVNEKGTQFKTIVEYAPSQRVPKRSSKKDGREGTILKDLEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE +GKPV  LP
Sbjct  121  FLECLGKPVENLP  133



>ref|XP_006492554.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Citrus 
sinensis]
Length=514

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+V+R+LPPA+ +   +EQID  F GRY+W+SFR GKTSQKHQ  +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFVNEKG QFKTIVEYAP QR P+QWSKKDGREG +LKDPEYLE
Sbjct  61   KKPEDVLEFAEFFNGHVFVNEKGVQFKTIVEYAPSQRVPKQWSKKDGREGTLLKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KPV  LP
Sbjct  121  FLEFISKPVENLP  133



>gb|EYU26453.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=522

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG +DRTK+VLRHLPP + +S L E +DSRFSGRY WL+FRPGK+S +   YSRAYI+F
Sbjct  1    MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRFSGRYGWLAFRPGKSSPRQPIYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
             TPEDV+EFAEFFNGH+FVNEKG+QFK IVEYAP QR P+QWSKKDGR+G +LKDPEYLE
Sbjct  61   NTPEDVIEFAEFFNGHIFVNEKGTQFKAIVEYAPSQRVPKQWSKKDGRDGTLLKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KPVV LP
Sbjct  121  FLEFIAKPVVNLP  133



>gb|EYU26454.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=521

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG +DRTK+VLRHLPP + +S L E +DSRFSGRY WL+FRPGK+S +   YSRAYI+F
Sbjct  1    MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRFSGRYGWLAFRPGKSSPRQPIYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
             TPEDV+EFAEFFNGH+FVNEKG+QFK IVEYAP QR P+QWSKKDGR+G +LKDPEYLE
Sbjct  61   NTPEDVIEFAEFFNGHIFVNEKGTQFKAIVEYAPSQRVPKQWSKKDGRDGTLLKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KPVV LP
Sbjct  121  FLEFIAKPVVNLP  133



>ref|XP_010246764.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X5 
[Nelumbo nucifera]
Length=575

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+VLRHLPP L +S L+EQID RF+GRY W+ FR GK SQKHQ YSRAYI+F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNEKGSQFKTIVEYAP QR  + WSKKDGREG I KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKGSQFKTIVEYAPSQRVAKSWSKKDGREGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLDLISKPVENLP  133



>ref|XP_010246762.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Nelumbo nucifera]
Length=585

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+VLRHLPP L +S L+EQID RF+GRY W+ FR GK SQKHQ YSRAYI+F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNEKGSQFKTIVEYAP QR  + WSKKDGREG I KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKGSQFKTIVEYAPSQRVAKSWSKKDGREGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLDLISKPVENLP  133



>ref|XP_010246761.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Nelumbo nucifera]
Length=602

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+VLRHLPP L +S L+EQID RF+GRY W+ FR GK SQKHQ YSRAYI+F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNEKGSQFKTIVEYAP QR  + WSKKDGREG I KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKGSQFKTIVEYAPSQRVAKSWSKKDGREGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLDLISKPVENLP  133



>ref|XP_010246760.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Nelumbo nucifera]
Length=612

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+VLRHLPP L +S L+EQID RF+GRY W+ FR GK SQKHQ YSRAYI+F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNEKGSQFKTIVEYAP QR  + WSKKDGREG I KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKGSQFKTIVEYAPSQRVAKSWSKKDGREGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLDLISKPVENLP  133



>gb|KCW57140.1| hypothetical protein EUGRSUZ_I02778 [Eucalyptus grandis]
Length=479

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG  DRTK+VLRHLPP++    L++QID+ F+GRY+W SFRPGKTS KHQ YSRAYINF
Sbjct  1    MKGHPDRTKVVLRHLPPSITEGMLADQIDTAFAGRYNWFSFRPGKTSLKHQVYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF GHVFVNEKG+ FKTIVEYAP QR P+Q SKKDGREG I+KDPEYLE
Sbjct  61   KRPEDVIEFAEFFEGHVFVNEKGTHFKTIVEYAPSQRLPKQTSKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KPV  LP
Sbjct  121  FLEFIAKPVENLP  133



>ref|XP_010030190.1| PREDICTED: regulator of nonsense transcripts UPF3 [Eucalyptus 
grandis]
 gb|KCW57141.1| hypothetical protein EUGRSUZ_I02778 [Eucalyptus grandis]
Length=486

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG  DRTK+VLRHLPP++    L++QID+ F+GRY+W SFRPGKTS KHQ YSRAYINF
Sbjct  1    MKGHPDRTKVVLRHLPPSITEGMLADQIDTAFAGRYNWFSFRPGKTSLKHQVYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF GHVFVNEKG+ FKTIVEYAP QR P+Q SKKDGREG I+KDPEYLE
Sbjct  61   KRPEDVIEFAEFFEGHVFVNEKGTHFKTIVEYAPSQRLPKQTSKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KPV  LP
Sbjct  121  FLEFIAKPVENLP  133



>gb|KJB47868.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47870.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=468

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  128  FLEFLAKPVENLP  140



>gb|KJB47864.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=485

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  128  FLEFLAKPVENLP  140



>ref|XP_006598794.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006598795.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN39677.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=512

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK+VLRHLPP++  + L  QID+ F+GRY+WLSFRPGK SQKH  YSRAYI+F
Sbjct  1    MKGALDRTKVVLRHLPPSISEAALLAQIDAAFAGRYNWLSFRPGKISQKHISYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+ FAEFFNGHVFVNEKGSQFK IVEYAP QR PRQWSKKDGR+G I KD EYLE
Sbjct  61   KRPEDVILFAEFFNGHVFVNEKGSQFKVIVEYAPSQRVPRQWSKKDGRDGTIYKDSEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KPV  LP
Sbjct  121  FLELLAKPVENLP  133



>gb|KJB47855.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47857.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=508

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  1    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  61   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>gb|KJB47856.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47858.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=509

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  1    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  61   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>gb|KJB47866.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=509

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  128  FLEFLAKPVENLP  140



>gb|KJB47867.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=511

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  128  FLEFLAKPVENLP  140



>gb|KJB47860.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47862.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47865.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=515

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  128  FLEFLAKPVENLP  140



>gb|KJB47859.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47861.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47869.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=516

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+S KDGREG I KDPEYLE
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSNKDGREGTISKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  128  FLEFLAKPVENLP  140



>ref|XP_007041201.1| Smg-4/UPF3 family protein, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOX97032.1| Smg-4/UPF3 family protein, putative isoform 2, partial [Theobroma 
cacao]
Length=440

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 116/140 (83%), Gaps = 7/140 (5%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPPA+  + L EQ+D+ FSGRY+WLSFRPGK+SQKHQ YSRAYI+F
Sbjct  1    MKGALDRTKVILRHLPPAITEAMLVEQVDTAFSGRYNWLSFRPGKSSQKHQSYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILK------  603
            K  EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP QR P++ SKKDGREG ILK      
Sbjct  61   KRSEDVLEFAEFFNGHVFVNEKGTQFKTIVEYAPSQRVPKRSSKKDGREGTILKVFLDEH  120

Query  604  -DPEYLEFLEFIGKPVVYLP  660
             D EYLEFLE +GKPV  LP
Sbjct  121  LDLEYLEFLECLGKPVENLP  140



>gb|KHF99019.1| upf3a [Gossypium arboreum]
Length=577

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK++LRHLPP++  S L EQ+DS FSGRY+WLSFRPGK+SQK+  YSRAY++F
Sbjct  8    MKGTLDRTKVILRHLPPSITESVLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFFNGHVFV+EKG+QFK +VEYAP QR P+Q+SKKDGREG I KDPEYLE
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKGAQFKAVVEYAPSQRVPKQFSKKDGREGTISKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  128  FLEFLEKPVENLP  140



>ref|XP_009786002.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Nicotiana 
sylvestris]
Length=469

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+V+RHLPP L +STL EQ+DSRF+GRY+W +FRPGKTS KHQ YSRAYI+F+  EDV
Sbjct  5    RTKVVVRHLPPTLSQSTLLEQVDSRFAGRYNWFTFRPGKTSLKHQSYSRAYIDFRNTEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
            +EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ WSKKD RE  ILKDPEYLEFLEF+ 
Sbjct  65   IEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRVPKHWSKKDAREATILKDPEYLEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_007148572.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 ref|XP_007148573.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20566.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20567.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
Length=513

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK+VLRHLPP+L  + L  QIDS F+ RY+WLSFRP K SQKH  YSRAYI+F
Sbjct  1    MKGSLDRTKVVLRHLPPSLSEAALLAQIDSAFADRYNWLSFRPAKVSQKHISYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K P+DV+ FAEFFNGHVFVNEKGSQFK IVEYAP QR PRQWSKKDGR+G I KD EYLE
Sbjct  61   KRPDDVILFAEFFNGHVFVNEKGSQFKVIVEYAPSQRVPRQWSKKDGRDGTIYKDSEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KPV  LP
Sbjct  121  FLELLAKPVENLP  133



>ref|XP_009587163.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+V+RHLPP L +STL EQ+DSRF+GRY+W +FRPGKTS KHQ YSR YI+F+  EDV
Sbjct  5    RTKVVVRHLPPTLSQSTLLEQVDSRFAGRYNWFTFRPGKTSLKHQSYSRVYIDFRNTEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
            +EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ WSKKD RE  ILKDPEYLEFLEF+ 
Sbjct  65   IEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRVPKHWSKKDAREATILKDPEYLEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_009404844.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=467

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+V+RHLPPA+ +S L EQID RF+GRY W+ FRPGK SQK Q +SRAY+NF
Sbjct  1    MKDPPDRTKVVMRHLPPAISQSVLMEQIDGRFAGRYDWVCFRPGKNSQKDQIHSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDVVEFAEFF+GH+FVNEKG+QFK +VEYAP Q+ P  WSKKDGREG I KDPEY+E
Sbjct  61   NNPEDVVEFAEFFDGHIFVNEKGAQFKALVEYAPSQQVPNIWSKKDGREGTISKDPEYME  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KPV +LP
Sbjct  121  FLELISKPVEHLP  133



>ref|XP_011047883.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
 ref|XP_011047884.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=518

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  268  GPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKT  447
            G  D+TK+V+RHLPP + +    EQID  FSGRY+WLSFRPGK+SQKHQ  SRAYI+FK 
Sbjct  4    GQSDKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKR  63

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
            P+DV++FAEFFNGH+FVNEKG+QFK IVEYAP Q  P+QWSKKDGREG ILKDPEYLEFL
Sbjct  64   PDDVIDFAEFFNGHLFVNEKGTQFKAIVEYAPSQHVPKQWSKKDGREGTILKDPEYLEFL  123

Query  628  EFIGKPVVYLP  660
            EFI KPV  LP
Sbjct  124  EFIAKPVENLP  134



>ref|XP_011047887.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Populus euphratica]
Length=510

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  268  GPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKT  447
            G  D+TK+V+RHLPP + +    EQID  FSGRY+WLSFRPGK+SQKHQ  SRAYI+FK 
Sbjct  4    GQSDKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKR  63

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
            P+DV++FAEFFNGH+FVNEKG+QFK IVEYAP Q  P+QWSKKDGREG ILKDPEYLEFL
Sbjct  64   PDDVIDFAEFFNGHLFVNEKGTQFKAIVEYAPSQHVPKQWSKKDGREGTILKDPEYLEFL  123

Query  628  EFIGKPVVYLP  660
            EFI KPV  LP
Sbjct  124  EFIAKPVENLP  134



>ref|XP_009355335.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=485

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK+VLRHLPP++ ++ L EQID  F+GRY+W++FRPGK SQK+Q YSRAYI+ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDVFFAGRYNWVAFRPGKRSQKNQSYSRAYIDL  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K P+DV +FAEFF+GH+FVNEKGSQFK IVEYAP QR P+ WSKKDGREG I +DPEYLE
Sbjct  62   KRPDDVFDFAEFFDGHLFVNEKGSQFKVIVEYAPSQRVPKHWSKKDGREGTIFRDPEYLE  121

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP   LP
Sbjct  122  FLEFIAKPAENLP  134



>ref|XP_011047886.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Populus euphratica]
Length=511

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  268  GPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKT  447
            G  D+TK+V+RHLPP + +    EQID  FSGRY+WLSFRPGK+SQKHQ  SRAYI+FK 
Sbjct  4    GQSDKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKR  63

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
            P+DV++FAEFFNGH+FVNEKG+QFK IVEYAP Q  P+QWSKKDGREG ILKDPEYLEFL
Sbjct  64   PDDVIDFAEFFNGHLFVNEKGTQFKAIVEYAPSQHVPKQWSKKDGREGTILKDPEYLEFL  123

Query  628  EFIGKPVVYLP  660
            EFI KPV  LP
Sbjct  124  EFIAKPVENLP  134



>ref|XP_011047885.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=517

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  268  GPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKT  447
            G  D+TK+V+RHLPP + +    EQID  FSGRY+WLSFRPGK+SQKHQ  SRAYI+FK 
Sbjct  4    GQSDKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKR  63

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
            P+DV++FAEFFNGH+FVNEKG+QFK IVEYAP Q  P+QWSKKDGREG ILKDPEYLEFL
Sbjct  64   PDDVIDFAEFFNGHLFVNEKGTQFKAIVEYAPSQHVPKQWSKKDGREGTILKDPEYLEFL  123

Query  628  EFIGKPVVYLP  660
            EFI KPV  LP
Sbjct  124  EFIAKPVENLP  134



>ref|XP_009355334.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=495

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK+VLRHLPP++ ++ L EQID  F+GRY+W++FRPGK SQK+Q YSRAYI+ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDVFFAGRYNWVAFRPGKRSQKNQSYSRAYIDL  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K P+DV +FAEFF+GH+FVNEKGSQFK IVEYAP QR P+ WSKKDGREG I +DPEYLE
Sbjct  62   KRPDDVFDFAEFFDGHLFVNEKGSQFKVIVEYAPSQRVPKHWSKKDGREGTIFRDPEYLE  121

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP   LP
Sbjct  122  FLEFIAKPAENLP  134



>ref|XP_008218705.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Prunus 
mume]
Length=492

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            +K  LDRTK+VLRHLPP++ +++L EQID  FSGRY+W++FRPGK SQK+  YSRAYI+ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNEKGSQFK IVEYAP QR P+QWSKKDGREG I +DPEYLE
Sbjct  62   KRPEDVIEFAEFFDGHLFVNEKGSQFKVIVEYAPSQRVPKQWSKKDGREGTIFRDPEYLE  121

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KP   LP
Sbjct  122  FLEFLAKPAENLP  134



>ref|XP_007221816.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
 gb|EMJ23015.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
Length=485

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            +K  LDRTK+VLRHLPP++ +++L EQID  FSGRY+W++FRPGK SQK+  YSRAYI+ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNEKGSQFK IVEYAP QR P+QWSKKDGREG I +DPEYLE
Sbjct  62   KRPEDVIEFAEFFDGHLFVNEKGSQFKVIVEYAPSQRVPKQWSKKDGREGTIFRDPEYLE  121

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KP   LP
Sbjct  122  FLEFLAKPAENLP  134



>ref|XP_006385052.1| Smg-4/UPF3 family protein [Populus trichocarpa]
 gb|ERP62849.1| Smg-4/UPF3 family protein [Populus trichocarpa]
Length=527

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++  G  D+TK+V+RHLPP + +    EQID  FSGRY+WLS+RPG  SQKHQ YSRAYI
Sbjct  1    MKGGGQSDKTKVVVRHLPPGISQPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK PEDV++FAEFFNGH+FVNEKG+QFK IVEY+P QR P+QWSKKDGREG I KDPEY
Sbjct  61   DFKRPEDVIDFAEFFNGHIFVNEKGTQFKAIVEYSPSQRVPKQWSKKDGREGTISKDPEY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFLE I KPV  LP
Sbjct  121  LEFLELIAKPVENLP  135



>ref|XP_009353786.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009353787.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009353789.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK+VLRHLPP++ ++ L EQID  F+GRY W++FRPGK SQK+Q YSRAYI+ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDGFFAGRYSWVAFRPGKKSQKNQSYSRAYIDL  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GH+FVNEKG QFK IVEYAP QR P  WSKKDGREG I +DPEYLE
Sbjct  62   KRPEDVFEFAEFFDGHLFVNEKGGQFKVIVEYAPSQRVPEHWSKKDGREGTIFRDPEYLE  121

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP   LP
Sbjct  122  FLEFIAKPAENLP  134



>ref|XP_006385051.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
 gb|ERP62848.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
Length=520

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++  G  D+TK+V+RHLPP + +    EQID  FSGRY+WLS+RPG  SQKHQ YSRAYI
Sbjct  1    MKGGGQSDKTKVVVRHLPPGISQPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK PEDV++FAEFFNGH+FVNEKG+QFK IVEY+P QR P+QWSKKDGREG I KDPEY
Sbjct  61   DFKRPEDVIDFAEFFNGHIFVNEKGTQFKAIVEYSPSQRVPKQWSKKDGREGTISKDPEY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFLE I KPV  LP
Sbjct  121  LEFLELIAKPVENLP  135



>ref|XP_007221815.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
 gb|EMJ23014.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
Length=482

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            +K  LDRTK+VLRHLPP++ +++L EQID  FSGRY+W++FRPGK SQK+  YSRAYI+ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNEKGSQFK IVEYAP QR P+QWSKKDGREG I +DPEYLE
Sbjct  62   KRPEDVIEFAEFFDGHLFVNEKGSQFKVIVEYAPSQRVPKQWSKKDGREGTIFRDPEYLE  121

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KP   LP
Sbjct  122  FLEFLAKPAENLP  134



>ref|XP_006592654.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006592655.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN31598.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=514

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG LDRTK+VLRHLPP++  + L  QID+ F+GRY+WLSFRPGK SQKH  +SRAYI+F
Sbjct  1    MKGALDRTKVVLRHLPPSISEAALLSQIDAAFAGRYNWLSFRPGKISQKHMSFSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+ FAEFFNGHVFVN KGSQFK IVEYAP QR PRQWSKKD R+G I KD EYLE
Sbjct  61   KRPEDVILFAEFFNGHVFVNVKGSQFKVIVEYAPSQRVPRQWSKKDLRDGTIYKDSEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KPV  LP
Sbjct  121  FLELLAKPVENLP  133



>ref|XP_006389505.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
 gb|ERP48419.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
Length=511

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  268  GPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKT  447
            G  D+TK+V+RHLPP + +    EQID  FSGRY+WLS+RPGK+SQKHQ  SRAYI+FK 
Sbjct  4    GQSDKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSYRPGKSSQKHQSCSRAYIDFKR  63

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
            P+DV++FAEFFNGH+FVNEKG+QFK IVEYAP Q  P+QWSKKDGREG ILKDPEYLEFL
Sbjct  64   PDDVIDFAEFFNGHLFVNEKGTQFKAIVEYAPSQHVPKQWSKKDGREGTILKDPEYLEFL  123

Query  628  EFIGKPVVYLP  660
            EFI KPV  LP
Sbjct  124  EFIAKPVENLP  134



>ref|XP_011028362.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=521

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++  G  D+TK+V+RHLPP + +    EQID  FSGRY+WLS+RPG  SQKHQ YSRAYI
Sbjct  1    MKGGGQSDKTKVVVRHLPPGISKPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK PEDV++FAEFFNGH+FVNEKG+QFK IVEY+P QR P+QWSKKDGREG ILKDPEY
Sbjct  61   DFKRPEDVIDFAEFFNGHLFVNEKGTQFKAIVEYSPSQRVPKQWSKKDGREGTILKDPEY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEF E I KPV  LP
Sbjct  121  LEFHELIEKPVENLP  135



>ref|XP_011028363.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=520

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++  G  D+TK+V+RHLPP + +    EQID  FSGRY+WLS+RPG  SQKHQ YSRAYI
Sbjct  1    MKGGGQSDKTKVVVRHLPPGISKPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK PEDV++FAEFFNGH+FVNEKG+QFK IVEY+P QR P+QWSKKDGREG ILKDPEY
Sbjct  61   DFKRPEDVIDFAEFFNGHLFVNEKGTQFKAIVEYSPSQRVPKQWSKKDGREGTILKDPEY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEF E I KPV  LP
Sbjct  121  LEFHELIEKPVENLP  135



>ref|XP_011628613.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Amborella trichopoda]
Length=600

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PLDRTK+V+R LPPAL +  L E+IDSRFSGRY W +FRPGK S K+Q +SR YI+F
Sbjct  1    MKDPLDRTKVVVRRLPPALTQQALMEKIDSRFSGRYEWAAFRPGKNSLKNQRHSRIYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF GHVFVNEKGSQFK +VEYAP QR P+ WSKKDGREG I KDPEYLE
Sbjct  61   KRPEDVLEFAEFFVGHVFVNEKGSQFKAVVEYAPSQRVPKPWSKKDGREGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KP   LP
Sbjct  121  FLEFLAKPAENLP  133



>ref|XP_006858584.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Amborella trichopoda]
 gb|ERN20051.1| hypothetical protein AMTR_s00071p00188270 [Amborella trichopoda]
Length=599

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PLDRTK+V+R LPPAL +  L E+IDSRFSGRY W +FRPGK S K+Q +SR YI+F
Sbjct  1    MKDPLDRTKVVVRRLPPALTQQALMEKIDSRFSGRYEWAAFRPGKNSLKNQRHSRIYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF GHVFVNEKGSQFK +VEYAP QR P+ WSKKDGREG I KDPEYLE
Sbjct  61   KRPEDVLEFAEFFVGHVFVNEKGSQFKAVVEYAPSQRVPKPWSKKDGREGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KP   LP
Sbjct  121  FLEFLAKPAENLP  133



>ref|XP_002526435.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35930.1| conserved hypothetical protein [Ricinus communis]
Length=472

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  268  GPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKT  447
            G  ++TK+V+RHLPP + + +  EQID  FSGRY+W+SFRPGK+SQKHQ YSRAYI+FK 
Sbjct  4    GQAEKTKVVVRHLPPTISQGSFLEQIDVVFSGRYNWVSFRPGKSSQKHQSYSRAYIDFKR  63

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
            PEDV+EFAEFFNGH+FVNEKG+QF+ IVEYAP Q  P+QWSKKDGREG I+KDP YLEFL
Sbjct  64   PEDVIEFAEFFNGHLFVNEKGTQFRAIVEYAPSQHVPKQWSKKDGREGTIVKDPAYLEFL  123

Query  628  EFIGKPVVYLP  660
            E I KP   LP
Sbjct  124  ELISKPAENLP  134



>ref|XP_012066695.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Jatropha curcas]
 gb|KDP42459.1| hypothetical protein JCGZ_00256 [Jatropha curcas]
Length=510

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG  ++TK+V+RHLPP + +    EQI+  F+GRY+W+SFRPGK SQ+HQ  SRAYI+F
Sbjct  1    MKGQSEKTKVVVRHLPPTISQDMFLEQINVAFAGRYNWVSFRPGKNSQRHQSNSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            ++PEDV+EFAEFFNGH+FVNEKG+QF+ +VEYAP QR P+QWSKKDGREG ILKDP YLE
Sbjct  61   RSPEDVIEFAEFFNGHLFVNEKGTQFRAVVEYAPSQRVPKQWSKKDGREGTILKDPAYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KP   LP
Sbjct  121  FLELISKPAENLP  133



>ref|XP_012066696.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Jatropha curcas]
Length=509

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKG  ++TK+V+RHLPP + +    EQI+  F+GRY+W+SFRPGK SQ+HQ  SRAYI+F
Sbjct  1    MKGQSEKTKVVVRHLPPTISQDMFLEQINVAFAGRYNWVSFRPGKNSQRHQSNSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            ++PEDV+EFAEFFNGH+FVNEKG+QF+ +VEYAP QR P+QWSKKDGREG ILKDP YLE
Sbjct  61   RSPEDVIEFAEFFNGHLFVNEKGTQFRAVVEYAPSQRVPKQWSKKDGREGTILKDPAYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KP   LP
Sbjct  121  FLELISKPAENLP  133



>ref|XP_008802925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=568

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  253  LLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAY  432
            +  MK PLDRTK+VLR LPPA+ ++TL E+ID RF+GRY W  FRPGK SQK+  +SRAY
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSQKNPHHSRAY  66

Query  433  INFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPE  612
            I+FK PEDVVEFAEFF+GHVFVN+KGSQFK  VEYAP QR P+ WSKKD REG I+KDPE
Sbjct  67   IDFKRPEDVVEFAEFFDGHVFVNKKGSQFKVHVEYAPSQRIPKTWSKKDVREGTIIKDPE  126

Query  613  YLEFLEFIGKPVVYLP  660
            YLEFLE + KP  YLP
Sbjct  127  YLEFLEHLAKPAEYLP  142



>ref|XP_010657967.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Vitis vinifera]
 emb|CBI29694.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+V+RHLPP +  +   EQID+ F GRY  + FRPGK SQK Q YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ W KKDGREG I KDPEY+E
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRIPKHWPKKDGREGTIFKDPEYME  120

Query  622  FLEFIGKPVVYLP  660
            F+E + KPV  LP
Sbjct  121  FVELLAKPVENLP  133



>ref|XP_010657968.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Vitis vinifera]
Length=515

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+V+RHLPP +  +   EQID+ F GRY  + FRPGK SQK Q YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ W KKDGREG I KDPEY+E
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRIPKHWPKKDGREGTIFKDPEYME  120

Query  622  FLEFIGKPVVYLP  660
            F+E + KPV  LP
Sbjct  121  FVELLAKPVENLP  133



>ref|XP_010657969.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Vitis vinifera]
Length=514

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+V+RHLPP +  +   EQID+ F GRY  + FRPGK SQK Q YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ W KKDGREG I KDPEY+E
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRIPKHWPKKDGREGTIFKDPEYME  120

Query  622  FLEFIGKPVVYLP  660
            F+E + KPV  LP
Sbjct  121  FVELLAKPVENLP  133



>ref|XP_009403714.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=563

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+V+R LPP++ +  L EQID RF+GRY W+ FRPGK SQK+Q Y+RAY+NF
Sbjct  1    MKDPSDRTKVVVRRLPPSMSQPVLMEQIDGRFAGRYDWVCFRPGKNSQKNQRYTRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K P+DVVEFAEFF+GH+FVNEKG+QFK +VEYAP QR P+ WSKKD REG I KD EY+E
Sbjct  61   KIPDDVVEFAEFFDGHIFVNEKGAQFKALVEYAPFQRVPKHWSKKDVREGTIYKDSEYME  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KPV +LP
Sbjct  121  FLELISKPVEHLP  133



>ref|XP_010930556.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
Length=575

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+VLRHLPP++ +S L EQID RF+GRY W  FRPGK S K+Q YSRAY+NF
Sbjct  1    MKDPFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K  EDVVEFAE F+GH+FVNEKG+QFK +VEYAP QR PR WSKKDGREG I KDPEYLE
Sbjct  61   KRLEDVVEFAELFDGHIFVNEKGAQFKALVEYAPSQRVPRAWSKKDGREGTISKDPEYLE  120

Query  622  FLEFIGKP  645
            FLE + KP
Sbjct  121  FLELLSKP  128



>gb|KJB32869.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=442

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP Q  P  W+K D  EG I KDPEYLE
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGAQFKTIVEYAPSQCVPTLWAKNDDCEGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>gb|KJB32868.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=499

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP Q  P  W+K D  EG I KDPEYLE
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGAQFKTIVEYAPSQCVPTLWAKNDDCEGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>gb|KJB32861.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=507

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP Q  P  W+K D  EG I KDPEYLE
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGAQFKTIVEYAPSQCVPTLWAKNDDCEGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>gb|KJB32864.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=504

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP Q  P  W+K D  EG I KDPEYLE
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGAQFKTIVEYAPSQCVPTLWAKNDDCEGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>gb|KJB32858.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=508

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP Q  P  W+K D  EG I KDPEYLE
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGAQFKTIVEYAPSQCVPTLWAKNDDCEGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  121  FLEFLAKPVENLP  133



>emb|CAN62711.1| hypothetical protein VITISV_035617 [Vitis vinifera]
Length=355

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+++RHLPP +  +   EQI++ F GRY  + FRPGK SQ+ Q YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMILEAAFLEQINTVFKGRYTLVKFRPGKNSQQRQSYSRAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ W KKD REG I KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRIPKHWPKKDSREGTIFKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KP   LP
Sbjct  121  FLELLAKPFENLP  133



>ref|XP_008802926.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Phoenix dactylifera]
Length=567

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = +1

Query  253  LLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGK--TSQKHQPYSR  426
            +  MK PLDRTK+VLR LPPA+ ++TL E+ID RF+GRY W  FRPGK   SQK+  +SR
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSCSQKNPHHSR  66

Query  427  AYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKD  606
            AYI+FK PEDVVEFAEFF+GHVFVN+KGSQFK  VEYAP QR P+ WSKKD REG I+KD
Sbjct  67   AYIDFKRPEDVVEFAEFFDGHVFVNKKGSQFKVHVEYAPSQRIPKTWSKKDVREGTIIKD  126

Query  607  PEYLEFLEFIGKPVVYLP  660
            PEYLEFLE + KP  YLP
Sbjct  127  PEYLEFLEHLAKPAEYLP  144



>ref|XP_004485448.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Cicer arietinum]
 ref|XP_004485449.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Cicer arietinum]
 ref|XP_004485450.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Cicer arietinum]
Length=510

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP +   +LS  ID  FSGRY+WLSFRP K S KH  +SRAYI+F  PED
Sbjct  3    DRTKVVVRHLPPTISEDSLSSLIDGSFSGRYNWLSFRPAKISPKHTSFSRAYIDFNKPED  62

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFI  636
            V+EFAEFFNGHVFVNEKG+QFK  VEYAP QR P+QWSKKDGR+G I KDPEYLEFLE +
Sbjct  63   VIEFAEFFNGHVFVNEKGTQFKVTVEYAPSQRVPKQWSKKDGRDGTIYKDPEYLEFLELL  122

Query  637  GKPVVYLP  660
             KPV  LP
Sbjct  123  AKPVENLP  130



>ref|XP_008802922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=570

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = +1

Query  253  LLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGK--TSQKHQPYSR  426
            +  MK PLDRTK+VLR LPPA+ ++TL E+ID RF+GRY W  FRPGK   SQK+  +SR
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSCSQKNPHHSR  66

Query  427  AYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKD  606
            AYI+FK PEDVVEFAEFF+GHVFVN+KGSQFK  VEYAP QR P+ WSKKD REG I+KD
Sbjct  67   AYIDFKRPEDVVEFAEFFDGHVFVNKKGSQFKVHVEYAPSQRIPKTWSKKDVREGTIIKD  126

Query  607  PEYLEFLEFIGKPVVYLP  660
            PEYLEFLE + KP  YLP
Sbjct  127  PEYLEFLEHLAKPAEYLP  144



>ref|XP_010327534.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Solanum lycopersicum]
Length=476

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_009401110.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401111.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=565

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            M+GP DRTK+V+R LPP++ +S L EQID RF+GRY W+ FRPGK SQK+Q +SRAY+NF
Sbjct  1    MRGPSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVCFRPGKNSQKNQRHSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAEFF+ H+FVNEKG+QFK +VEYAP QR P+Q  KKD REG I KDPEY+E
Sbjct  61   KRPEDVVEFAEFFDQHIFVNEKGAQFKALVEYAPSQRVPKQCPKKDVREGTISKDPEYME  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KP+ +LP
Sbjct  121  FLELVSKPLEHLP  133



>ref|XP_010327533.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Solanum lycopersicum]
Length=489

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_010327532.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum lycopersicum]
Length=495

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_008795266.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=562

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTKIVLRHLPP++ +S L EQID RFSGRY WL FRPGK S K+Q YSRAY+NF
Sbjct  1    MKDPFDRTKIVLRHLPPSISQSALIEQIDERFSGRYDWLCFRPGKASHKNQRYSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PE VVEFAEFF+GH+FVNEKG+QFK +VEYAP Q  P+  SKKDGREG I KDPEYLE
Sbjct  61   KRPEVVVEFAEFFDGHIFVNEKGAQFKVLVEYAPSQHVPKPSSKKDGREGTISKDPEYLE  120

Query  622  FLEFIGKP  645
            FLE + KP
Sbjct  121  FLEHLSKP  128



>ref|XP_004248850.2| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Solanum lycopersicum]
Length=496

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_006339922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006339923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006339924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Solanum tuberosum]
Length=508

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFTFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_006339925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum tuberosum]
Length=482

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFTFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_004485447.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Cicer arietinum]
Length=517

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP +   +LS  ID  FSGRY+WLSFRP K S KH  +SRAYI+F  PED
Sbjct  3    DRTKVVVRHLPPTISEDSLSSLIDGSFSGRYNWLSFRPAKISPKHTSFSRAYIDFNKPED  62

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFI  636
            V+EFAEFFNGHVFVNEKG+QFK  VEYAP QR P+QWSKKDGR+G I KDPEYLEFLE +
Sbjct  63   VIEFAEFFNGHVFVNEKGTQFKVTVEYAPSQRVPKQWSKKDGRDGTIYKDPEYLEFLELL  122

Query  637  GKPVVYLP  660
             KPV  LP
Sbjct  123  AKPVENLP  130



>ref|XP_010683312.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=495

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL+RTK+V+RHLPP+L  S+  EQID RFS RY+W SFRPG +S  +Q Y RAY+NF
Sbjct  1    MKEPLNRTKVVVRHLPPSLSHSSFFEQIDGRFSSRYNWSSFRPGNSSHTNQRYGRAYVNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
             +P+DV EFAEFFNGHVFVNEKG+Q+K IVEYAP QR P+  +KKDGREG I KDPEYLE
Sbjct  61   NSPDDVFEFAEFFNGHVFVNEKGTQYKAIVEYAPSQRVPKSNAKKDGREGTIYKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KPV  LP
Sbjct  121  FLERISKPVENLP  133



>ref|XP_010683306.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=503

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL+RTK+V+RHLPP+L  S+  EQID RFS RY+W SFRPG +S  +Q Y RAY+NF
Sbjct  1    MKEPLNRTKVVVRHLPPSLSHSSFFEQIDGRFSSRYNWSSFRPGNSSHTNQRYGRAYVNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
             +P+DV EFAEFFNGHVFVNEKG+Q+K IVEYAP QR P+  +KKDGREG I KDPEYLE
Sbjct  61   NSPDDVFEFAEFFNGHVFVNEKGTQYKAIVEYAPSQRVPKSNAKKDGREGTIYKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KPV  LP
Sbjct  121  FLERISKPVENLP  133



>ref|XP_008795263.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008795264.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=565

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTKIVLRHLPP++ +S L EQID RFSGRY WL FRPGK S K+Q YSRAY+NF
Sbjct  1    MKDPFDRTKIVLRHLPPSISQSALIEQIDERFSGRYDWLCFRPGKASHKNQRYSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PE VVEFAEFF+GH+FVNEKG+QFK +VEYAP Q  P+  SKKDGREG I KDPEYLE
Sbjct  61   KRPEVVVEFAEFFDGHIFVNEKGAQFKVLVEYAPSQHVPKPSSKKDGREGTISKDPEYLE  120

Query  622  FLEFIGKP  645
            FLE + KP
Sbjct  121  FLEHLSKP  128



>ref|XP_010327529.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010327530.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
Length=508

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_010327531.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum lycopersicum]
Length=507

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            RTK+VLRHLPP L +S L E +DSRF+GRY+W +FRP KTS KHQ YS+AYI+F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIG  639
             EFAEFF+GH+FVNEKG+QFKTIVEYAP QR P+ W KKD REG ILKDP Y+EFLEF+ 
Sbjct  65   TEFAEFFDGHMFVNEKGTQFKTIVEYAPSQRVPKHWLKKDAREGTILKDPAYMEFLEFLA  124

Query  640  KPVVYLP  660
            KPV  LP
Sbjct  125  KPVENLP  131



>ref|XP_010101271.1| hypothetical protein L484_011635 [Morus notabilis]
 gb|EXB88206.1| hypothetical protein L484_011635 [Morus notabilis]
Length=533

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK V+R LPP+L +S L +QID RFSGRYHW  FRPGK SQKHQ YSRAYI+F
Sbjct  1    MKDPLSRTKAVVRRLPPSLSQSDLFQQIDDRFSGRYHWFCFRPGKNSQKHQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
               EDV+EFAEFF+GHVFVNEKG Q+KT+VEYAP QR P+  ++KDGR+G I KDP+YLE
Sbjct  61   NRAEDVLEFAEFFDGHVFVNEKGVQYKTVVEYAPSQRVPKLSTRKDGRDGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKLIAKPVEHLP  133



>ref|XP_007024253.1| Smg-4/UPF3 family protein, putative isoform 6 [Theobroma cacao]
 gb|EOY26875.1| Smg-4/UPF3 family protein, putative isoform 6 [Theobroma cacao]
Length=450

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP++ +S L  QID RFS RY+W SFR GK+S KHQ YSRAYINF
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGTQFKAIVEYAPSQRVPKPGTKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVDNLP  133



>tpg|DAA37690.1| TPA: hypothetical protein ZEAMMB73_050614 [Zea mays]
Length=270

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGH+FVNEKG+QFK  VEYAP Q+ P+   KKDGREG + KDPEYLE
Sbjct  61   KHPEDVVEFAEVFNGHIFVNEKGAQFKAFVEYAPSQQVPKSNVKKDGREGTVTKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>ref|XP_007226163.1| hypothetical protein PRUPE_ppa015218mg [Prunus persica]
 gb|EMJ27362.1| hypothetical protein PRUPE_ppa015218mg [Prunus persica]
Length=467

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L  S L +QID + + RY+W  FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSHSDLLQQIDHQLADRYNWFCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKGSQFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGSQFKAIVEYAPSQRVPKPCTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKLIAKPVEHLP  133



>ref|XP_007024252.1| Smg-4/UPF3 family protein, putative isoform 5 [Theobroma cacao]
 gb|EOY26874.1| Smg-4/UPF3 family protein, putative isoform 5 [Theobroma cacao]
Length=492

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP++ +S L  QID RFS RY+W SFR GK+S KHQ YSRAYINF
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGTQFKAIVEYAPSQRVPKPGTKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVDNLP  133



>ref|XP_007024249.1| Smg-4/UPF3 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY26871.1| Smg-4/UPF3 family protein, putative isoform 2 [Theobroma cacao]
Length=487

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP++ +S L  QID RFS RY+W SFR GK+S KHQ YSRAYINF
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGTQFKAIVEYAPSQRVPKPGTKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVDNLP  133



>ref|XP_007024248.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007024250.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007024251.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26870.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26872.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26873.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
Length=523

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP++ +S L  QID RFS RY+W SFR GK+S KHQ YSRAYINF
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGTQFKAIVEYAPSQRVPKPGTKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVDNLP  133



>ref|XP_008219049.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219050.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219051.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
Length=528

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L  S L +QID + + RY+W  FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSHSDLLQQIDHQLADRYNWFCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKGSQFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGSQFKAIVEYAPSQRVPKPCTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKLIAKPVEHLP  133



>ref|XP_010912655.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Elaeis 
guineensis]
Length=562

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGP DRTKIVLRHLPP++ +S L EQI  RF+GRY W+ FRPGK S K+Q YSR+Y++F
Sbjct  1    MKGPFDRTKIVLRHLPPSISQSALMEQIGERFAGRYDWVCFRPGKASPKNQRYSRSYLSF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAEFF+GH+FVNEKG+QFK +VEYAP Q  P+  SKKDGREG I KDPEYLE
Sbjct  61   KRPEDVVEFAEFFDGHIFVNEKGAQFKVLVEYAPSQHVPKPSSKKDGREGTISKDPEYLE  120

Query  622  FLEFIGKP  645
            FLE + KP
Sbjct  121  FLEHLSKP  128



>ref|XP_008786471.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=581

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK   DRTK+VLRHLPP++ +S L EQID RF+GRY W  FRPGK S K+Q YSRAY+NF
Sbjct  1    MKDSFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K  EDVVEFAE F+GH+FVNEKG+QFK +VEYAP QR P+ W KKDGREG I KDPEYLE
Sbjct  61   KRLEDVVEFAELFDGHIFVNEKGAQFKALVEYAPSQRVPKPWPKKDGREGTISKDPEYLE  120

Query  622  FLEFIGKP  645
            FLE + KP
Sbjct  121  FLELLSKP  128



>ref|XP_008786472.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=574

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK   DRTK+VLRHLPP++ +S L EQID RF+GRY W  FRPGK S K+Q YSRAY+NF
Sbjct  1    MKDSFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K  EDVVEFAE F+GH+FVNEKG+QFK +VEYAP QR P+ W KKDGREG I KDPEYLE
Sbjct  61   KRLEDVVEFAELFDGHIFVNEKGAQFKALVEYAPSQRVPKPWPKKDGREGTISKDPEYLE  120

Query  622  FLEFIGKP  645
            FLE + KP
Sbjct  121  FLELLSKP  128



>ref|XP_010096436.1| hypothetical protein L484_013119 [Morus notabilis]
 gb|EXB64107.1| hypothetical protein L484_013119 [Morus notabilis]
Length=534

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = +1

Query  262  MKGP--LDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            MKG    DRTK+VLRHLPP + ++ L E+IDS F+GRY WLSFRPGK  QKH  +SRAY+
Sbjct  1    MKGQQQFDRTKVVLRHLPPTISKAALLERIDSVFAGRYSWLSFRPGKNRQKH-SFSRAYL  59

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK PEDVVEFAE F GHVFVNEKG QFKT VEYAP QR P+QWSKKDGREG I  D EY
Sbjct  60   DFKKPEDVVEFAELFGGHVFVNEKGIQFKTTVEYAPSQRVPKQWSKKDGREGTINMDSEY  119

Query  616  LEFLEFIGKPVVYLP  660
            LEFLEF+ KP   LP
Sbjct  120  LEFLEFLAKPAENLP  134



>gb|EPS57826.1| hypothetical protein M569_16991, partial [Genlisea aurea]
Length=484

 Score =   196 bits (498),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+VLRHLPP++  S L E IDSRFSGRYHW +F PGK+SQK   YSRAYI F
Sbjct  1    MKGPLDRTKVVLRHLPPSISESNLVELIDSRFSGRYHWFAFCPGKSSQKRLKYSRAYIGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV+EFA FFNGH FVNEKG+Q K IVEYAP QR P++  KKDGREG I KD EYL+
Sbjct  61   YKPEDVIEFAAFFNGHAFVNEKGAQCKAIVEYAPSQRIPKKPFKKDGREGTIEKDTEYLD  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KP+  LP
Sbjct  121  FLESLAKPIENLP  133



>gb|KJB32862.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=514

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 106/140 (76%), Gaps = 7/140 (5%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILK------  603
            K+ EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP Q  P  W+K D  EG I K      
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGAQFKTIVEYAPSQCVPTLWAKNDDCEGTIFKVFLDEH  120

Query  604  -DPEYLEFLEFIGKPVVYLP  660
             DPEYLEFLEF+ KPV  LP
Sbjct  121  LDPEYLEFLEFLAKPVENLP  140



>gb|KJB32865.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=515

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 106/140 (76%), Gaps = 7/140 (5%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILK------  603
            K+ EDV+EFAEFFNGHVFVNEKG+QFKTIVEYAP Q  P  W+K D  EG I K      
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGAQFKTIVEYAPSQCVPTLWAKNDDCEGTIFKVFLDEH  120

Query  604  -DPEYLEFLEFIGKPVVYLP  660
             DPEYLEFLEF+ KPV  LP
Sbjct  121  LDPEYLEFLEFLAKPVENLP  140



>ref|XP_010910233.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Elaeis guineensis]
Length=531

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PLDRTK+VLR LPPA+P++TL E+ID RF+GRY W  FRPGK ++K+Q +SRAYI+F
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGKNNRKNQHHSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
               EDVVEFAEFF+GH+FVNEKG QFK  VEYAP Q  P++ SKKD REG I+KDPEYLE
Sbjct  61   NRSEDVVEFAEFFDGHIFVNEKGGQFKVHVEYAPSQHVPKRRSKKDVREGTIIKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KP   LP
Sbjct  121  FLEHLAKPAENLP  133



>emb|CAN72659.1| hypothetical protein VITISV_042717 [Vitis vinifera]
Length=437

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+++RHLPP +  +   EQID+ F  RY  + F PGK SQ+ Q YSRAY++F
Sbjct  76   MKGPLDRTKVMVRHLPPMISEAAFLEQIDTVFKERYTLVKFCPGKNSQQRQSYSRAYLDF  135

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNEKG+QFKTIVEYAP QR P+ W KKDGREG I KDPEYLE
Sbjct  136  KRPEDVIEFAEFFDGHVFVNEKGTQFKTIVEYAPSQRIPKHWPKKDGREGTIFKDPEYLE  195

Query  622  FLEFIGKPVVYLP  660
             LE + KP   LP
Sbjct  196  SLELLAKPFENLP  208



>ref|XP_004975685.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Setaria italica]
 ref|XP_004975686.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Setaria italica]
Length=504

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG QFK +VEYAP Q+ PR   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGVQFKALVEYAPSQQVPRSNIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  121  FLELISKPTEHLP  133



>ref|XP_010910195.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910210.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910217.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
Length=566

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PLDRTK+VLR LPPA+P++TL E+ID RF+GRY W  FRPGK ++K+Q +SRAYI+F
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGKNNRKNQHHSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
               EDVVEFAEFF+GH+FVNEKG QFK  VEYAP Q  P++ SKKD REG I+KDPEYLE
Sbjct  61   NRSEDVVEFAEFFDGHIFVNEKGGQFKVHVEYAPSQHVPKRRSKKDVREGTIIKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE + KP   LP
Sbjct  121  FLEHLAKPAENLP  133



>ref|XP_009362405.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Pyrus x bretschneideri]
Length=491

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID + + RY+WL FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GH+FVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHMFVNEKGAQFKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I  PV +LP
Sbjct  121  FLKLIAMPVEHLP  133



>ref|XP_009379179.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=524

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID   + RY+WL FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +K+DGREG I KDP+YLE
Sbjct  61   KQPEDVFEFAEFFDGHVFVNEKGAQFKAIVEYAPSQRVPKPSTKRDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKHIAKPVEHLP  133



>gb|KJB68168.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=452

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL +TK+V+RHLPP++    +  QID RFS RY+W SFR GK+S K Q YSRAYINF
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GH+FVNEKG+QFK +VEYAP QR P+  SKKDGREG I KDP+YLE
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKGTQFKAVVEYAPSQRVPKSSSKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVENLP  133



>ref|XP_008368136.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
UPF3-like [Malus domestica]
Length=575

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID   + RY+WL FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKVPLVRTKVLIRHLPPSLSQSDLFHQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGAQFKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKLIAKPVEHLP  133



>gb|KJB68172.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=464

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL +TK+V+RHLPP++    +  QID RFS RY+W SFR GK+S K Q YSRAYINF
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GH+FVNEKG+QFK +VEYAP QR P+  SKKDGREG I KDP+YLE
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKGTQFKAVVEYAPSQRVPKSSSKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVENLP  133



>ref|XP_009379185.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=523

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID   + RY+WL FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +K+DGREG I KDP+YLE
Sbjct  61   KQPEDVFEFAEFFDGHVFVNEKGAQFKAIVEYAPSQRVPKPSTKRDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKHIAKPVEHLP  133



>gb|KJB68170.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=459

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL +TK+V+RHLPP++    +  QID RFS RY+W SFR GK+S K Q YSRAYINF
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GH+FVNEKG+QFK +VEYAP QR P+  SKKDGREG I KDP+YLE
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKGTQFKAVVEYAPSQRVPKSSSKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVENLP  133



>ref|XP_009362402.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362403.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362404.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=522

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID + + RY+WL FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GH+FVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHMFVNEKGAQFKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I  PV +LP
Sbjct  121  FLKLIAMPVEHLP  133



>ref|XP_009362399.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362400.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362401.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=523

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID + + RY+WL FRPGK SQK+Q YSRAYI+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GH+FVNEKG+QFK IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHMFVNEKGAQFKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I  PV +LP
Sbjct  121  FLKLIAMPVEHLP  133



>ref|XP_008459659.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Cucumis melo]
Length=513

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL+RTK+V+RHLPP+L  S L   I  RF+GR++W  +RPGKTSQK Q Y+RAYI+F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GHVFVNEKG+Q+K +VEYAP QR PR  +KKDGREG I KDP+YLE
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKGAQYKAVVEYAPSQRVPRSSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP  +LP
Sbjct  121  FLKLIAKPAEHLP  133



>ref|XP_008459660.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Cucumis melo]
Length=506

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL+RTK+V+RHLPP+L  S L   I  RF+GR++W  +RPGKTSQK Q Y+RAYI+F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GHVFVNEKG+Q+K +VEYAP QR PR  +KKDGREG I KDP+YLE
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKGAQYKAVVEYAPSQRVPRSSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP  +LP
Sbjct  121  FLKLIAKPAEHLP  133



>ref|XP_004141560.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Cucumis sativus]
Length=506

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL+RTK+V+RHLPP+L  S L   I  RF+GR++W  +RPGKTSQK Q Y+RAYI+F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GHVFVNEKG+Q+K +VEYAP QR PR  +KKDGREG I KDP+YLE
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKGAQYKAVVEYAPSQRVPRSSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP  +LP
Sbjct  121  FLKLIAKPAEHLP  133



>ref|XP_008669383.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Zea mays]
Length=499

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGH+FVNEKG+QFK  VEYAP Q+ P+   KKDGREG + KDPEYLE
Sbjct  61   KHPEDVVEFAEVFNGHIFVNEKGAQFKAFVEYAPSQQVPKSNVKKDGREGTVTKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>ref|XP_011656113.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Cucumis sativus]
 gb|KGN52703.1| hypothetical protein Csa_5G650630 [Cucumis sativus]
Length=513

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL+RTK+V+RHLPP+L  S L   I  RF+GR++W  +RPGKTSQK Q Y+RAYI+F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GHVFVNEKG+Q+K +VEYAP QR PR  +KKDGREG I KDP+YLE
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKGAQYKAVVEYAPSQRVPRSSTKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP  +LP
Sbjct  121  FLKLIAKPAEHLP  133



>tpg|DAA37689.1| TPA: hypothetical protein ZEAMMB73_050614 [Zea mays]
Length=500

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGH+FVNEKG+QFK  VEYAP Q+ P+   KKDGREG + KDPEYLE
Sbjct  61   KHPEDVVEFAEVFNGHIFVNEKGAQFKAFVEYAPSQQVPKSNVKKDGREGTVTKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>gb|KJB68169.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
 gb|KJB68171.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=487

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL +TK+V+RHLPP++    +  QID RFS RY+W SFR GK+S K Q YSRAYINF
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GH+FVNEKG+QFK +VEYAP QR P+  SKKDGREG I KDP+YLE
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKGTQFKAVVEYAPSQRVPKSSSKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVENLP  133



>gb|EMT22790.1| Regulator of nonsense transcripts 3A [Aegilops tauschii]
Length=484

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+PEDVVEFAEFFNGHVFVNEKG+QFK +VEYAP Q+ P+   KKD R+G I KDPEYLE
Sbjct  61   KSPEDVVEFAEFFNGHVFVNEKGAQFKALVEYAPSQQVPKSNIKKDARQGTITKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  121  FLELISKPTEHLP  133



>ref|XP_008663221.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Zea mays]
Length=488

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D RF+GRY W  FRPG  SQK+  +SR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK  VEYAP Q+ P+   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGAQFKAFVEYAPSQQVPKSTIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>ref|XP_008663219.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Zea mays]
Length=496

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D RF+GRY W  FRPG  SQK+  +SR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK  VEYAP Q+ P+   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGAQFKAFVEYAPSQQVPKSTIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>ref|XP_008663218.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Zea mays]
Length=502

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D RF+GRY W  FRPG  SQK+  +SR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK  VEYAP Q+ P+   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGAQFKAFVEYAPSQQVPKSTIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>ref|XP_008663216.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Zea mays]
Length=504

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D RF+GRY W  FRPG  SQK+  +SR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK  VEYAP Q+ P+   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGAQFKAFVEYAPSQQVPKSTIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>dbj|BAJ94892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  241  EL*VLLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPY  420
            EL     MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  Y
Sbjct  23   ELEARAHMKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWARFRPGNASQKNHRY  82

Query  421  SRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAIL  600
            SR Y+NFK+PEDVVEFAEFFNGHVFVNEKG+QFK +VEYAP Q+ P+   KKD R+G I 
Sbjct  83   SRLYLNFKSPEDVVEFAEFFNGHVFVNEKGAQFKALVEYAPSQQVPKSNIKKDARQGTIT  142

Query  601  KDPEYLEFLEFIGKPVVYLP  660
            KDPEYLEFLE I KP  +LP
Sbjct  143  KDPEYLEFLELISKPTEHLP  162



>ref|XP_008663217.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Zea mays]
 gb|AFW58318.1| hypothetical protein ZEAMMB73_385077 [Zea mays]
Length=503

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D RF+GRY W  FRPG  SQK+  +SR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK  VEYAP Q+ P+   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGAQFKAFVEYAPSQQVPKSTIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>ref|XP_008663214.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Zea mays]
 ref|XP_008663215.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Zea mays]
Length=514

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D RF+GRY W  FRPG  SQK+  +SR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK  VEYAP Q+ P+   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGAQFKAFVEYAPSQQVPKSTIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLEFI KP  +LP
Sbjct  121  FLEFISKPTEHLP  133



>ref|XP_011461172.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=498

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S   +QID  F  R++W  FRPGK S KHQ YSRAYI F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSQSDFFQQIDHLFGDRHNWFCFRPGKNSHKHQRYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK+IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGTQFKSIVEYAPSQRVPKPSNKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP  +LP
Sbjct  121  FLKLIAKPAEHLP  133



>ref|XP_002447880.1| hypothetical protein SORBIDRAFT_06g017380 [Sorghum bicolor]
 gb|EES12208.1| hypothetical protein SORBIDRAFT_06g017380 [Sorghum bicolor]
Length=504

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK  VEY+P Q+ P+   KKDGREG I+KDPEYLE
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKGAQFKAFVEYSPSQQVPKSNIKKDGREGTIMKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  121  FLELISKPTEHLP  133



>ref|XP_011461169.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011461170.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011461171.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S   +QID  F  R++W  FRPGK S KHQ YSRAYI F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSQSDFFQQIDHLFGDRHNWFCFRPGKNSHKHQRYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GHVFVNEKG+QFK+IVEYAP QR P+  +KKDGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKGTQFKSIVEYAPSQRVPKPSNKKDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP  +LP
Sbjct  121  FLKLIAKPAEHLP  133



>ref|XP_008378738.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Malus domestica]
Length=517

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID   + RY+WL FRPGK SQK+Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GH+FVNEKG+QFK IVEYAP QR P+   K+DGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHIFVNEKGAQFKAIVEYAPSQRVPKPSIKRDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKHIAKPVEHLP  133



>emb|CAH66847.1| H0525C06.10 [Oryza sativa Indica Group]
 gb|EEC77332.1| hypothetical protein OsI_16007 [Oryza sativa Indica Group]
 gb|EEE61056.1| hypothetical protein OsJ_14914 [Oryza sativa Japonica Group]
Length=507

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            +K P  RTK+VLR LPPA+ +  + EQ+D+RF GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK +VEYAP Q+ P+  +KKD R+G I+KDPEYLE
Sbjct  68   KGPEDVVEFAEVFNGHVFVNEKGAQFKALVEYAPSQQVPKSNTKKDARQGTIMKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  128  FLESISKPAEHLP  140



>ref|XP_008378737.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Malus domestica]
Length=523

 Score =   191 bits (486),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID   + RY+WL FRPGK SQK+Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GH+FVNEKG+QFK IVEYAP QR P+   K+DGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHIFVNEKGAQFKAIVEYAPSQRVPKPSIKRDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKHIAKPVEHLP  133



>ref|XP_008378736.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Malus domestica]
Length=524

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+++RHLPP+L +S L  QID   + RY+WL FRPGK SQK+Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFAEFF+GH+FVNEKG+QFK IVEYAP QR P+   K+DGREG I KDP+YLE
Sbjct  61   KRPEDVFEFAEFFDGHIFVNEKGAQFKAIVEYAPSQRVPKPSIKRDGREGTIYKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV +LP
Sbjct  121  FLKHIAKPVEHLP  133



>ref|NP_174660.2| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
 sp|Q9FVW4.1|RENT3_ARATH RecName: Full=Regulator of nonsense transcripts UPF3; AltName: 
Full=Nonsense mRNA reducing factor UPF3; AltName: Full=Up-frameshift 
suppressor 3 homolog; Short=AtUpf3 [Arabidopsis thaliana]
 gb|AAG12847.1|AC079286_4 unknown protein; 6107-8789 [Arabidopsis thaliana]
 gb|AAM91586.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15431.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31653.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
Length=482

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L +S L  QID RF+ RY+W+SFRPGK+S K+Q YSRAY++F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPSDKKDPREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKVIAQPVENLP  133



>ref|XP_002891069.1| ATUPF3/UPF3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67328.1| ATUPF3/UPF3 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L +S L  QID RF+ RY+W+SFRPGK+S K+Q YSRAY++F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFA FFNGHVFVNEKG+QFK +VEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKGAQFKAVVEYAPSQRVPKPCDKKDPREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKVIAQPVENLP  133



>gb|KHG15802.1| Regulator of nonsense transcripts 3A [Gossypium arboreum]
Length=540

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL +TK+V+RHLPP++    +  QID RFS RY+W SFR GK S K Q YSRAYINF
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKCSHKQQSYSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
              PEDV EFAEFF+GH+FVNEKG+QFK IVEYAP QR P+  SKKDGREG I KDP+YLE
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKGTQFKAIVEYAPSQRVPKPSSKKDGREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKLIAKPVENLP  133



>gb|AAG12537.1|AC015446_18 Unknown protein [Arabidopsis thaliana]
Length=525

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L +S L  QID RF+ RY+W+SFRPGK+S K+Q YSRAY++F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPSDKKDPREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKVIAQPVENLP  133



>emb|CAE03133.3| OJ000114_01.14 [Oryza sativa Japonica Group]
Length=455

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            +K P  RTK+VLR LPPA+ +  + EQ+D+RF GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK +VEYAP Q+  +  +KKD R+G I+KDPEYLE
Sbjct  68   KGPEDVVEFAEVFNGHVFVNEKGAQFKALVEYAPSQQVXKSNTKKDARQGTIMKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  128  FLESISKPAEHLP  140



>ref|NP_001052873.1| Os04g0440100 [Oryza sativa Japonica Group]
 dbj|BAF14787.1| Os04g0440100 [Oryza sativa Japonica Group]
Length=507

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            +K P  RTK+VLR LPPA+ +  + EQ+D+RF GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDVVEFAE FNGHVFVNEKG+QFK +VEYAP Q+  +  +KKD R+G I+KDPEYLE
Sbjct  68   KGPEDVVEFAEVFNGHVFVNEKGAQFKALVEYAPSQQVXKSNTKKDARQGTIMKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  128  FLESISKPAEHLP  140



>ref|XP_010530121.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Tarenaya hassleriana]
Length=494

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  L + K+V+RHLPP++ +S L   ID+RF+ RY+W +FR GK+S K+Q YSRAYI F
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            KTPEDV +FA FFNGHVFVNEKG+Q K +VEYAP QRAPR   KKD REG I KDP+YLE
Sbjct  61   KTPEDVCDFASFFNGHVFVNEKGAQCKAVVEYAPSQRAPRPCGKKDPREGTICKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKIIAKPVENLP  133



>ref|XP_010530119.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Tarenaya hassleriana]
Length=499

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  L + K+V+RHLPP++ +S L   ID+RF+ RY+W +FR GK+S K+Q YSRAYI F
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            KTPEDV +FA FFNGHVFVNEKG+Q K +VEYAP QRAPR   KKD REG I KDP+YLE
Sbjct  61   KTPEDVCDFASFFNGHVFVNEKGAQCKAVVEYAPSQRAPRPCGKKDPREGTICKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKIIAKPVENLP  133



>ref|XP_010530120.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Tarenaya hassleriana]
Length=498

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  L + K+V+RHLPP++ +S L   ID+RF+ RY+W +FR GK+S K+Q YSRAYI F
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            KTPEDV +FA FFNGHVFVNEKG+Q K +VEYAP QRAPR   KKD REG I KDP+YLE
Sbjct  61   KTPEDVCDFASFFNGHVFVNEKGAQCKAVVEYAPSQRAPRPCGKKDPREGTICKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  121  FLKIIAKPVENLP  133



>ref|XP_006652316.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Oryza 
brachyantha]
Length=512

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            +K P  RTK+VLR LPPA+    + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+NF
Sbjct  8    VKDPAHRTKVVLRRLPPAIAPQAVVDQVDARFAGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+PEDVVEFAE F+GHVFVNEKG+QFK +VEYAP Q+ P+  SKKD R+G I+KDPEYLE
Sbjct  68   KSPEDVVEFAEVFSGHVFVNEKGAQFKALVEYAPSQQVPKLNSKKDARQGTIMKDPEYLE  127

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  128  FLESISKPAEHLP  140



>emb|CDY15301.1| BnaC06g07870D [Brassica napus]
Length=473

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L  S L  QIDSRF  RY+W SFRPGK++ K Q +SRAY  F
Sbjct  2    MKDPLAKRKVVVRHLPPSLSESDLLSQIDSRFGDRYYWFSFRPGKSNYKTQKHSRAYFGF  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV +FA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  62   KAPEDVYDFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSITKDPDYLE  121

Query  622  FLEFIGKPVVYLP  660
            FLE + +PV  LP
Sbjct  122  FLELLAQPVENLP  134



>emb|CDY52194.1| BnaCnng22070D [Brassica napus]
Length=484

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  + K+V+RHLPP+L +S L  QID RF  RY+W+SFRPGK+S K Q YSRAY +F
Sbjct  1    MKDPSAKRKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFSF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV +FA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYDFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSITKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKLIAQPVENLP  133



>ref|XP_009421163.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK   DRTK+V+R LPP++ +S L EQID RF+GRY W+ FRPGK S+K+Q +SRAY+NF
Sbjct  1    MKDSSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVFFRPGKNSRKNQRHSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            +  +DVVEFAEFF+GH+FVNEKG+ FK ++EYAP QR P+ WSKKD  EG + KDPEY++
Sbjct  61   ERSDDVVEFAEFFDGHIFVNEKGAHFKAVIEYAPSQRVPKPWSKKDVCEGTLSKDPEYMD  120

Query  622  FLEFIGKPVVYLP  660
            FL  + KPV +LP
Sbjct  121  FLGLLSKPVEHLP  133



>ref|XP_010542926.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Tarenaya hassleriana]
Length=490

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+++RHLPP++ +S L   I +RF+ RY+WL+F PGK+S K+Q YSRAYI F
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            KT EDV EFA FFNGHVFVNEKGSQ K IVEYAP QR P+Q  KKD REG I KDP YLE
Sbjct  61   KTQEDVYEFATFFNGHVFVNEKGSQCKAIVEYAPSQRVPKQCGKKDPREGTICKDPGYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKIIARPVENLP  133



>ref|XP_010478812.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Camelina 
sativa]
Length=484

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L +S L  QID RF  RY+W+SFRPGK+S ++Q  SRAY+ F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKVIAQPVENLP  133



>ref|XP_010499932.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Camelina sativa]
 ref|XP_010499933.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Camelina sativa]
Length=485

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L +S L  QID RF  RY+W+SFRPGK+S ++Q  SRAY+ F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKVIAQPVENLP  133



>ref|XP_010542909.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Tarenaya hassleriana]
Length=495

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+++RHLPP++ +S L   I +RF+ RY+WL+F PGK+S K+Q YSRAYI F
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            KT EDV EFA FFNGHVFVNEKGSQ K IVEYAP QR P+Q  KKD REG I KDP YLE
Sbjct  61   KTQEDVYEFATFFNGHVFVNEKGSQCKAIVEYAPSQRVPKQCGKKDPREGTICKDPGYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKIIARPVENLP  133



>ref|XP_010542917.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Tarenaya hassleriana]
Length=491

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+++RHLPP++ +S L   I +RF+ RY+WL+F PGK+S K+Q YSRAYI F
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            KT EDV EFA FFNGHVFVNEKGSQ K IVEYAP QR P+Q  KKD REG I KDP YLE
Sbjct  61   KTQEDVYEFATFFNGHVFVNEKGSQCKAIVEYAPSQRVPKQCGKKDPREGTICKDPGYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKIIARPVENLP  133



>ref|XP_010463114.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Camelina 
sativa]
Length=499

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L +S L  QID RF  RY+W+SFRPGK+S ++Q  SRAY+ F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKVIAQPVENLP  133



>ref|XP_003527584.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 gb|KHN20546.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=529

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S LS+ IDS F+ RY+W SFRPG  S   Q +SRAYI
Sbjct  7    MKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAYI  66

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  67   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIYKDPDY  126

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  127  LEFLKLIAKPQEHLP  141



>ref|XP_006582445.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Glycine max]
Length=537

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S LS+ IDS F+ RY+W SFRPG  S   Q +SRAYI
Sbjct  7    MKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAYI  66

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  67   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIYKDPDY  126

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  127  LEFLKLIAKPQEHLP  141



>ref|XP_006582443.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Glycine max]
Length=539

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S LS+ IDS F+ RY+W SFRPG  S   Q +SRAYI
Sbjct  7    MKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAYI  66

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  67   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIYKDPDY  126

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  127  LEFLKLIAKPQEHLP  141



>ref|XP_006582444.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Glycine max]
Length=537

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S LS+ IDS F+ RY+W SFRPG  S   Q +SRAYI
Sbjct  7    MKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAYI  66

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  67   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIYKDPDY  126

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  127  LEFLKLIAKPQEHLP  141



>ref|XP_006582442.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
Length=547

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S LS+ IDS F+ RY+W SFRPG  S   Q +SRAYI
Sbjct  7    MKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAYI  66

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  67   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIYKDPDY  126

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  127  LEFLKLIAKPQEHLP  141



>ref|XP_006303223.1| hypothetical protein CARUB_v10012004mg [Capsella rubella]
 gb|EOA36121.1| hypothetical protein CARUB_v10012004mg [Capsella rubella]
Length=311

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P+ + K+V+RHLPP+L +S L  QID RF  RY+W+SFRPGK+S ++Q  SRAY+ F
Sbjct  1    MKEPVQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSYRNQKCSRAYVAF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            + PEDV EFA FFNGHVFVNEKG+Q+K IVEYAP QR P    KKD REG+I KDP+YLE
Sbjct  61   EEPEDVYEFAAFFNGHVFVNEKGAQYKAIVEYAPSQRVPTPADKKDLREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKLIAQPVENLP  133



>ref|XP_006579008.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Glycine max]
Length=493

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S L + IDS F+ RY+W SFRPG  S K Q +SRAYI
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIFKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|NP_001117406.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
 gb|AEE31654.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
Length=484

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKT--SQKHQPYSRAYI  435
            MK PL + K+V+RHLPP+L +S L  QID RF+ RY+W+SFRPGK+    K+Q YSRAY+
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSRLGYKNQKYSRAYV  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDP+Y
Sbjct  61   SFKAPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPSDKKDPREGSISKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I +PV  LP
Sbjct  121  LEFLKVIAQPVENLP  135



>ref|XP_011031522.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031524.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031525.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031526.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
Length=524

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +1

Query  253  LLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAY  432
            + + K PL RTK+V+RHLPP+L +S L  Q D RF  RY+W  FRPG +S K Q YSRAY
Sbjct  1    MKKKKEPLGRTKVVIRHLPPSLSQSNLFSQFDHRFCHRYNWFRFRPGNSSHKSQRYSRAY  60

Query  433  INFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPE  612
            I+FK PEDV+EFA+FF+GHVFVNEKGSQFK IVEYAP QR P+    KD REG I  DP+
Sbjct  61   IDFKNPEDVLEFADFFHGHVFVNEKGSQFKAIVEYAPCQRVPKSCPHKDSREGTIYTDPD  120

Query  613  YLEFLEFIGKPV  648
            YLEFL+ I KPV
Sbjct  121  YLEFLKLIAKPV  132



>ref|XP_009114779.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=462

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            + MK PL + K+V+RHLPP+L  S L  QIDSRF  RY+W SFRPGK++ + Q +SRAY 
Sbjct  1    MMMKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRTQKHSRAYF  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
             FK PEDV +FA FFNGHVFVN+KG+QFK IVEYAP QR P+   KKD REG+I KDP+Y
Sbjct  61   GFKAPEDVYDFASFFNGHVFVNDKGAQFKAIVEYAPSQRVPKPCYKKDPREGSITKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I +PV  LP
Sbjct  121  LEFLKLIAQPVENLP  135



>ref|XP_003522607.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006579004.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 ref|XP_006579005.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Glycine max]
 ref|XP_006579006.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Glycine max]
Length=535

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S L + IDS F+ RY+W SFRPG  S K Q +SRAYI
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIFKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|XP_006579007.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Glycine max]
Length=525

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S L + IDS F+ RY+W SFRPG  S K Q +SRAYI
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIFKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|XP_009114778.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=479

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            + MK PL + K+V+RHLPP+L  S L  QIDSRF  RY+W SFRPGK++ + Q +SRAY 
Sbjct  1    MMMKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRTQKHSRAYF  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
             FK PEDV +FA FFNGHVFVN+KG+QFK IVEYAP QR P+   KKD REG+I KDP+Y
Sbjct  61   GFKAPEDVYDFASFFNGHVFVNDKGAQFKAIVEYAPSQRVPKPCYKKDPREGSITKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I +PV  LP
Sbjct  121  LEFLKLIAQPVENLP  135



>emb|CDX93747.1| BnaA09g23470D [Brassica napus]
Length=475

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL + K+V+RHLPP+L  S L  QIDSRF  RY+W SFRPGK++ + Q +SRAY  F
Sbjct  2    MKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRAQKHSRAYFGF  61

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV +FA FFNGHVFVN+KG+QFK IVEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  62   KAPEDVYDFAAFFNGHVFVNDKGAQFKAIVEYAPSQRVPKPCDKKDPREGSITKDPDYLE  121

Query  622  FLEFIGKPVVYLP  660
            FL+ + +PV  LP
Sbjct  122  FLKLLAQPVENLP  134



>ref|XP_010239939.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Brachypodium distachyon]
Length=505

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+N 
Sbjct  1    MKDPPPRTKVVLRRLPPAIGQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNL  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDVVEFAEFFNGH+FVNEKG+QFK +VEYAP Q+ P+   KKD R+G I KD EYLE
Sbjct  61   KSSEDVVEFAEFFNGHIFVNEKGAQFKALVEYAPSQQVPKSTIKKDARQGTITKDLEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  121  FLELISKPTEHLP  133



>ref|XP_010239938.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Brachypodium distachyon]
Length=506

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  RTK+VLR LPPA+ +  + +Q+D+RF+GRY W  FRPG  SQK+  YSR Y+N 
Sbjct  1    MKDPPPRTKVVLRRLPPAIGQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNL  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDVVEFAEFFNGH+FVNEKG+QFK +VEYAP Q+ P+   KKD R+G I KD EYLE
Sbjct  61   KSSEDVVEFAEFFNGHIFVNEKGAQFKALVEYAPSQQVPKSTIKKDARQGTITKDLEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FLE I KP  +LP
Sbjct  121  FLELISKPTEHLP  133



>ref|XP_006415052.1| hypothetical protein EUTSA_v10007455mg [Eutrema salsugineum]
 gb|ESQ33405.1| hypothetical protein EUTSA_v10007455mg [Eutrema salsugineum]
Length=496

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  + K+V+RHLPP+L +S L  QI+ RF  RY+W SFRPGK+S K+Q +SRAY+ F
Sbjct  1    MKDPSPKRKVVVRHLPPSLSQSDLLSQIEPRFGDRYYWFSFRPGKSSYKNQKFSRAYVGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV EFA FFNGHVFVNEKG+QFK +VEYAP QR P+   KKD REG+I KDP+YLE
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKGAQFKAVVEYAPSQRVPKPCDKKDPREGSISKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKLIAQPVENLP  133



>gb|KHN47094.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=530

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++    +TK+V+RHLPP+L +S L + IDS F+ RY+W SFRPG  S K Q +SRAYI
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +FK P+DV EFAEFF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERGAQHKVIVEYAPSQRVPKPSAKKDGREGTIFKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>gb|AES68284.2| regulator of nonsense transcripts UPF3 protein [Medicago truncatula]
Length=540

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++ +    RTK+V+RHLPP+L  S L + ID+RFS RYHW  FR G TS ++Q Y+RAY+
Sbjct  1    MKARSEKGRTKVVIRHLPPSLTESDLIQHIDNRFSSRYHWFVFRSGNTSYRNQKYARAYL  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +F +P+DV EFAEFFNGHVFVNEKG Q K +VEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   DFNSPDDVFEFAEFFNGHVFVNEKGVQHKAVVEYAPSQRVPKLSTKKDGREGTIYKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLISKPQEHLP  135



>emb|CDY48801.1| BnaA05g20690D [Brassica napus]
Length=476

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  + K+V+RHLPP+L  S L  QID RF  RY+W+SFRPGK+S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV +FA FF+GHVFVNEKG+QFK IVEYAP QR P+   KKD R+G+I KDP+YLE
Sbjct  61   KAPEDVYDFAAFFSGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPRDGSITKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I  PV  LP
Sbjct  121  FLKLIALPVENLP  133



>ref|XP_009145165.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=480

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  + K+V+RHLPP+L  S L  QID RF  RY+W+SFRPGK+S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV +FA FF+GHVFVNEKG+QFK IVEYAP QR P+   KKD R+G+I KDP+YLE
Sbjct  61   KAPEDVYDFAAFFSGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPRDGSITKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I  PV  LP
Sbjct  121  FLKLIALPVENLP  133



>ref|XP_009145164.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=485

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  + K+V+RHLPP+L  S L  QID RF  RY+W+SFRPGK+S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV +FA FF+GHVFVNEKG+QFK IVEYAP QR P+   KKD R+G+I KDP+YLE
Sbjct  61   KAPEDVYDFAAFFSGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPRDGSITKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I  PV  LP
Sbjct  121  FLKLIALPVENLP  133



>ref|XP_006441553.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 ref|XP_006441554.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 ref|XP_006441555.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54793.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54794.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54795.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
Length=523

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP+L ++ L       F+ RY+W  FRPGK+S KHQ YSRAY+  
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K P DV EFAE  NGHVFVNEKG+QFK IVEYAP QR P+ +S+KD REG I KDP+YLE
Sbjct  61   KKPADVFEFAELLNGHVFVNEKGAQFKAIVEYAPSQRVPKPFSRKDSREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP   LP
Sbjct  121  FLKVIAKPAENLP  133



>ref|XP_009107941.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=461

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK    + K+V+RHLPP+L    L  QIDSRF   Y W SFRPGK++ K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDPEYLE
Sbjct  61   KSPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSITKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKLIAQPVENLP  133



>ref|XP_009107940.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=466

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK    + K+V+RHLPP+L    L  QIDSRF   Y W SFRPGK++ K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDPEYLE
Sbjct  61   KSPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSITKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKLIAQPVENLP  133



>ref|XP_007148608.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20602.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=529

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S L + IDS F  RY+W SFRPG TS K Q +SRAYI
Sbjct  7    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFDSRYNWFSFRPGNTSLKRQRHSRAYI  66

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +F +P DV +FA FF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  67   DFNSPHDVFDFAHFFHGHVFVNERGAQHKAIVEYAPSQRVPKPTTKKDGREGTIYKDPDY  126

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  127  LEFLKLIAKPHEHLP  141



>emb|CDY46452.1| BnaA08g06560D [Brassica napus]
Length=491

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK    + K+V+RHLPP+L +  L  QIDSRF   Y W SFRPGK++ K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSQPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+PEDV EFA FFNGHVFVNEKG+QFK IVEYAP QR P+   KKD REG+I KDPEYLE
Sbjct  61   KSPEDVYEFAAFFNGHVFVNEKGAQFKAIVEYAPSQRVPKPCDKKDPREGSITKDPEYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I +PV  LP
Sbjct  121  FLKLIAQPVENLP  133



>ref|XP_007148607.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20601.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=539

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++   ++TK+V+RHLPP+L +S L + IDS F  RY+W SFRPG TS K Q +SRAYI
Sbjct  7    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFDSRYNWFSFRPGNTSLKRQRHSRAYI  66

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +F +P DV +FA FF+GHVFVNE+G+Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  67   DFNSPHDVFDFAHFFHGHVFVNERGAQHKAIVEYAPSQRVPKPTTKKDGREGTIYKDPDY  126

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  127  LEFLKLIAKPHEHLP  141



>ref|XP_003598033.1| B3 domain-containing protein [Medicago truncatula]
Length=1203

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++ +    RTK+V+RHLPP+L  S L + ID+RFS RYHW  FR G TS ++Q Y+RAY+
Sbjct  1    MKARSEKGRTKVVIRHLPPSLTESDLIQHIDNRFSSRYHWFVFRSGNTSYRNQKYARAYL  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            +F +P+DV EFAEFFNGHVFVNEKG Q K +VEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   DFNSPDDVFEFAEFFNGHVFVNEKGVQHKAVVEYAPSQRVPKLSTKKDGREGTIYKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLISKPQEHLP  135



>ref|XP_002325958.2| hypothetical protein POPTR_0019s10620g [Populus trichocarpa]
 gb|EEF00340.2| hypothetical protein POPTR_0019s10620g [Populus trichocarpa]
Length=527

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = +1

Query  253  LLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAY  432
            + + K PL RTK+V+RHLPP+L +S L  Q D  F  RY+W  FRPG +S K Q YSRAY
Sbjct  1    MKKKKEPLGRTKVVIRHLPPSLSQSNLFSQFDHLFCHRYNWFRFRPGNSSHKSQRYSRAY  60

Query  433  INFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPE  612
            I+FK PEDV+EFA FF+GHVFVNEKGSQFK IVEYAP Q  P+    KD REG I  DP+
Sbjct  61   IDFKNPEDVLEFAGFFHGHVFVNEKGSQFKAIVEYAPCQHVPKSCPHKDSREGTIYTDPD  120

Query  613  YLEFLEFIGKPV  648
            YLEFL+ I KP 
Sbjct  121  YLEFLKLIAKPA  132



>gb|KDO45829.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45830.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45831.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45832.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45833.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45834.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45835.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45836.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
Length=523

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP+L ++ L       F+ RY+W  FRPGK+S KHQ YSRAY+  
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K P  V EFAE  NGHVFVNEKG+QFK IVEYAP QR P+ +S+KD REG I KDP+YLE
Sbjct  61   KKPAGVFEFAELLNGHVFVNEKGAQFKAIVEYAPSQRVPKPFSRKDSREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP   LP
Sbjct  121  FLKVIAKPAENLP  133



>ref|XP_006478194.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006478195.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Citrus sinensis]
Length=523

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP+L ++ L       F+ RY+W  FRPGK+S KHQ YSRAY+  
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K P  V EFAE  NGHVFVNEKG+QFK IVEYAP QR P+ +S+KD REG I KDP+YLE
Sbjct  61   KKPAGVFEFAELLNGHVFVNEKGAQFKAIVEYAPSQRVPKPFSRKDSREGTIFKDPDYLE  120

Query  622  FLEFIGKPVVYLP  660
            FL+ I KP   LP
Sbjct  121  FLKVIAKPAENLP  133



>emb|CDX91795.1| BnaC08g07140D [Brassica napus]
Length=730

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 109/163 (67%), Gaps = 7/163 (4%)
 Frame = +1

Query  175  LILC-EIRFLPPRLMFCGLPRVSEL*VLLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDS  351
            L+ C   RF+   L  C   RVS       MK    + K+V+RHLPP+L    L  QIDS
Sbjct  216  LVTCFSSRFM--ELQMCFRNRVS----FDLMKDRSAKRKVVVRHLPPSLSEPDLLSQIDS  269

Query  352  RFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIV  531
            RF   Y W SFRPGK++ K Q +SRAY  FK+PEDV EFA FFNGHVFVNEKG+QFK IV
Sbjct  270  RFGDSYSWFSFRPGKSNYKTQKHSRAYFGFKSPEDVYEFAAFFNGHVFVNEKGAQFKAIV  329

Query  532  EYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIGKPVVYLP  660
            EYAP QR P+   KKD REG+I KDP+YLEFL+ I +PV  LP
Sbjct  330  EYAPSQRVPKPCDKKDPREGSITKDPDYLEFLKLIAQPVENLP  372



>ref|XP_012073511.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Jatropha 
curcas]
 ref|XP_012073512.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Jatropha 
curcas]
 ref|XP_012073513.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Jatropha 
curcas]
Length=503

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  250  VLLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRA  429
            ++++ K P +RT++V+RHLPP+L +  L  Q D  FS RY+W  FRP K SQKHQ YSRA
Sbjct  1    MIMKKKEPSERTRVVIRHLPPSLSQFHLFSQFDHLFSQRYNWFCFRPAKFSQKHQRYSRA  60

Query  430  YINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDP  609
            YI+FK P DV+EFA+ F+GH+F NE+GSQFK IVEYAP QR P+  + KD R+G I KDP
Sbjct  61   YIDFKNPGDVLEFADIFHGHIFYNERGSQFKAIVEYAPSQRVPKTCTLKDDRDGTIYKDP  120

Query  610  EYLEFLEFIGKPVVYL  657
            +YLEFL+ I KPV  L
Sbjct  121  DYLEFLKLIAKPVENL  136



>gb|KDP36702.1| hypothetical protein JCGZ_07993 [Jatropha curcas]
Length=536

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  250  VLLRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRA  429
            ++++ K P +RT++V+RHLPP+L +  L  Q D  FS RY+W  FRP K SQKHQ YSRA
Sbjct  1    MIMKKKEPSERTRVVIRHLPPSLSQFHLFSQFDHLFSQRYNWFCFRPAKFSQKHQRYSRA  60

Query  430  YINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDP  609
            YI+FK P DV+EFA+ F+GH+F NE+GSQFK IVEYAP QR P+  + KD R+G I KDP
Sbjct  61   YIDFKNPGDVLEFADIFHGHIFYNERGSQFKAIVEYAPSQRVPKTCTLKDDRDGTIYKDP  120

Query  610  EYLEFLEFIGKPVVYL  657
            +YLEFL+ I KPV  L
Sbjct  121  DYLEFLKLIAKPVENL  136



>ref|XP_006441556.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54796.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
Length=527

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 98/137 (72%), Gaps = 4/137 (3%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTS----QKHQPYSRA  429
            MK PL RTK+V+RHLPP+L ++ L       F+ RY+W  FRPGK+S     KHQ YSRA
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSFFYSYKHQRYSRA  60

Query  430  YINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDP  609
            Y+  K P DV EFAE  NGHVFVNEKG+QFK IVEYAP QR P+ +S+KD REG I KDP
Sbjct  61   YVELKKPADVFEFAELLNGHVFVNEKGAQFKAIVEYAPSQRVPKPFSRKDSREGTIFKDP  120

Query  610  EYLEFLEFIGKPVVYLP  660
            +YLEFL+ I KP   LP
Sbjct  121  DYLEFLKVIAKPAENLP  137



>gb|KDO45837.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
Length=527

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 97/137 (71%), Gaps = 4/137 (3%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTS----QKHQPYSRA  429
            MK PL RTK+V+RHLPP+L ++ L       F+ RY+W  FRPGK+S     KHQ YSRA
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSFFYSYKHQRYSRA  60

Query  430  YINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDP  609
            Y+  K P  V EFAE  NGHVFVNEKG+QFK IVEYAP QR P+ +S+KD REG I KDP
Sbjct  61   YVELKKPAGVFEFAELLNGHVFVNEKGAQFKAIVEYAPSQRVPKPFSRKDSREGTIFKDP  120

Query  610  EYLEFLEFIGKPVVYLP  660
            +YLEFL+ I KP   LP
Sbjct  121  DYLEFLKVIAKPAENLP  137



>ref|XP_010910224.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Elaeis guineensis]
Length=551

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 94/133 (71%), Gaps = 15/133 (11%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PLDRTK+VLR LPPA+P++TL E+ID RF+GRY W  FRPGK               
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGKNKS------------  48

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
               EDVVEFAEFF+GH+FVNEKG QFK  VEYAP Q  P++ SKKD REG I+KDPEYLE
Sbjct  49   ---EDVVEFAEFFDGHIFVNEKGGQFKVHVEYAPSQHVPKRRSKKDVREGTIIKDPEYLE  105

Query  622  FLEFIGKPVVYLP  660
            FLE + KP   LP
Sbjct  106  FLEHLAKPAENLP  118



>ref|XP_001778894.1| predicted protein [Physcomitrella patens]
 gb|EDQ56344.1| predicted protein [Physcomitrella patens]
Length=1124

 Score =   171 bits (432),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK    RTK+ +RHLPP+L  +   +QI  +++G Y W S+ PGK+S K Q YSRAYINF
Sbjct  26   MKEQQARTKVSVRHLPPSLAWAVFQDQIAVKYAGTYTWWSYHPGKSSHKRQVYSRAYINF  85

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV++F E FNGHVFVNE+G+Q+K +VEYAP QR P+  SKKD REG I  DPEYL 
Sbjct  86   KKPEDVIDFYEDFNGHVFVNERGAQYKALVEYAPYQRVPKPRSKKDVREGTISTDPEYLA  145

Query  622  FLEFIGKPVVYLP  660
            F+E + KP  YLP
Sbjct  146  FVEQLAKPAEYLP  158



>ref|XP_003592906.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=385

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP + + +L   IDS F+GRY+W SF P K +  H   SRAYI+F TP+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKIT-SHNHTSRAYIDFNTPDD  61

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK--DGREGAILKDPEYLEFLE  630
            V++FA FFNGH+F+N+KG+ FK  VEYAP QR P   SKK  D R+G I KDP+YL+FL+
Sbjct  62   VIDFAHFFNGHLFLNQKGTHFKVTVEYAPSQRVPNHSSKKPEDARDGTIFKDPDYLQFLQ  121

Query  631  FIGKPVVYLP  660
             I KPV  LP
Sbjct  122  QIAKPVENLP  131



>ref|XP_009421164.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=531

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK   DRTK+V+R LPP++ +S L EQID RF+GRY W+ FRPGK S+K+Q +SRAY+NF
Sbjct  1    MKDSSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVFFRPGKNSRKNQRHSRAYLNF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILK  603
            +  +DVVEFAEFF+GH+FVNEKG+ FK ++EYAP QR P+ WSKKD  EG + K
Sbjct  61   ERSDDVVEFAEFFDGHIFVNEKGAHFKAVIEYAPSQRVPKPWSKKDVCEGTLSK  114



>ref|XP_003592907.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=498

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP + + +L   IDS F+GRY+W SF P K +  H   SRAYI+F TP+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKIT-SHNHTSRAYIDFNTPDD  61

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK--DGREGAILKDPEYLEFLE  630
            V++FA FFNGH+F+N+KG+ FK  VEYAP QR P   SKK  D R+G I KDP+YL+FL+
Sbjct  62   VIDFAHFFNGHLFLNQKGTHFKVTVEYAPSQRVPNHSSKKPEDARDGTIFKDPDYLQFLQ  121

Query  631  FIGKPVVYLP  660
             I KPV  LP
Sbjct  122  QIAKPVENLP  131



>gb|ABE91932.1| Nonsense-mediated decay UPF3 [Medicago truncatula]
Length=500

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP + + +L   IDS F+GRY+W SF P K +  H   SRAYI+F TP+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKIT-SHNHTSRAYIDFNTPDD  61

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK--DGREGAILKDPEYLEFLE  630
            V++FA FFNGH+F+N+KG+ FK  VEYAP QR P   SKK  D R+G I KDP+YL+FL+
Sbjct  62   VIDFAHFFNGHLFLNQKGTHFKVTVEYAPSQRVPNHSSKKPEDARDGTIFKDPDYLQFLQ  121

Query  631  FIGKPVVYLP  660
             I KPV  LP
Sbjct  122  QIAKPVENLP  131



>gb|AES63156.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=510

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP + + +L   IDS F+GRY+W SF P K +  H   SRAYI+F TP+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITS-HNHTSRAYIDFNTPDD  61

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK--DGREGAILKDPEYLEFLE  630
            V++FA FFNGH+F+N+KG+ FK  VEYAP QR P   SKK  D R+G I KDP+YL+FL+
Sbjct  62   VIDFAHFFNGHLFLNQKGTHFKVTVEYAPSQRVPNHSSKKPEDARDGTIFKDPDYLQFLQ  121

Query  631  FIGKPVVYLP  660
             I KPV  LP
Sbjct  122  QIAKPVENLP  131



>gb|AES63158.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=540

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP + + +L   IDS F+GRY+W SF P K +  H   SRAYI+F TP+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKIT-SHNHTSRAYIDFNTPDD  61

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK--DGREGAILKDPEYLEFLE  630
            V++FA FFNGH+F+N+KG+ FK  VEYAP QR P   SKK  D R+G I KDP+YL+FL+
Sbjct  62   VIDFAHFFNGHLFLNQKGTHFKVTVEYAPSQRVPNHSSKKPEDARDGTIFKDPDYLQFLQ  121

Query  631  FIGKPVVYLP  660
             I KPV  LP
Sbjct  122  QIAKPVENLP  131



>ref|XP_003592905.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=565

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  277  DRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPED  456
            DRTK+V+RHLPP + + +L   IDS F+GRY+W SF P K +  H   SRAYI+F TP+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITS-HNHTSRAYIDFNTPDD  61

Query  457  VVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK--DGREGAILKDPEYLEFLE  630
            V++FA FFNGH+F+N+KG+ FK  VEYAP QR P   SKK  D R+G I KDP+YL+FL+
Sbjct  62   VIDFAHFFNGHLFLNQKGTHFKVTVEYAPSQRVPNHSSKKPEDARDGTIFKDPDYLQFLQ  121

Query  631  FIGKPVVYLP  660
             I KPV  LP
Sbjct  122  QIAKPVENLP  131



>ref|XP_004499563.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Cicer arietinum]
 ref|XP_004499564.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X7 [Cicer arietinum]
 ref|XP_004499565.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X8 [Cicer arietinum]
Length=535

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++    +TK+V+RHLPP+L  S L +QI +RFS  Y++ SF  G TS K+Q YSRAYI
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            NF +P+DV +FA+FFNGHVFVNEKG Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKGVQHKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|XP_004499558.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Cicer arietinum]
Length=572

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++    +TK+V+RHLPP+L  S L +QI +RFS  Y++ SF  G TS K+Q YSRAYI
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            NF +P+DV +FA+FFNGHVFVNEKG Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKGVQHKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|XP_004499559.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Cicer arietinum]
Length=570

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++    +TK+V+RHLPP+L  S L +QI +RFS  Y++ SF  G TS K+Q YSRAYI
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            NF +P+DV +FA+FFNGHVFVNEKG Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKGVQHKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|XP_004499561.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Cicer arietinum]
 ref|XP_004499562.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Cicer arietinum]
Length=567

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++    +TK+V+RHLPP+L  S L +QI +RFS  Y++ SF  G TS K+Q YSRAYI
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            NF +P+DV +FA+FFNGHVFVNEKG Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKGVQHKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|XP_004499560.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Cicer arietinum]
Length=568

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYI  435
            ++++    +TK+V+RHLPP+L  S L +QI +RFS  Y++ SF  G TS K+Q YSRAYI
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
            NF +P+DV +FA+FFNGHVFVNEKG Q K IVEYAP QR P+  +KKDGREG I KDP+Y
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKGVQHKAIVEYAPSQRVPKPSTKKDGREGTIYKDPDY  120

Query  616  LEFLEFIGKPVVYLP  660
            LEFL+ I KP  +LP
Sbjct  121  LEFLKLIAKPQEHLP  135



>ref|XP_010246763.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X4 
[Nelumbo nucifera]
Length=580

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 85/133 (64%), Gaps = 32/133 (24%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P DRTK+VLRHLPP L +S L+EQID RF+GRY W+ FR GK SQKHQ YSRAYI+F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GH+FVNE                                KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHIFVNE--------------------------------KDPEYLE  88

Query  622  FLEFIGKPVVYLP  660
            FL+ I KPV  LP
Sbjct  89   FLDLISKPVENLP  101



>gb|KJB32867.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=476

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 84/133 (63%), Gaps = 32/133 (24%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K+ EDV+EFAEFFNGHVFVNE                                KDPEYLE
Sbjct  61   KSLEDVLEFAEFFNGHVFVNE--------------------------------KDPEYLE  88

Query  622  FLEFIGKPVVYLP  660
            FLEF+ KPV  LP
Sbjct  89   FLEFLAKPVENLP  101



>ref|XP_008378998.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Malus 
domestica]
Length=607

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  400  SQKHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKD  579
            SQK+Q YSRAYI+ K PEDV +FAEFF+GH+FVNEKGSQFK IVEYAP QR P+ WSKKD
Sbjct  84   SQKNQSYSRAYIDLKRPEDVFDFAEFFDGHLFVNEKGSQFKVIVEYAPSQRVPKHWSKKD  143

Query  580  GREGAILKDPEYLEFLEFIGKPVVYLP  660
            GREG I KDPEYLEFLEFI KP   LP
Sbjct  144  GREGTIFKDPEYLEFLEFIAKPAENLP  170



>ref|XP_002972412.1| hypothetical protein SELMODRAFT_97155 [Selaginella moellendorffii]
 gb|EFJ26498.1| hypothetical protein SELMODRAFT_97155 [Selaginella moellendorffii]
Length=118

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+R LPP L    L  +I +RF+  Y W+ FRPGK++  +Q +SRAYI F
Sbjct  1    MKDPLSRTKVVVRRLPPTLSEDALVSRIQTRFARPYLWMLFRPGKST--NQIHSRAYIEF  58

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILK  603
            + PEDV+ F E F+GHVFVNEKGSQ+K +VEYAP QR P    KKDGREG+IL+
Sbjct  59   ERPEDVLAFHEDFHGHVFVNEKGSQYKAMVEYAPYQRVPDLRVKKDGREGSILR  112



>ref|XP_002984244.1| hypothetical protein SELMODRAFT_119852 [Selaginella moellendorffii]
 gb|EFJ14754.1| hypothetical protein SELMODRAFT_119852 [Selaginella moellendorffii]
Length=118

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            M+ PL RTK+V+R LPP L    L  +I +RF+  Y W+ FRPGK++  +Q +SRAYI F
Sbjct  1    MRDPLSRTKVVVRRLPPTLSEDALVSRIQTRFARPYLWMLFRPGKST--NQIHSRAYIEF  58

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILK  603
            + PEDV+ F E F+GHVFVNEKGSQ+K +VEYAP QR P    KKDGREG+IL+
Sbjct  59   ERPEDVLAFHEDFHGHVFVNEKGSQYKAMVEYAPYQRVPDLRVKKDGREGSILR  112



>ref|XP_002510770.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52957.1| conserved hypothetical protein [Ricinus communis]
Length=423

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +1

Query  286  KIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVVE  465
            K+V+RHLPP+L +S L  Q        ++W  FRP  +S K+  YSRAYI FK+P D  +
Sbjct  14   KVVIRHLPPSLSQSHLFSQFHHLLLLSFNWFCFRPPNSSHKNHRYSRAYIEFKSPADAGQ  73

Query  466  FAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEFIGKP  645
            FA  F+GH+FV++ G+QFK IVEYAP QR P+    KDGREG I  DP+YLEFL+ I KP
Sbjct  74   FAHLFHGHLFVDDNGAQFKAIVEYAPSQRVPKPSPVKDGREGTIYTDPDYLEFLKLIAKP  133

Query  646  VVYLP  660
            V  LP
Sbjct  134  VDNLP  138



>ref|XP_006478236.1| PREDICTED: uncharacterized protein LOC102612273 [Citrus sinensis]
Length=233

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  KGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFK  444
            +G +   ++V+RHLPP+L ++ L       F+ RY+W  FRPG++S KHQ YSRAY   K
Sbjct  29   RGAIGENQLVIRHLPPSLSQNDLLALFHDHFNDRYNWFCFRPGRSSSKHQRYSRAYEELK  88

Query  445  TPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKD  606
             P  V EFAE  NGHVFVNEKG+QFK  VEYAP Q  P+  S+KD REG I KD
Sbjct  89   NPAVVFEFAELLNGHVFVNEKGAQFKVTVEYAPSQCVPKPCSRKDSREGTIFKD  142



>ref|XP_008352807.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
UPF3-like, partial [Malus domestica]
Length=532

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  397  TSQKHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK  576
             SQK+Q YSRAYI+FK PEDV EFAEFF+GHVFVNEKG+QFK IVEYAP QR P+  +KK
Sbjct  2    CSQKNQRYSRAYIDFKRPEDVFEFAEFFDGHVFVNEKGAQFKAIVEYAPSQRVPKPSTKK  61

Query  577  DGREGAILKDPEYLEFLEFIGKPVVYLP  660
            DGREG I KDP+YLEFL+ I KPV +LP
Sbjct  62   DGREGTIYKDPDYLEFLKLIAKPVEHLP  89



>emb|CBI18298.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 81/133 (61%), Gaps = 32/133 (24%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+++RHLPP +  +   EQI++ F GRY  + FRPGK SQ+ Q YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMILEAAFLEQINTVFKGRYTLVKFRPGKNSQQRQSYSRAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNE                                KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHVFVNE--------------------------------KDPEYLE  88

Query  622  FLEFIGKPVVYLP  660
            FLE + KP   LP
Sbjct  89   FLELLAKPFENLP  101



>ref|XP_010930558.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Elaeis guineensis]
Length=543

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 5/94 (5%)
 Frame = +1

Query  391  GKTS----QKHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAP  558
            G+TS     K+Q YSRAY+NFK  EDVVEFAE F+GH+FVNEKG+QFK +VEYAP QR P
Sbjct  8    GRTSPVWCHKNQRYSRAYLNFKRLEDVVEFAELFDGHIFVNEKGAQFKALVEYAPSQRVP  67

Query  559  RQWSKKDGREGAILKDPEYLEFLEFIGKPVVYLP  660
            R WSKKDGREG I KDPEYLEFLE + KP  +LP
Sbjct  68   RAWSKKDGREGTISKDPEYLEFLELLSKP-EHLP  100



>ref|XP_010930557.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Elaeis guineensis]
Length=558

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = +1

Query  406  KHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGR  585
            K+Q YSRAY+NFK  EDVVEFAE F+GH+FVNEKG+QFK +VEYAP QR PR WSKKDGR
Sbjct  32   KNQRYSRAYLNFKRLEDVVEFAELFDGHIFVNEKGAQFKALVEYAPSQRVPRAWSKKDGR  91

Query  586  EGAILKDPEYLEFLEFIGKPVVYLP  660
            EG I KDPEYLEFLE + KP  +LP
Sbjct  92   EGTISKDPEYLEFLELLSKP-EHLP  115



>gb|EMS47492.1| Regulator of nonsense transcripts 3A [Triticum urartu]
Length=509

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  391  GKTSQKHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWS  570
            G  SQK+  YSR Y+NFK+PEDVVEFAEFFNGHVFVNEKG+QFK +VEYAP Q+ P+   
Sbjct  46   GVKSQKNHRYSRLYLNFKSPEDVVEFAEFFNGHVFVNEKGAQFKALVEYAPSQQVPKSNI  105

Query  571  KKDGREGAILKDPEYLEFLEFIGKPVVYLP  660
            KKD R+G I KDPEYLEFLE I KP  +LP
Sbjct  106  KKDARQGTITKDPEYLEFLELISKPTEHLP  135



>gb|KJB32866.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 5/117 (4%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK  LDRTK+VLRHLPP++  + L EQ+DS F+GRY+W SFRPGK  QKHQ  SR YI+F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKT-----IVEYAPLQRAPRQWSKKDGREGAI  597
            K+ EDV+EFAEFFNGHVFVNEKG+   +     ++++   +RA +  S+K    G +
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKGALKDSSIVTPLMDFVRQKRAAKVGSRKSLSNGKL  117



>emb|CBI18294.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 78/133 (59%), Gaps = 32/133 (24%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MKGPLDRTK+++RHLPP +  +   EQID+ F  RY  + F PGK SQ+ Q YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMISEAAFLEQIDTVFKERYTLVKFCPGKNSQQRQSYSRAYLDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            K PEDV+EFAEFF+GHVFVNE                                KDPEYLE
Sbjct  61   KRPEDVIEFAEFFDGHVFVNE--------------------------------KDPEYLE  88

Query  622  FLEFIGKPVVYLP  660
             LE + KP   LP
Sbjct  89   SLELLAKPFENLP  101



>gb|KIY98106.1| hypothetical protein MNEG_9858, partial [Monoraphidium neglectum]
Length=149

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            M  P +RTK+V+R+LPPAL    L   +D    GRY W ++ PGK S +   +SRAY +F
Sbjct  1    MTKPQERTKVVVRNLPPALTEEALRAVVDKIVGGRYGWSAYYPGKVSLRRTLHSRAYFDF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPE  612
             TP+DV+EF   F+GHVFV+ KG+Q++  VEYAP QR P+  +KK   EG I K  E
Sbjct  61   LTPDDVIEFKTRFDGHVFVSTKGTQYRCTVEYAPSQRVPKPPTKKAPMEGTIEKGEE  117



>ref|XP_005644501.1| hypothetical protein COCSUDRAFT_44353 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19957.1| hypothetical protein COCSUDRAFT_44353 [Coccomyxa subellipsoidea 
C-169]
Length=382

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = +1

Query  274  LDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPE  453
            ++RTK+V+R LPP++  + + E +DS  + +Y+W SF  GKTS +   +SR Y+NF+ P 
Sbjct  1    MERTKVVIRKLPPSIADADVRELVDS-TNVKYNWFSFVQGKTSVRKVVHSRCYVNFEDPS  59

Query  454  DVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEF  633
            D+  F      H FV ++G+QF++ VEYAP Q+ P+   K+D REG + KDPEYL F+E 
Sbjct  60   DIPAFKAAVEAHAFVTDRGAQFRSSVEYAPFQKVPQGKPKRDPREGTLDKDPEYLAFVES  119

Query  634  I  636
            +
Sbjct  120  L  120



>ref|XP_002945932.1| hypothetical protein VOLCADRAFT_48819 [Volvox carteri f. nagariensis]
 gb|EFJ52927.1| hypothetical protein VOLCADRAFT_48819, partial [Volvox carteri 
f. nagariensis]
Length=90

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  283  TKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVV  462
            TK+V+R+LPP +   T    ++S   GRY WLS+ PGK S K   +SRAY+NF T EDV 
Sbjct  1    TKVVIRNLPPGMTDDTFKTVLESLAGGRYTWLSYFPGKVSLKRVVFSRAYVNFLTAEDVY  60

Query  463  EFAEFFNGHVFVNEKGSQFKTIVEYAPLQR  552
            +F + F+GHVF+ +KG Q++  VEYAPLQ+
Sbjct  61   DFKQRFDGHVFIGQKGHQYRCSVEYAPLQK  90



>ref|XP_001691099.1| UPF3 protein [Chlamydomonas reinhardtii]
 gb|EDP05545.1| UPF3 protein [Chlamydomonas reinhardtii]
Length=371

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 0/112 (0%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK P  +TK+++R LPPA+   T    +DS  +GRY+WLS+  GK S K    SRAYINF
Sbjct  1    MKPPRQKTKVLVRKLPPAMSEDTFKSVLDSVAAGRYNWLSYYAGKVSLKRVASSRAYINF  60

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAI  597
             + EDV  F + F+GHVF++ +G+Q++  VEYAPLQ+ P   +K    EG I
Sbjct  61   VSEEDVYNFKQRFDGHVFISRQGNQYRCAVEYAPLQKMPTLEAKPHPLEGTI  112



>ref|XP_011395745.1| Regulator of nonsense transcripts 3A [Auxenochlorella protothecoides]
 gb|KFM22879.1| Regulator of nonsense transcripts 3A [Auxenochlorella protothecoides]
Length=475

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 80/124 (65%), Gaps = 9/124 (7%)
 Frame = +1

Query  277  DRTKIVLRHLPPALP----RSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFK  444
            +RTK+V+RHLPP+L     +S + E +D     R +W ++  GK S K   +SRAY+NFK
Sbjct  6    ERTKVVVRHLPPSLSEDAFKSAVQEWLD-----RSNWSAYYQGKVSAKEHVHSRAYLNFK  60

Query  445  TPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEF  624
             P D + F+  FNG++FV+++G+  +  VEYAP QR PR  +++D REG I KD  Y  F
Sbjct  61   DPADALRFSAAFNGNLFVSDRGAHTRARVEYAPFQRVPRATNRRDPREGTIEKDAGYRAF  120

Query  625  LEFI  636
            L+ +
Sbjct  121  LKSL  124



>ref|XP_001754467.1| predicted protein [Physcomitrella patens]
 gb|EDQ80917.1| predicted protein [Physcomitrella patens]
Length=987

 Score =   108 bits (271),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 67/192 (35%), Positives = 83/192 (43%), Gaps = 78/192 (41%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKT--------------  399
            MK    RTK+ +RHLPP+L  +   +QI  +++G Y W S+ PGK               
Sbjct  26   MKEQQARTKVAVRHLPPSLSEAVFQDQIAGKYAGAYTWWSYHPGKNRSSRKRRQYVAHNP  85

Query  400  ------------SQKHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEK------------  507
                        S K Q YSRAYINFK PEDV++F E FNGHVFVNE+            
Sbjct  86   RNQFDAVGAIACSHKRQVYSRAYINFKKPEDVIDFYEDFNGHVFVNERVMDFCKHWNEGI  145

Query  508  ----------------------------------------GSQFKTIVEYAPLQRAPRQW  567
                                                    G+Q+K +VEYAP QR P+  
Sbjct  146  FHFFCVGHHKLEVESGCDYTLVSRFLMLGDSSRTERLEECGAQYKALVEYAPYQRVPKPR  205

Query  568  SKKDGREGAILK  603
            SKKD REG I K
Sbjct  206  SKKDVREGTIFK  217



>ref|XP_005851259.1| hypothetical protein CHLNCDRAFT_50004 [Chlorella variabilis]
 gb|EFN59157.1| hypothetical protein CHLNCDRAFT_50004 [Chlorella variabilis]
Length=119

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 71/117 (61%), Gaps = 9/117 (8%)
 Frame = +1

Query  280  RTKIVLRHLPPALP----RSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKT  447
            R K+V+R LPP+L     R  + E I+     R  W S+  GK S K   +SRAY+ FK 
Sbjct  6    RCKVVVRRLPPSLQEEAFRGAVREWIE-----RADWFSYVQGKASSKDLLHSRAYLRFKD  60

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYL  618
              DV  F + ++GH FVNE+G+QF+  VEYA  QR PRQ  K+D +EG I +D +YL
Sbjct  61   AADVPRFQQAWDGHAFVNERGTQFRCQVEYAAYQRVPRQRVKRDPKEGTIERDADYL  117



>ref|XP_006441562.1| hypothetical protein CICLE_v10024224mg [Citrus clementina]
 gb|ESR54802.1| hypothetical protein CICLE_v10024224mg [Citrus clementina]
Length=89

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  439  FKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYL  618
             K P DV EFAE  NGH+FVNEK +QFK +V Y P QR P+  S+KD REG I KDP+YL
Sbjct  1    MKKPADVFEFAELLNGHLFVNEKVAQFKAVVGYVPSQRVPKPCSRKDSREGTIFKDPDYL  60

Query  619  EFLEFIGKPVVYLP  660
            EFL+ I KP   LP
Sbjct  61   EFLKVIAKPAENLP  74



>gb|KHN22614.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=148

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 26/138 (19%)
 Frame = +1

Query  256  LRMKGPLDRTKIVLRHLPPALPRSTL--SEQIDSRFSGRYHWLSFR--------------  387
            ++++   ++TK+V+RHL P+L  S    + +   RFS +   L  R              
Sbjct  1    MKVRSEREKTKVVIRHLSPSLTLSDFFPTHRFSLRFSLQLVLLPSRQQQVITIQTLPVCS  60

Query  388  ---PGKT-------SQKHQPYSRAYINFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEY  537
               P K+       S K Q +SRAYI+FK P+DV EF EFF+GHVFVNE+G+Q+K IVEY
Sbjct  61   LCNPNKSLIIIIICSHKRQMHSRAYIDFKCPDDVFEFTEFFDGHVFVNERGAQYKVIVEY  120

Query  538  APLQRAPRQWSKKDGREG  591
            AP QR P+  +KK   +G
Sbjct  121  APSQRVPKPSAKKMDVKG  138



>gb|ACO09703.1| Regulator of nonsense transcripts 3B [Osmerus mordax]
Length=297

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = +1

Query  283  TKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVV  462
            TKIV+R LPP+L +  L EQ+         +L F    TS     ++RAYINFK  ED+V
Sbjct  36   TKIVIRRLPPSLTKEELEEQLQP--LPEVDYLEFFSSDTSMYPHLFARAYINFKNQEDIV  93

Query  463  EFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK-DGREGAILKDPEYLEFLEF  633
             F + F+G+VF++ +G ++  IVE+AP Q+  ++ SKK D + G I +DPEY +FLE+
Sbjct  94   LFRDRFDGYVFIDNRGQEYPAIVEFAPFQKIAKKRSKKRDAKSGTIDEDPEYKKFLEY  151



>emb|CCJ29190.1| unnamed protein product [Pneumocystis jirovecii]
Length=395

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 73/127 (57%), Gaps = 5/127 (4%)
 Frame = +1

Query  271  PLDRTKIVLRHLPPALPRSTLSEQIDSRFSG-RYHWLSFRPGKTS---QKHQPYSRAYIN  438
            P  R K+V+R+LPP L   T  E +       R  W SF PGK S    K+  Y+RAYI 
Sbjct  19   PATRLKVVIRYLPPDLSEQTFKELVKEWIDEERVEWSSFYPGKVSSNRNKNDKYARAYIK  78

Query  439  FKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPR-QWSKKDGREGAILKDPEY  615
            FK+PE ++ F + F  H+F +EKG   + +VE+AP Q+ PR +  K D R+G I  D E+
Sbjct  79   FKSPEALIAFHKGFGAHLFTDEKGKGQRVLVEFAPFQKVPRLERQKHDARQGTIDDDAEF  138

Query  616  LEFLEFI  636
            + F E +
Sbjct  139  IAFQETL  145



>gb|KFM76145.1| Regulator of nonsense transcripts 3A, partial [Stegodyphus mimosarum]
Length=342

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDV  459
            +TK+V+R LPP + +    EQI       + ++ F           +SRAYINF  PED+
Sbjct  33   QTKVVIRRLPPTMTQEQFIEQIAP--LPEHDYMYFVKADMRLGPHAFSRAYINFLIPEDI  90

Query  460  VEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK-DGREGAILKDPEYLEFLEFI  636
              F + F+G+VF++ KG+++  IVE+AP Q+ P++ SKK D + G I  DP+YL+FLE +
Sbjct  91   FTFKDKFDGYVFLDSKGNEYPAIVEFAPFQKIPKKRSKKRDAKCGTITNDPDYLKFLESL  150

Query  637  GKP  645
              P
Sbjct  151  KNP  153



>ref|XP_012050899.1| hypothetical protein CNAG_03276 [Cryptococcus neoformans var. 
grubii H99]
 gb|AFR96497.2| hypothetical protein CNAG_03276 [Cryptococcus neoformans var. 
grubii H99]
Length=427

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYH-WLSFRPGK----TSQKHQPYSRAYINFK  444
            R K+V+R LPP LP     + + +  + +   W SF  GK    T   H  YSRAY+   
Sbjct  11   RNKLVIRRLPPTLPEDIFWQSVSTWITDKTCLWKSFVKGKAGDSTYDSHPVYSRAYVLMA  70

Query  445  TPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAP-RQWSKKDGREGAILKDPEYLE  621
             PE ++ F   F+GH++ ++ G++F+ +VEYAP Q+ P +   K D R+G + +DP+YL 
Sbjct  71   DPESLINFHRAFDGHIYKSKTGAEFQAVVEYAPFQKTPLKTKVKVDNRQGTVDEDPDYLS  130

Query  622  FLEFIGKPVV  651
            F+E +  PV 
Sbjct  131  FIESLNAPVT  140



>ref|XP_006441789.1| hypothetical protein CICLE_v10023375mg [Citrus clementina]
 gb|ESR55029.1| hypothetical protein CICLE_v10023375mg [Citrus clementina]
Length=103

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGK-----TSQKHQPYSR  426
            MK PL RTK+V+RHLP +L ++ L       F+  Y+W +F P        S KHQ YSR
Sbjct  1    MKKPLQRTKVVIRHLPLSLSQNDLLALFHDHFNDHYNWSTFGPENLGIFFNSYKHQTYSR  60

Query  427  AYINFKTPEDVVEFAEFFNGHVFVNEKGS  513
            A    K P DV EFAE  NGHVFVNEKG+
Sbjct  61   ACEELKKPTDVFEFAELLNGHVFVNEKGN  89



>ref|XP_006441573.1| hypothetical protein CICLE_v10024086mg [Citrus clementina]
 gb|ESR54813.1| hypothetical protein CICLE_v10024086mg [Citrus clementina]
Length=90

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = +1

Query  262  MKGPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINF  441
            MK PL RTK+V+RHLPP+L ++ L       F+ RY+           KH+ YSR Y   
Sbjct  1    MKKPLQRTKVVIRHLPPSLSQNDLLALFHDHFNDRYNCF---------KHETYSRTYEEL  51

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQR  552
            K P DV EFAE  NGHVFVNEKG+    +V+Y P  +
Sbjct  52   KKPTDVFEFAELLNGHVFVNEKGNFAWYLVKYTPCLK  88



>emb|CAG08354.1| unnamed protein product [Tetraodon nigroviridis]
Length=503

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = +1

Query  283  TKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVV  462
            TKIV+R LPP+L +  L EQ+         +L F    TS     ++RAYINF+  ED+V
Sbjct  37   TKIVIRRLPPSLTKEELKEQLQP--LPEVDYLEFFSNDTSLFPHLFARAYINFQNQEDIV  94

Query  463  EFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK-DGREGAILKDPEYLEFLEF  633
             F + F+G+VF++++G ++  +VE+AP Q+  ++ SKK D + G I +DPEY +FLEF
Sbjct  95   LFRDRFDGYVFIDKRGQEYPAVVEFAPFQKTAKKRSKKRDAKCGTINEDPEYKKFLEF  152



>emb|CDS12040.1| hypothetical protein LRAMOSA04235 [Absidia idahoensis var. thermophila]
Length=395

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGR--YHWLSFRPGKTSQ---KHQPYSRAYINFK  444
            +TKIV+R LP  LP       +  R++G     +  + PGK +Q   K   +SRAY + K
Sbjct  65   KTKIVVRRLPANLPEEVFMNAV-KRWTGDDVVDYKFYVPGKVTQSKGKENVFSRAYFHMK  123

Query  445  TPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEF  624
            T E V+ F + F+GH+FV+ +G++ + +VE+AP Q+ P++    D R+G I +DP+YL+F
Sbjct  124  TMEAVIAFHQGFDGHIFVDNRGNESRAVVEFAPFQKLPKEQKNPDSRQGTIDEDPDYLKF  183

Query  625  LEFI  636
            L+ +
Sbjct  184  LDSL  187



>emb|CDH57309.1| wd repeat-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=399

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGR--YHWLSFRPGKTSQ---KHQPYSRAYINFK  444
            +TKIV+R LP  LP       +  R++G     +  + PGK +Q   K   +SRAY + K
Sbjct  65   KTKIVVRRLPANLPEEVFMTAV-KRWTGDDVVDYKFYVPGKVTQSKGKENVFSRAYFHMK  123

Query  445  TPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEF  624
            T E V+ F + F+GH+FV+ +G++ + +VE+AP Q+ P++    D R+G I +DP+YL+F
Sbjct  124  TMEAVIAFHQGFDGHIFVDNRGNESRAVVEFAPFQKLPKEQKNPDSRQGTIDEDPDYLKF  183

Query  625  LEFI  636
            L+ +
Sbjct  184  LDSL  187



>ref|XP_003970655.1| PREDICTED: regulator of nonsense transcripts 3B [Takifugu rubripes]
Length=452

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 77/118 (65%), Gaps = 3/118 (3%)
 Frame = +1

Query  283  TKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVV  462
            TKIV+R LPP+L +  L EQ+         +L F    TS     ++RAYINF+  ED+V
Sbjct  36   TKIVIRRLPPSLTKEELEEQLQP--LPEVDYLEFFSNDTSLFPHLFARAYINFRNQEDIV  93

Query  463  EFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKK-DGREGAILKDPEYLEFLEF  633
             F + F+G+VF++++G ++  +VE+AP Q+  ++ +KK D + G I++DPEY +FLE+
Sbjct  94   LFRDRFDGYVFIDKRGQEYPAVVEFAPFQKTAKKRNKKRDAKCGTIIEDPEYKKFLEY  151



>ref|XP_002404304.1| regulator of nonsense transcripts 3B, putative [Ixodes scapularis]
 gb|EEC14884.1| regulator of nonsense transcripts 3B, putative [Ixodes scapularis]
Length=452

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = +1

Query  283  TKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVV  462
            TK+V+R LPP +      +QI       Y +  F  G  S     +SRAYINF   E++ 
Sbjct  33   TKVVIRRLPPTMSEDQFLDQISPVPENDYMY--FVKGNKSLGPNAFSRAYINFINQEEIF  90

Query  463  EFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAP-RQWSKKDGREGAILKDPEYLEFLEFIG  639
             F E F+ +VF++EKG+++  IVEYAP Q+ P R+  KKD + G I +DPEYL+FLE + 
Sbjct  91   IFKEKFDEYVFLDEKGNEYPAIVEYAPFQKIPKRRTRKKDPKCGTIEQDPEYLKFLESLE  150

Query  640  KP-VVYLP  660
            +P  V LP
Sbjct  151  QPEEVSLP  158



>gb|EPB88698.1| hypothetical protein HMPREF1544_04457 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=414

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = +1

Query  271  PLDRTKIVLRHLPPALPRSTLSEQIDSRFSGR-YHWLSFRPGKTSQ---KHQPYSRAYIN  438
            P  +TK+V+R LPP LP    +  +    S     +  + PGK S+   K   +SRAY +
Sbjct  58   PTLKTKVVVRRLPPNLPEEIFNNSVKPWISEETVDYSVYVPGKLSKSKAKESIFSRAYFH  117

Query  439  FKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYL  618
            FKT E V+ F + ++GHVFV+ +G++F+ +VE+A  Q+ P++    D R+G I +D +YL
Sbjct  118  FKTMEAVIAFHQGYDGHVFVDSRGNEFRAVVEFALYQKIPKEHKTADARQGTIDQDQDYL  177

Query  619  EFLEFI  636
            +FLE +
Sbjct  178  DFLESL  183



>ref|XP_003030982.1| hypothetical protein SCHCODRAFT_109867 [Schizophyllum commune 
H4-8]
 gb|EFI96079.1| hypothetical protein SCHCODRAFT_109867, partial [Schizophyllum 
commune H4-8]
Length=502

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = +1

Query  286  KIVLRHLPPALPRSTLSEQIDSRFSGR-YHWLSFRPGKTS---QKHQPYSRAYINFKTPE  453
            KIV+R LPP LP S   E + +  S     W ++ PGK      K    SRAYI FKT E
Sbjct  102  KIVVRRLPPNLPESIFWESVQAWVSEETVSWRTYWPGKMRSRPDKENVPSRAYIVFKTDE  161

Query  454  DVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFLEF  633
             V  F + ++GH+F ++ G++F+ +VE+AP Q+ P +  K D R G I KD +Y+ FLE 
Sbjct  162  QVAIFGKEYDGHLFRDKAGNEFQAVVEFAPYQKVPSEKKKVDVRAGTIEKDEDYISFLES  221

Query  634  IGKPVVYLP  660
            +  P    P
Sbjct  222  LNAPTSSEP  230



>gb|ESA18168.1| hypothetical protein GLOINDRAFT_144398, partial [Rhizophagus 
irregularis DAOM 181602]
Length=270

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 76/125 (61%), Gaps = 4/125 (3%)
 Frame = +1

Query  274  LDRTKIVLRHLPPALPRSTLSEQIDSRFSGR-YHWLSFRPGKTSQ---KHQPYSRAYINF  441
            + +TK+V+R LPP +P S   E +    +     W  F  G+ S+   K   +SRAY +F
Sbjct  25   VTKTKVVVRRLPPLIPESLFFESVKQWVNEETCTWSRFHQGRISKSKNKESIFSRAYFHF  84

Query  442  KTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLE  621
            KT E V+EF   ++ H+F++++G++ + +VE+A  Q+ P++  K D R+G I  DP+YL 
Sbjct  85   KTVEQVLEFHRGYDNHLFIDKQGNENRAVVEFAVYQKLPKEHKKPDPRQGTIETDPDYLA  144

Query  622  FLEFI  636
            FLE +
Sbjct  145  FLESL  149



>emb|CEP19677.1| hypothetical protein [Parasitella parasitica]
Length=424

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFS-GRYHWLSFRPGKTSQ---KHQPYSRAYINFKT  447
            +TK+V+R LPP LP    +  +    S     +  + PGK S+   K   ++RAY +FK+
Sbjct  54   KTKVVVRRLPPNLPEEIFNNSVKPWISEDTVDYSLYVPGKLSKSKAKESVFARAYFHFKS  113

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
             E V+ F + F+GHVFV+ +G+ F+ +VE+A  Q+ P++    D R+G I +D +YL+FL
Sbjct  114  MEAVIAFHQGFDGHVFVDSRGNDFRAVVEFALYQKLPKEHKTADARQGTIDQDQDYLDFL  173

Query  628  EFI  636
            E +
Sbjct  174  ESL  176



>gb|KDN51831.1| hypothetical protein RSAG8_00380, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=333

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 4/127 (3%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYH-WLSFRPGKTSQK---HQPYSRAYINFKT  447
            R K+V+R LPP LP +   + +    +     W  + PGK   K       SRAY+ F T
Sbjct  30   RLKVVIRRLPPNLPENIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYVEFTT  89

Query  448  PEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYLEFL  627
            PE +V F   +NGHVF +++G++   +VEYAP Q+ P +  K D + G I  D ++  FL
Sbjct  90   PEAIVVFNRGYNGHVFRDKQGNESAAVVEYAPYQKVPHEKRKADAKSGTIEADEDFNSFL  149

Query  628  EFIGKPV  648
            E + KP 
Sbjct  150  ESLNKPA  156



>dbj|GAN09940.1| conserved hypothetical protein [Mucor ambiguus]
Length=416

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 77/126 (61%), Gaps = 4/126 (3%)
 Frame = +1

Query  271  PLDRTKIVLRHLPPALPRSTLSEQIDSRFS-GRYHWLSFRPGKTSQ---KHQPYSRAYIN  438
            P  +TK+V+R LPP LP    +  +    S     +  + PGK S+   K   +SRAY +
Sbjct  53   PTLKTKVVVRRLPPNLPEEIFNTSVKPWISEDTVDYSVYVPGKLSKSKAKESIFSRAYFH  112

Query  439  FKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYL  618
            FKT E V+ F + ++GHVFV+ +G++F+ +VE+A  Q+ P++    D R+G I +D +YL
Sbjct  113  FKTMEAVIAFHQGYDGHVFVDSRGNEFRAVVEFALYQKIPKEHKTADTRQGTIDEDQDYL  172

Query  619  EFLEFI  636
            +FLE +
Sbjct  173  DFLESL  178



>ref|XP_007872945.1| hypothetical protein PNEG_01033 [Pneumocystis murina B123]
 gb|EMR10886.1| hypothetical protein PNEG_01033 [Pneumocystis murina B123]
Length=410

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 4/126 (3%)
 Frame = +1

Query  280  RTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTS---QKHQPYSRAYINFKTP  450
            R K+V+R+LP  L        +    S    W SF PGK S    K+  + RAYI FK+P
Sbjct  22   RLKVVVRYLPCNLSEQEFKNSVKEWISEEIEWFSFFPGKISTNRSKNDRHGRAYIKFKSP  81

Query  451  EDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPR-QWSKKDGREGAILKDPEYLEFL  627
            E ++ F +  N H+F +EK  + +  VE+AP Q+ PR +  K D R+G I +DPE++ F 
Sbjct  82   EALITFYKGINKHLFTDEKNKEQRVFVEFAPFQKIPRVEKQKHDIRQGTIDEDPEFITFQ  141

Query  628  EFIGKP  645
            E +  P
Sbjct  142  ETLKNP  147



>gb|KEP50606.1| Smg-4/UPF3 family protein [Rhizoctonia solani 123E]
Length=821

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 72/131 (55%), Gaps = 4/131 (3%)
 Frame = +1

Query  268  GPLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYH-WLSFRPGKTSQK---HQPYSRAYI  435
            G   R K+V+R LPP LP +   + +    +     W  + PGK   K       SRAY+
Sbjct  380  GNTPRLKVVVRRLPPNLPETIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYV  439

Query  436  NFKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEY  615
             F TPE VV F   +NGHVF +++G++   +VEYAP Q+ P +  K DG+ G I  D ++
Sbjct  440  EFTTPEAVVVFNRDYNGHVFRDKQGNESVVVVEYAPYQKVPHEKRKADGKIGTIEADEDF  499

Query  616  LEFLEFIGKPV  648
            + FLE + KP 
Sbjct  500  ISFLEALNKPA  510



>emb|CEI89159.1| hypothetical protein RMCBS344292_03527 [Rhizopus microsporus]
Length=350

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (60%), Gaps = 4/126 (3%)
 Frame = +1

Query  271  PLDRTKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSF-RPGK---TSQKHQPYSRAYIN  438
            P  +TK+V+R LPP L    L E +    + +    SF  PGK   +  K   +SRAY +
Sbjct  37   PTLKTKVVVRRLPPLLQEDALMEAVKPWINEQTTDYSFFVPGKIPKSKGKENIFSRAYFH  96

Query  439  FKTPEDVVEFAEFFNGHVFVNEKGSQFKTIVEYAPLQRAPRQWSKKDGREGAILKDPEYL  618
             KT E V+ F + F+G +F + +G++ + +VE+AP Q+ P++    D R+G I +DP+Y+
Sbjct  97   LKTMEAVIAFHQGFDGRLFTDSRGNESRAVVEFAPYQKIPKEHKTTDSRQGTIDEDPDYV  156

Query  619  EFLEFI  636
            EFL F+
Sbjct  157  EFLNFL  162



>ref|XP_006909398.1| PREDICTED: regulator of nonsense transcripts 3A isoform X1 [Pteropus 
alecto]
Length=349

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +1

Query  283  TKIVLRHLPPALPRSTLSEQIDSRFSGRYHWLSFRPGKTSQKHQPYSRAYINFKTPEDVV  462
            +K+V+R LPP+L +  L EQ+    +  + +  F     S     YSRAYINF+ P+D++
Sbjct  68   SKVVIRRLPPSLTKEQLEEQLHPLPA--HDYFEFFTADLSLYPHLYSRAYINFRNPDDIL  125

Query  463  EFAEFFNGHVFVNEKGSQFKTIVEYAPLQR-APRQWSKKDGREGAILKDPEYLEFLE  630
             F + F+G++F++ KG ++  +VE+AP Q+ A R+  KKD + G+I  D EY  FLE
Sbjct  126  LFRDRFDGYIFIDNKGLEYPAVVEFAPFQKIAKRRLKKKDAKTGSIEGDLEYKRFLE  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1063448340092