BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1190

Length=817
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589785.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    393   2e-132   Nicotiana tomentosiformis
ref|XP_009589784.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    392   6e-131   Nicotiana tomentosiformis
ref|XP_010097724.1|  Ent-kaurenoic acid oxidase 1                       384   1e-127   Morus notabilis
ref|XP_010323137.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    380   2e-127   Solanum lycopersicum
ref|XP_006354607.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       383   3e-127   Solanum tuberosum [potatoes]
gb|EYU40296.1|  hypothetical protein MIMGU_mgv1a006460mg                380   5e-127   Erythranthe guttata [common monkey flower]
gb|EYU42301.1|  hypothetical protein MIMGU_mgv1a005890mg                379   6e-126   Erythranthe guttata [common monkey flower]
ref|XP_004229509.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    379   7e-126   Solanum lycopersicum
ref|XP_011085042.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       377   3e-125   Sesamum indicum [beniseed]
ref|XP_010269971.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       374   1e-123   Nelumbo nucifera [Indian lotus]
gb|AEF32085.1|  ent-kaurenoic acid oxidase                              373   2e-123   Castanea mollissima
gb|AJD25209.1|  cytochrome P450 CYP88A52                                371   8e-123   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006445516.1|  hypothetical protein CICLE_v10019986mg             370   2e-122   
ref|XP_008375674.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       367   7e-122   
gb|KDO85362.1|  hypothetical protein CISIN_1g010697mg                   369   7e-122   Citrus sinensis [apfelsine]
ref|XP_006464339.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       369   9e-122   Citrus sinensis [apfelsine]
ref|XP_002264215.1|  PREDICTED: ent-kaurenoic acid oxidase 1            368   1e-121   Vitis vinifera
ref|XP_009376861.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       367   4e-121   Pyrus x bretschneideri [bai li]
gb|AGF25266.1|  ent-kaurenoic acid oxidase                              367   4e-121   Pyrus communis
ref|XP_006375612.1|  hypothetical protein POPTR_0014s17720g             364   5e-121   
ref|XP_009347589.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       367   5e-121   
ref|XP_010275286.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       367   5e-121   Nelumbo nucifera [Indian lotus]
gb|AGZ93669.1|  ent-kaurene acid oxidase                                366   2e-120   Malus domestica [apple tree]
ref|XP_008354800.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       365   3e-120   
gb|AGI65630.1|  ent-kaurenoic acid oxidase                              365   4e-120   Malus domestica [apple tree]
emb|CDP09340.1|  unnamed protein product                                365   4e-120   Coffea canephora [robusta coffee]
ref|XP_007218023.1|  hypothetical protein PRUPE_ppa005937mg             362   1e-119   
ref|XP_011093453.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       363   1e-119   Sesamum indicum [beniseed]
emb|CDP09339.1|  unnamed protein product                                363   1e-119   Coffea canephora [robusta coffee]
ref|XP_011656712.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       362   2e-119   Cucumis sativus [cucumbers]
ref|XP_012083781.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    362   3e-119   Jatropha curcas
gb|KCW76778.1|  hypothetical protein EUGRSUZ_D01134                     362   3e-119   Eucalyptus grandis [rose gum]
ref|XP_010052709.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       362   4e-119   
ref|XP_002526524.1|  Ent-kaurenoic acid oxidase, putative               362   4e-119   Ricinus communis
emb|CBV36747.1|  ent-kaurenoic acid oxidase                             360   3e-118   Helianthus annuus
emb|CDP09338.1|  unnamed protein product                                360   4e-118   Coffea canephora [robusta coffee]
emb|CDP09336.1|  unnamed protein product                                360   4e-118   Coffea canephora [robusta coffee]
ref|XP_011013095.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       359   6e-118   Populus euphratica
ref|XP_008460072.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       355   1e-117   
gb|EPS65596.1|  hypothetical protein M569_09175                         357   2e-117   Genlisea aurea
dbj|BAG71199.1|  ent-kaurenoic acid oxidase                             357   3e-117   Lactuca sativa [cultivated lettuce]
emb|CBI16745.3|  unnamed protein product                                355   5e-117   Vitis vinifera
ref|XP_012084984.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       356   1e-116   Jatropha curcas
gb|KJB67442.1|  hypothetical protein B456_010G190900                    355   2e-116   Gossypium raimondii
ref|XP_002265630.1|  PREDICTED: ent-kaurenoic acid oxidase 2            353   9e-116   Vitis vinifera
ref|XP_008438234.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       353   2e-115   Cucumis melo [Oriental melon]
ref|XP_011010024.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    352   2e-115   Populus euphratica
ref|XP_010941218.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       352   2e-115   Elaeis guineensis
ref|XP_004308741.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       351   7e-115   Fragaria vesca subsp. vesca
ref|XP_010457593.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    350   2e-114   
ref|XP_008232238.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       350   2e-114   Prunus mume [ume]
ref|XP_007008706.1|  Cytochrome P450, family 88, subfamily A, pol...    350   2e-114   
ref|XP_007217929.1|  hypothetical protein PRUPE_ppa004901mg             349   4e-114   
ref|XP_010556999.1|  PREDICTED: ent-kaurenoic acid oxidase 1            349   5e-114   Tarenaya hassleriana [spider flower]
ref|XP_010691953.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       348   6e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007008707.1|  Ent-kaurenoic acid oxidase 1 isoform 2             350   7e-114   
ref|XP_006307341.1|  hypothetical protein CARUB_v10008960mg             348   8e-114   Capsella rubella
ref|XP_007039941.1|  Cytochrome P450, family 88, subfamily A, pol...    348   1e-113   
ref|XP_007217930.1|  hypothetical protein PRUPE_ppa004910mg             347   2e-113   
ref|XP_008232229.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       347   3e-113   Prunus mume [ume]
gb|KFK31124.1|  hypothetical protein AALP_AA6G071000                    347   4e-113   Arabis alpina [alpine rockcress]
ref|XP_008232239.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       347   4e-113   Prunus mume [ume]
ref|NP_172008.1|  ent-kaurenoic acid oxidase 1                          347   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892270.1|  ent-kaurenoic acid hydroxylase 1                   347   4e-113   
ref|XP_009420467.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       346   8e-113   
ref|XP_004307312.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       346   1e-112   Fragaria vesca subsp. vesca
ref|XP_010475187.1|  PREDICTED: ent-kaurenoic acid oxidase 1            345   1e-112   
ref|XP_004133946.1|  PREDICTED: ent-kaurenoic acid oxidase 1            346   1e-112   Cucumis sativus [cucumbers]
ref|XP_010457591.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    345   1e-112   
ref|XP_007219798.1|  hypothetical protein PRUPE_ppa026558mg             345   2e-112   
ref|XP_006418058.1|  hypothetical protein EUTSA_v10009356mg             345   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_010510017.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    340   3e-112   
ref|XP_008788752.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       342   4e-112   
ref|XP_006410376.1|  hypothetical protein EUTSA_v10016575mg             343   7e-112   Eutrema salsugineum [saltwater cress]
emb|CDY48265.1|  BnaA05g10890D                                          343   8e-112   Brassica napus [oilseed rape]
emb|CDY49505.1|  BnaC05g03170D                                          343   8e-112   Brassica napus [oilseed rape]
ref|XP_009143990.1|  PREDICTED: ent-kaurenoic acid oxidase 2            343   8e-112   
ref|XP_010691952.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       343   8e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008799425.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       342   1e-111   
gb|AAK11564.1|AF318500_1  ent-kaurenoic acid hydroxylase                342   2e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AAG41777.1|AF212991_1  ent-kaurenoic acid oxidase                    342   2e-111   Cucurbita maxima [Boston marrow]
ref|XP_007147426.1|  hypothetical protein PHAVU_006G123600g             341   4e-111   Phaseolus vulgaris [French bean]
ref|XP_002319447.1|  ent-kaurenoic acid oxidase family protein          341   4e-111   
gb|KHN14287.1|  Ent-kaurenoic acid oxidase 2                            341   5e-111   Glycine soja [wild soybean]
ref|XP_003546291.1|  PREDICTED: ent-kaurenoic acid oxidase 2            341   5e-111   Glycine max [soybeans]
ref|XP_009119194.1|  PREDICTED: ent-kaurenoic acid oxidase 1            341   7e-111   Brassica rapa
ref|XP_002879389.1|  ent-kaurenoic acid hydroxylase                     340   2e-110   
ref|XP_010934998.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       339   3e-110   Elaeis guineensis
ref|XP_009392783.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       339   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010228115.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    337   4e-110   
ref|XP_010469584.1|  PREDICTED: ent-kaurenoic acid oxidase 2            339   4e-110   
ref|XP_011469589.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       341   5e-110   Fragaria vesca subsp. vesca
ref|XP_006847688.1|  PREDICTED: ent-kaurenoic acid oxidase 2            338   7e-110   Amborella trichopoda
ref|XP_010510015.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    338   8e-110   Camelina sativa [gold-of-pleasure]
ref|XP_007219847.1|  hypothetical protein PRUPE_ppa027023mg             338   9e-110   Prunus persica
ref|XP_006294074.1|  hypothetical protein CARUB_v10023069mg             338   1e-109   Capsella rubella
ref|XP_004486502.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       337   1e-109   Cicer arietinum [garbanzo]
ref|XP_010413993.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       337   2e-109   Camelina sativa [gold-of-pleasure]
gb|KEH37115.1|  cytochrome P450 family ent-kaurenoic acid oxidase       337   2e-109   Medicago truncatula
ref|XP_004486504.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    337   2e-109   Cicer arietinum [garbanzo]
ref|XP_004486505.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    337   2e-109   
gb|KEH37116.1|  cytochrome P450 family ent-kaurenoic acid oxidase       337   2e-109   Medicago truncatula
ref|XP_007147425.1|  hypothetical protein PHAVU_006G123500g             337   2e-109   Phaseolus vulgaris [French bean]
ref|NP_180803.1|  Ent-kaurenoic acid oxidase 2                          336   5e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AAO23063.1|  ent-kaurenoic acid oxidase                              335   7e-109   Pisum sativum [garden pea]
emb|CBV36748.1|  ent-kaurenoic acid oxidase                             335   8e-109   Helianthus annuus
ref|XP_008660301.1|  PREDICTED: cytochrome P450 88A1-like               335   1e-108   
gb|ACE76904.1|  ent-kaurenoic acid oxidase                              332   1e-108   Leersia tisserantii
ref|XP_008659025.1|  PREDICTED: cytochrome P450 88A1 isoform X1         333   1e-108   Zea mays [maize]
emb|CDY12205.1|  BnaC04g12350D                                          335   2e-108   Brassica napus [oilseed rape]
gb|AAK11565.1|AF318501_1  ent-kaurenoic acid hydroxylase                334   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003561220.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    334   3e-108   Brachypodium distachyon [annual false brome]
gb|ACE76902.1|  ent-kaurenoic acid oxidase                              331   4e-108   Oryza brachyantha
gb|EMS55313.1|  Ent-kaurenoic acid oxidase 1                            332   6e-108   Triticum urartu
gb|ACE76903.1|  ent-kaurenoic acid oxidase                              329   2e-107   Oryza meyeriana var. granulata
ref|XP_002436354.1|  hypothetical protein SORBIDRAFT_10g000920          332   3e-107   Sorghum bicolor [broomcorn]
ref|XP_006655700.1|  PREDICTED: cytochrome P450 88A1-like               330   3e-107   
ref|NP_001105586.1|  cytochrome P450 88A1                               332   5e-107   Zea mays [maize]
ref|XP_003533093.1|  PREDICTED: ent-kaurenoic acid oxidase 2            331   6e-107   Glycine max [soybeans]
gb|ACE76899.1|  ent-kaurenoic acid oxidase                              327   8e-107   Oryza punctata
gb|ADZ55288.1|  ent-kaurene acid oxidase                                330   1e-106   Triticum aestivum [Canadian hard winter wheat]
emb|CBY78887.1|  KAO protein                                            330   1e-106   Aegilops speltoides
gb|ADZ55287.1|  ent-kaurene acid oxidase                                330   2e-106   Triticum aestivum [Canadian hard winter wheat]
gb|ACU44686.1|  ent-kaurenoic acid oxidase                              321   2e-106   Triticum aestivum [Canadian hard winter wheat]
gb|ACE76900.1|  ent-kaurenoic acid oxidase                              325   3e-106   Oryza officinalis
gb|ACV91868.1|  KAO1                                                    329   3e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q9AXH9.1|KAO1_HORVU  RecName: Full=Ent-kaurenoic acid oxidase ...    329   3e-106   Hordeum vulgare [barley]
gb|ACE76901.1|  ent-kaurenoic acid oxidase                              325   5e-106   Oryza australiensis
gb|ACE76898.1|  ent-kaurenoic acid oxidase                              325   6e-106   Oryza rufipogon [common wild rice]
gb|ADK62526.1|  ent-kaurenoic acid oxidase                              328   7e-106   Triticum aestivum [Canadian hard winter wheat]
gb|ACU44682.1|  ent-kaurenoic acid oxidase                              317   9e-105   Triticum aestivum [Canadian hard winter wheat]
gb|ACU44680.1|  ent-kaurenoic acid oxidase                              316   2e-104   Triticum aestivum [Canadian hard winter wheat]
gb|EEC73049.1|  hypothetical protein OsI_07000                          325   2e-104   Oryza sativa Indica Group [Indian rice]
ref|NP_001056579.1|  Os06g0110000                                       324   3e-104   
emb|CBY78885.1|  KAO protein                                            323   4e-104   Triticum urartu
ref|XP_010104358.1|  Ent-kaurenoic acid oxidase 2                       323   6e-104   
ref|XP_003581683.2|  PREDICTED: ent-kaurenoic acid oxidase 1-like       323   8e-104   
emb|CBY78889.1|  KAO protein                                            320   1e-102   Aegilops tauschii
gb|AAO23064.1|  ent-kaurenoic acid oxidase                              319   2e-102   Pisum sativum [garden pea]
emb|CBV36749.1|  ent-kaurenoic acid oxidase                             315   6e-101   Helianthus annuus
ref|XP_003580920.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       315   7e-101   Brachypodium distachyon [annual false brome]
ref|XP_004980663.1|  PREDICTED: cytochrome P450 88A1-like               313   1e-99    
ref|XP_004973029.1|  PREDICTED: cytochrome P450 88A1-like               312   1e-99    Setaria italica
ref|XP_007209946.1|  hypothetical protein PRUPE_ppa004753mg             311   2e-99    Prunus persica
ref|XP_008238293.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       311   3e-99    Prunus mume [ume]
gb|ABY49060.1|  ent-kaurenoic acid oxidase                              305   2e-98    Luziola fluitans [southern watergrass]
gb|ABY49059.1|  ent-kaurenoic acid oxidase                              304   2e-98    Rhynchoryza subulata
ref|XP_007209137.1|  hypothetical protein PRUPE_ppa005745mg             307   3e-98    
gb|ABY49058.1|  ent-kaurenoic acid oxidase                              303   5e-98    Chikusichloa aquatica
ref|XP_008238332.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       307   8e-98    Prunus mume [ume]
gb|KJB25352.1|  hypothetical protein B456_004G187300                    303   3e-97    Gossypium raimondii
ref|XP_003516638.1|  PREDICTED: beta-amyrin 11-oxidase-like             305   9e-97    
gb|ABY49057.1|  ent-kaurenoic acid oxidase                              299   1e-96    Leersia perrieri
ref|XP_008356451.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       304   2e-96    Malus domestica [apple tree]
ref|XP_004301697.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       304   2e-96    Fragaria vesca subsp. vesca
ref|XP_009373442.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    303   2e-96    
ref|XP_007156654.1|  hypothetical protein PHAVU_002G005900g             303   2e-96    Phaseolus vulgaris [French bean]
ref|XP_009373441.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    304   2e-96    
gb|KJB25353.1|  hypothetical protein B456_004G187300                    302   3e-96    Gossypium raimondii
gb|KJB25350.1|  hypothetical protein B456_004G187300                    301   1e-95    Gossypium raimondii
gb|KHG22736.1|  Cytochrome P450                                         301   1e-95    Gossypium arboreum [tree cotton]
gb|ABY49055.1|  ent-kaurenoic acid oxidase                              297   2e-95    Oryza meridionalis [Australian wild rice]
gb|ABY49053.1|  ent-kaurenoic acid oxidase                              296   2e-95    Oryza glumipatula
gb|ABY49048.1|  ent-kaurenoic acid oxidase                              296   2e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010677318.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       301   2e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|AAT28221.1|  putative ent-Kaurenoic acid hydroxylase-like cyto...    298   2e-94    Ginkgo biloba [ginkgo]
ref|XP_003611463.1|  Cytochrome P450 ent-kaurenoic acid oxidase         297   6e-94    
gb|AHW42467.1|  KAO2                                                    297   7e-94    Pinus tabuliformis [southern Chinese pine]
ref|XP_004512204.1|  PREDICTED: beta-amyrin 11-oxidase-like             297   7e-94    
ref|XP_004510262.1|  PREDICTED: beta-amyrin 11-oxidase-like             297   7e-94    Cicer arietinum [garbanzo]
gb|ABY49056.1|  ent-kaurenoic acid oxidase                              293   7e-94    Oryza eichingeri
gb|KEH37117.1|  cytochrome P450 family ent-kaurenoic acid oxidase       295   3e-93    Medicago truncatula
ref|XP_009797769.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       284   7e-93    Nicotiana sylvestris
ref|XP_006436761.1|  hypothetical protein CICLE_v10031341mg             294   1e-92    Citrus clementina [clementine]
ref|XP_010053585.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       294   1e-92    Eucalyptus grandis [rose gum]
gb|KDO44740.1|  hypothetical protein CISIN_1g011210mg                   293   3e-92    Citrus sinensis [apfelsine]
gb|KJB25351.1|  hypothetical protein B456_004G187300                    293   3e-92    Gossypium raimondii
ref|XP_010053588.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    292   3e-92    Eucalyptus grandis [rose gum]
ref|XP_010053587.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    292   5e-92    Eucalyptus grandis [rose gum]
ref|XP_010053586.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       291   1e-91    Eucalyptus grandis [rose gum]
gb|KGN46277.1|  hypothetical protein Csa_6G079220                       289   4e-91    Cucumis sativus [cucumbers]
ref|XP_004510263.1|  PREDICTED: beta-amyrin 11-oxidase-like             290   5e-91    Cicer arietinum [garbanzo]
gb|KEH20767.1|  cytochrome P450 family 88 protein                       288   2e-90    Medicago truncatula
dbj|BAG68926.1|  cytochrome P450 88D3                                   288   2e-90    Medicago truncatula
gb|EEE64964.1|  hypothetical protein OsJ_19857                          296   2e-90    Oryza sativa Japonica Group [Japonica rice]
gb|KJB78703.1|  hypothetical protein B456_013G013700                    283   7e-90    Gossypium raimondii
ref|XP_006436762.1|  hypothetical protein CICLE_v10032478mg             279   1e-89    
ref|XP_007039557.1|  Ent-kaurenoic acid hydroxylase 2                   286   2e-89    
ref|XP_003611462.1|  Cytochrome P450 ent-kaurenoic acid oxidase         285   3e-89    
sp|B5BSX1.1|BAMO_GLYUR  RecName: Full=Beta-amyrin 11-oxidase; Alt...    284   9e-89    Glycyrrhiza uralensis [Chinese licorice]
ref|XP_010042023.1|  PREDICTED: beta-amyrin 11-oxidase-like             283   3e-88    
ref|XP_011652889.1|  PREDICTED: beta-amyrin 11-oxidase-like             283   3e-88    Cucumis sativus [cucumbers]
emb|CDP12987.1|  unnamed protein product                                280   6e-87    Coffea canephora [robusta coffee]
gb|ABY49061.1|  ent-kaurenoic acid oxidase                              274   8e-87    Ehrharta erecta
gb|KCW77910.1|  hypothetical protein EUGRSUZ_D02168                     278   2e-86    Eucalyptus grandis [rose gum]
gb|KDO44741.1|  hypothetical protein CISIN_1g011343mg                   278   2e-86    Citrus sinensis [apfelsine]
ref|XP_006485427.1|  PREDICTED: beta-amyrin 11-oxidase-like             278   2e-86    Citrus sinensis [apfelsine]
ref|XP_008465946.1|  PREDICTED: beta-amyrin 11-oxidase-like             278   3e-86    Cucumis melo [Oriental melon]
dbj|BAG68927.1|  cytochrome P450 88D4                                   274   5e-85    Lotus japonicus
dbj|BAG68928.1|  cytochrome P450 88D5                                   273   2e-84    Lotus japonicus
gb|EMT30414.1|  Ent-kaurenoic acid oxidase 1                            268   1e-83    
gb|KGN56650.1|  hypothetical protein Csa_3G127130                       270   1e-83    Cucumis sativus [cucumbers]
ref|XP_008448719.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    266   2e-83    Cucumis melo [Oriental melon]
ref|XP_008448718.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    267   5e-83    Cucumis melo [Oriental melon]
ref|XP_006485429.1|  PREDICTED: beta-amyrin 11-oxidase-like             268   2e-82    Citrus sinensis [apfelsine]
ref|XP_007039555.1|  Cytochrome P450 88D6, putative                     270   2e-82    
ref|XP_008448717.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    265   2e-81    Cucumis melo [Oriental melon]
gb|KCW77919.1|  hypothetical protein EUGRSUZ_D021732                    264   3e-81    Eucalyptus grandis [rose gum]
ref|XP_008448720.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    264   4e-81    Cucumis melo [Oriental melon]
gb|KJB25349.1|  hypothetical protein B456_004G187200                    264   4e-81    Gossypium raimondii
ref|XP_009624147.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    259   2e-79    
ref|XP_004510261.1|  PREDICTED: beta-amyrin 11-oxidase-like             257   2e-78    Cicer arietinum [garbanzo]
ref|XP_003604124.1|  Ent-kaurenoic acid oxidase                         256   4e-78    
gb|KDO85363.1|  hypothetical protein CISIN_1g010697mg                   254   1e-77    Citrus sinensis [apfelsine]
gb|AFK35039.1|  unknown                                                 250   1e-77    Medicago truncatula
gb|KCW77922.1|  hypothetical protein EUGRSUZ_D02177                     254   3e-77    Eucalyptus grandis [rose gum]
ref|XP_004510260.1|  PREDICTED: beta-amyrin 11-oxidase-like             253   1e-76    Cicer arietinum [garbanzo]
dbj|BAN15044.1|  putative cytochrome P450 monooxygenase CYP88D8         252   1e-76    Astragalus sinicus
dbj|BAN15043.1|  putative cytochrome P450 monooxygenase CYP88D7         252   1e-76    Astragalus sinicus
gb|KEH18187.1|  cytochrome P450 family 88 protein                       250   1e-75    Medicago truncatula
dbj|BAQ20602.1|  ent-kaurenoic acid oxidase 1                           251   1e-75    Lygodium japonicum
dbj|BAG68925.1|  cytochrome P450 88D2                                   249   3e-75    Medicago truncatula
emb|CDP21969.1|  unnamed protein product                                247   4e-75    Coffea canephora [robusta coffee]
gb|AAL50601.1|  DWARF3                                                  243   3e-74    Zea mays [maize]
gb|AAL50595.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50620.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50591.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50583.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50574.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50586.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50615.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50597.1|  DWARF3                                                  243   4e-74    Zea mays [maize]
gb|AAL50593.1|  DWARF3                                                  243   5e-74    Zea mays [maize]
gb|AAL50589.1|  DWARF3                                                  243   5e-74    Zea mays [maize]
gb|AAL50596.1|  DWARF3                                                  243   5e-74    Zea mays [maize]
gb|AAL50579.1|  DWARF3                                                  243   5e-74    Zea mays [maize]
gb|AAL50580.1|  DWARF3                                                  243   5e-74    Zea mays [maize]
gb|AAL50608.1|  DWARF3                                                  243   5e-74    Zea mays [maize]
gb|AAL50585.1|  DWARF3                                                  243   6e-74    Zea mays [maize]
gb|AAL50594.1|  DWARF3                                                  243   6e-74    Zea mays [maize]
gb|AAL50619.1|  DWARF3                                                  243   6e-74    Zea mays [maize]
gb|AAL50592.1|  DWARF3                                                  243   6e-74    Zea mays [maize]
gb|AAL50604.1|  DWARF3                                                  243   6e-74    Zea mays [maize]
gb|AAL50616.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
gb|AAL50612.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
gb|AAL50611.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
gb|AAL50577.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
gb|AAL50576.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
gb|AAL50575.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
gb|AAL50602.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
gb|AAL50578.1|  DWARF3                                                  242   1e-73    Zea mays [maize]
ref|XP_002321248.2|  ent-kaurenoic acid oxidase family protein          245   2e-73    
gb|AAL50584.1|  DWARF3                                                  241   2e-73    Zea mays [maize]
gb|KJB37700.1|  hypothetical protein B456_006G216200                    243   3e-73    Gossypium raimondii
gb|AAL50581.1|  DWARF3                                                  241   4e-73    Zea mays [maize]
gb|AAL50600.1|  DWARF3                                                  240   5e-73    Zea mays [maize]
gb|AAL50573.1|  DWARF3                                                  240   5e-73    Zea mays [maize]
gb|AAL50606.1|  DWARF3                                                  240   5e-73    Zea mays [maize]
gb|AAL50582.1|  DWARF3                                                  240   6e-73    Zea mays [maize]
gb|AAL50599.1|  DWARF3                                                  240   6e-73    Zea mays [maize]
gb|AAL50607.1|  DWARF3                                                  240   7e-73    Zea mays [maize]
gb|AAL50587.1|  DWARF3                                                  239   1e-72    Zea mays [maize]
gb|AAL50605.1|  DWARF3                                                  238   3e-72    Zea mays [maize]
gb|AAL50609.1|  DWARF3                                                  238   4e-72    Zea mays [maize]
gb|AAL50610.1|  DWARF3                                                  238   4e-72    Zea mays [maize]
ref|XP_011010022.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    240   1e-71    Populus euphratica
ref|XP_004148755.2|  PREDICTED: beta-amyrin 11-oxidase-like             237   2e-71    Cucumis sativus [cucumbers]
ref|XP_008448712.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    238   4e-71    Cucumis melo [Oriental melon]
ref|XP_008448714.1|  PREDICTED: beta-amyrin 11-oxidase-like             238   5e-71    Cucumis melo [Oriental melon]
ref|XP_011650352.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    236   2e-70    Cucumis sativus [cucumbers]
gb|KDO42210.1|  hypothetical protein CISIN_1g012524mg                   235   3e-70    Citrus sinensis [apfelsine]
gb|ACU44684.1|  ent-kaurenoic acid oxidase                              224   5e-70    Triticum aestivum [Canadian hard winter wheat]
gb|ACU44681.1|  ent-kaurenoic acid oxidase                              223   2e-69    Triticum aestivum [Canadian hard winter wheat]
gb|AAL50621.1|  DWARF3                                                  231   2e-69    Zea mays [maize]
gb|KEH40663.1|  cytochrome P450 family 88 protein                       231   1e-68    Medicago truncatula
ref|XP_011652660.1|  PREDICTED: beta-amyrin 11-oxidase-like             229   1e-67    Cucumis sativus [cucumbers]
ref|XP_004148514.2|  PREDICTED: beta-amyrin 11-oxidase-like             225   3e-66    Cucumis sativus [cucumbers]
ref|XP_004148515.2|  PREDICTED: beta-amyrin 11-oxidase-like             219   5e-64    Cucumis sativus [cucumbers]
gb|KDO42211.1|  hypothetical protein CISIN_1g012524mg                   217   2e-63    Citrus sinensis [apfelsine]
ref|XP_002975682.1|  ent-Kaurenoic acid hydroxylase                     216   9e-63    
ref|XP_002993510.1|  hypothetical protein SELMODRAFT_1840               215   1e-62    
ref|XP_011652661.1|  PREDICTED: beta-amyrin 11-oxidase-like             215   2e-62    
ref|XP_002988455.1|  kaurenoic acid oxidase                             214   4e-62    
ref|XP_008466645.1|  PREDICTED: beta-amyrin 11-oxidase-like             211   3e-61    
ref|XP_002966472.1|  kaurenoic acid oxidase                             211   9e-61    
dbj|BAD93885.1|  putative cytochrome P450                               207   7e-60    
ref|XP_002982048.1|  hypothetical protein SELMODRAFT_115926             208   1e-59    
emb|CDP14871.1|  unnamed protein product                                196   1e-57    
gb|EMT11887.1|  Ent-kaurenoic acid oxidase 1                            195   2e-56    
ref|XP_010327257.1|  PREDICTED: beta-amyrin 11-oxidase-like             194   5e-56    
ref|XP_006662308.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       194   1e-55    
ref|XP_008665991.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       198   1e-55    
ref|XP_009776835.1|  PREDICTED: beta-amyrin 11-oxidase-like             194   2e-55    
gb|ABB47392.1|  Cytochrome P450 family protein, expressed               196   4e-55    
ref|XP_010054832.1|  PREDICTED: beta-amyrin 11-oxidase-like             186   5e-55    
ref|NP_001064479.1|  Os10g0378100                                       196   6e-55    
gb|EEC66846.1|  hypothetical protein OsI_33321                          195   8e-55    
gb|EMS63102.1|  Ent-kaurenoic acid oxidase 1                            190   1e-54    
ref|XP_010933628.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       194   3e-54    
gb|EMS51480.1|  Ent-kaurenoic acid oxidase 1                            190   3e-54    
dbj|BAJ98009.1|  predicted protein                                      194   4e-54    
dbj|BAJ95047.1|  predicted protein                                      194   4e-54    
ref|XP_010935390.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       193   4e-54    
ref|XP_012080198.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       193   6e-54    
gb|AAZ39647.1|  cytochrome P450 monooxygenase                           192   6e-54    
ref|XP_010935406.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       192   9e-54    
ref|XP_011071758.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       194   1e-53    
ref|XP_012083782.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    189   2e-53    
gb|EMT14310.1|  Ent-kaurenoic acid oxidase 1                            191   4e-53    
ref|XP_004976419.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       191   5e-53    
ref|XP_009348190.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       190   5e-53    
gb|EMT01609.1|  Ent-kaurenoic acid oxidase 1                            191   5e-53    
gb|EMT03540.1|  Ent-kaurenoic acid oxidase 1                            189   2e-52    
ref|XP_008797526.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       188   2e-52    
ref|XP_011465715.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       188   3e-52    
ref|XP_011621727.1|  PREDICTED: ent-kaurenoic acid oxidase 1            188   3e-52    
gb|EMT11997.1|  Ent-kaurenoic acid oxidase 1                            186   4e-52    
ref|XP_010677093.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       188   5e-52    
gb|ERM94634.1|  hypothetical protein AMTR_s00011p00192370               188   5e-52    
ref|XP_011042615.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       185   2e-51    
ref|XP_010926147.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       186   2e-51    
ref|XP_006878489.2|  PREDICTED: ent-kaurenoic acid oxidase 2            187   2e-51    
gb|KCW49377.1|  hypothetical protein EUGRSUZ_K02919                     185   3e-51    
ref|XP_010677090.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    186   3e-51    
ref|XP_010037638.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       186   3e-51    
ref|XP_004301171.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       184   4e-51    
ref|XP_009369418.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     180   8e-51    
ref|XP_007039942.1|  Cytochrome P450, family 88, subfamily A, pol...    182   9e-51    
ref|XP_008807889.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       184   1e-50    
ref|XP_010313690.1|  PREDICTED: ent-kaurenoic acid oxidase 2            184   2e-50    
gb|EYU35888.1|  hypothetical protein MIMGU_mgv1a023958mg                183   2e-50    
gb|KCW49383.1|  hypothetical protein EUGRSUZ_K02924                     181   3e-50    
ref|XP_006351981.1|  PREDICTED: beta-amyrin 11-oxidase-like             183   5e-50    
ref|XP_009624148.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    181   5e-50    
dbj|BAD51457.1|  ent-kaurenoic acid oxidase                             171   5e-50    
emb|CDP17342.1|  unnamed protein product                                182   9e-50    
ref|XP_002318613.2|  hypothetical protein POPTR_0012s07300g             181   1e-49    
ref|XP_006376822.1|  hypothetical protein POPTR_0012s07310g             181   1e-49    
gb|AFK48792.1|  unknown                                                 170   3e-49    
ref|XP_003578492.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       181   4e-49    
ref|XP_010037639.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       180   4e-49    
ref|XP_009343459.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       180   4e-49    
ref|XP_003581044.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       179   9e-49    
ref|XP_008239868.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       177   5e-48    
gb|AIT72035.1|  cytochrome P450                                         176   6e-48    
ref|XP_008374917.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       175   9e-48    
gb|KGN55785.1|  hypothetical protein Csa_3G011860                       173   2e-47    
ref|XP_010935398.1|  PREDICTED: LOW QUALITY PROTEIN: ent-kaurenoi...    176   3e-47    
gb|KEH17085.1|  cytochrome P450 family 90 protein                       172   5e-47    
ref|XP_007210937.1|  hypothetical protein PRUPE_ppa025181mg             174   7e-47    
gb|EAY78272.1|  hypothetical protein OsI_33319                          173   2e-46    
ref|XP_009358120.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       172   3e-46    
gb|KEH17084.1|  cytochrome P450 family 90 protein                       172   5e-46    
gb|EAZ15890.1|  hypothetical protein OsJ_31312                          169   5e-45    
gb|KEH17086.1|  cytochrome P450 family 90 protein                       166   4e-44    
ref|XP_006436759.1|  hypothetical protein CICLE_v10033793mg             157   4e-44    
gb|EMT14981.1|  Ent-kaurenoic acid oxidase 1                            166   7e-44    
emb|CDP14032.1|  unnamed protein product                                162   2e-43    
ref|XP_002980421.1|  hypothetical protein SELMODRAFT_112223             163   5e-43    
ref|XP_002311214.1|  hypothetical protein POPTR_0008s06740g             162   1e-42    
ref|XP_002962673.1|  hypothetical protein SELMODRAFT_77991              161   3e-42    
ref|XP_003611461.1|  Ent-kaurenoic acid oxidase                         151   6e-42    
ref|XP_010045569.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       156   6e-42    
ref|XP_006848201.1|  PREDICTED: cytochrome P450 90A1                    160   8e-42    
ref|XP_011044517.1|  PREDICTED: cytochrome P450 90A1-like               159   2e-41    
ref|XP_012087583.1|  PREDICTED: cytochrome P450 90A1                    159   2e-41    
gb|KCW83501.1|  hypothetical protein EUGRSUZ_B00405                     155   3e-41    
ref|NP_001291222.1|  cytochrome P450 90A1                               159   3e-41    
ref|XP_006378664.1|  hypothetical protein POPTR_0010s19710g             158   3e-41    
ref|XP_002534433.1|  cytochrome P450, putative                          154   4e-41    
ref|XP_010689797.1|  PREDICTED: cytochrome P450 90A1                    157   1e-40    
ref|XP_009413009.1|  PREDICTED: cytochrome P450 90A1-like               157   2e-40    
ref|XP_011654987.1|  PREDICTED: cytochrome P450 90A1 isoform X2         156   3e-40    
gb|ABD64134.1|  cytochrome P450-like protein                            149   3e-40    
ref|XP_008463233.1|  PREDICTED: cytochrome P450 90A1 isoform X2         156   3e-40    
ref|XP_008448713.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    155   3e-40    
ref|XP_010262836.1|  PREDICTED: cytochrome P450 90A1                    155   4e-40    
ref|XP_004148754.2|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    155   4e-40    
gb|KCW77914.1|  hypothetical protein EUGRSUZ_D021703                    152   4e-40    
ref|XP_009594382.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     155   5e-40    
gb|KJB74284.1|  hypothetical protein B456_011G286100                    152   5e-40    
ref|XP_002984874.1|  hypothetical protein SELMODRAFT_120985             155   5e-40    
ref|XP_009344808.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    155   5e-40    
ref|XP_008463232.1|  PREDICTED: cytochrome P450 90A1 isoform X1         155   6e-40    
ref|XP_011654986.1|  PREDICTED: cytochrome P450 90A1 isoform X1         155   6e-40    
gb|AER08631.1|  cytochrome P450 monooxygenase                           155   7e-40    
ref|XP_002985932.1|  hypothetical protein SELMODRAFT_123012             154   9e-40    
ref|XP_002968540.1|  hypothetical protein SELMODRAFT_89153              154   1e-39    
ref|XP_010253861.1|  PREDICTED: cytochrome P450 90A1-like               154   1e-39    
gb|KDO69000.1|  hypothetical protein CISIN_1g011522mg                   154   1e-39    
ref|XP_002316218.2|  hypothetical protein POPTR_0010s19710g             154   1e-39    
emb|CAR92131.1|  ABA 8'-hydroxylase cytochrome P450                     154   1e-39    
emb|CDP01362.1|  unnamed protein product                                153   2e-39    
gb|KJB74283.1|  hypothetical protein B456_011G286100                    152   2e-39    
ref|XP_009344816.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    153   2e-39    
ref|XP_009775493.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     153   3e-39    
gb|ACR20477.1|  steroid 23-alpha-hydroxylase                            153   3e-39    
ref|XP_008373929.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    153   3e-39    
ref|NP_001078535.1|  cytochrome P450 90A1                               151   3e-39    
ref|XP_002873219.1|  hypothetical protein ARALYDRAFT_908485             153   3e-39    
ref|XP_010677091.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    152   3e-39    
ref|XP_010095101.1|  Cytochrome P450 90A1                               152   4e-39    
ref|XP_010666620.1|  PREDICTED: abscisic acid 8'-hydroxylase 4          152   4e-39    
gb|AHA85934.1|  abscisic acid 8-hydroxylase 2                           150   4e-39    
ref|XP_009601885.1|  PREDICTED: cytochrome P450 90A1                    153   4e-39    
gb|KCW49382.1|  hypothetical protein EUGRSUZ_K02924                     152   4e-39    
gb|AJA04665.1|  constitutive photomorphogenesis and dwarfism 2          152   4e-39    
ref|XP_010031233.1|  PREDICTED: cytochrome P450 90A1                    152   5e-39    
ref|XP_010108615.1|  Abscisic acid 8'-hydroxylase 3                     152   5e-39    
gb|KJB74281.1|  hypothetical protein B456_011G286100                    152   6e-39    
ref|XP_004240946.1|  PREDICTED: cytochrome P450 90A1                    152   6e-39    
gb|KHF99479.1|  Cytochrome P450 protein                                 152   6e-39    
ref|XP_004499923.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       152   6e-39    
gb|AEW68003.1|  ABA 8'-hydroxylase 2                                    151   7e-39    
emb|CDX98856.1|  BnaC09g49790D                                          152   7e-39    
ref|XP_009804565.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       151   7e-39    
ref|XP_002975946.1|  hypothetical protein SELMODRAFT_104642             152   7e-39    
ref|XP_006338854.1|  PREDICTED: cytochrome P450 90A1-like               152   7e-39    
ref|XP_010545882.1|  PREDICTED: cytochrome P450 87A3-like               152   8e-39    
gb|KEH17087.1|  cytochrome P450 family 90 protein                       151   1e-38    
gb|KJB32373.1|  hypothetical protein B456_005G237800                    151   1e-38    
ref|XP_008373932.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    151   1e-38    
ref|XP_004307639.1|  PREDICTED: cytochrome P450 90A1                    151   1e-38    
ref|XP_009369157.1|  PREDICTED: cytochrome P450 90A1-like               151   1e-38    
ref|XP_004507292.1|  PREDICTED: cytochrome P450 85A-like                151   1e-38    
gb|KDO69001.1|  hypothetical protein CISIN_1g011522mg                   151   1e-38    
gb|ACU44688.1|  ent-kaurenoic acid oxidase                              141   1e-38    
gb|KJB32374.1|  hypothetical protein B456_005G237800                    151   1e-38    
ref|XP_006399027.1|  hypothetical protein EUTSA_v10013418mg             151   2e-38    
ref|XP_002529163.1|  cytochrome P450, putative                          151   2e-38    
ref|XP_006287674.1|  hypothetical protein CARUB_v10000884mg             151   2e-38    
gb|AAZ23260.1|  cytochrome P450 monooxygenase                           151   2e-38    
ref|NP_566628.1|  abscisic acid 8'-hydroxylase 4                        151   2e-38    
gb|KCW77911.1|  hypothetical protein EUGRSUZ_D02168                     150   2e-38    
ref|NP_196188.1|  cytochrome P450 90A1                                  151   2e-38    
ref|XP_002518804.1|  cytochrome P450, putative                          150   2e-38    
ref|XP_004490985.1|  PREDICTED: cytochrome P450 90A1-like isoform X1    150   2e-38    
emb|CDX70137.1|  BnaA10g24860D                                          150   2e-38    
ref|XP_010543733.1|  PREDICTED: cytochrome P450 90A1                    150   3e-38    
ref|XP_009122168.1|  PREDICTED: cytochrome P450 90A1                    150   3e-38    
ref|XP_007009007.1|  Cytochrome P450 superfamily protein isoform 1      150   3e-38    
ref|XP_010491100.1|  PREDICTED: cytochrome P450 90A1-like               150   3e-38    
dbj|BAF56238.1|  cytochrome P450 enzyme                                 150   4e-38    
ref|XP_002885304.1|  CYP707A4                                           150   4e-38    
ref|XP_004490986.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    150   4e-38    
ref|XP_010452477.1|  PREDICTED: cytochrome P450 90A1                    150   5e-38    
gb|KJB79327.1|  hypothetical protein B456_013G044100                    149   5e-38    
ref|XP_010507578.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     149   5e-38    
ref|XP_009417625.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     150   5e-38    
gb|AJD25211.1|  cytochrome P450 CYP90A39                                149   6e-38    
gb|ABK25038.1|  unknown                                                 150   6e-38    
ref|XP_010423443.1|  PREDICTED: cytochrome P450 90A1-like               149   6e-38    
gb|ADR78279.1|  CYP720B7                                                149   6e-38    
ref|NP_001275805.1|  uncharacterized protein LOC102608450               149   9e-38    
gb|KDO79227.1|  hypothetical protein CISIN_1g036255mg                   148   9e-38    
ref|XP_008233747.1|  PREDICTED: cytochrome P450 90A1                    149   1e-37    
ref|XP_007220390.1|  hypothetical protein PRUPE_ppa005060mg             149   1e-37    
gb|KJB67574.1|  hypothetical protein B456_010G198500                    149   1e-37    
dbj|BAG12743.1|  ABA 8-oxidase                                          149   1e-37    
ref|XP_006364084.1|  PREDICTED: beta-amyrin 11-oxidase-like             140   1e-37    
ref|XP_002523575.1|  cytochrome P450, putative                          149   1e-37    
emb|CDY04961.1|  BnaAnng01430D                                          143   1e-37    
gb|KJB79325.1|  hypothetical protein B456_013G044100                    149   1e-37    
ref|XP_009789229.1|  PREDICTED: cytochrome P450 90A1                    149   1e-37    
ref|XP_006434765.1|  hypothetical protein CICLE_v10001043mg             149   1e-37    
emb|CAD27417.1|  cytochrome P450                                        149   1e-37    
ref|XP_008369248.1|  PREDICTED: cytochrome P450 90A1                    148   1e-37    
ref|XP_010487859.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     148   2e-37    
ref|XP_007151377.1|  hypothetical protein PHAVU_004G041700g             148   2e-37    
gb|AGJ98215.1|  CYP85                                                   146   2e-37    
dbj|BAG12742.1|  ABA 8-oxidase                                          148   2e-37    
ref|XP_010059933.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like     148   2e-37    
gb|KFK24971.1|  hypothetical protein AALP_AA8G049800                    148   2e-37    
emb|CBI25492.3|  unnamed protein product                                146   3e-37    
ref|XP_010466060.1|  PREDICTED: abscisic acid 8'-hydroxylase 4          147   3e-37    
ref|XP_010545893.1|  PREDICTED: cytochrome P450 87A3-like               147   3e-37    
gb|AAZ39038.1|  cytochrome P450 90A2                                    147   3e-37    
ref|XP_009130893.1|  PREDICTED: cytochrome P450 90A1-like               147   3e-37    
gb|EMS50347.1|  Cytochrome P450 90A1                                    145   3e-37    
emb|CDY11332.1|  BnaA03g01680D                                          147   3e-37    
ref|XP_011627842.1|  PREDICTED: cytochrome P450 85A1                    146   4e-37    
ref|XP_002445633.1|  hypothetical protein SORBIDRAFT_07g022990          147   4e-37    
gb|AES99584.2|  cytochrome P450 family monooxygenase                    147   4e-37    
ref|XP_009391355.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     147   4e-37    
ref|XP_010473544.1|  PREDICTED: cytochrome P450 87A3-like               147   5e-37    
ref|XP_009414347.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like     147   5e-37    
emb|CDY14104.1|  BnaC02g02210D                                          147   5e-37    
ref|XP_004498124.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like     142   5e-37    
emb|CBI19518.3|  unnamed protein product                                146   5e-37    
gb|KCW77915.1|  hypothetical protein EUGRSUZ_D021701                    138   5e-37    
ref|XP_002875528.1|  hypothetical protein ARALYDRAFT_484717             147   5e-37    
ref|XP_010067524.1|  PREDICTED: cytochrome P450 90A1-like isoform X2    147   5e-37    
gb|EMT14727.1|  Cytochrome P450 85A1                                    147   5e-37    
ref|XP_006367714.1|  PREDICTED: beta-amyrin 11-oxidase-like             145   5e-37    
ref|XP_006425891.1|  hypothetical protein CICLE_v10027226mg             147   6e-37    
ref|XP_009125613.1|  PREDICTED: cytochrome P450 90A1-like               147   6e-37    
ref|XP_009391571.1|  PREDICTED: cytochrome P450 90A1 isoform X1         147   6e-37    
ref|XP_006290962.1|  hypothetical protein CARUB_v10017078mg             145   6e-37    
gb|KJB32375.1|  hypothetical protein B456_005G237800                    146   6e-37    
gb|KCW77912.1|  hypothetical protein EUGRSUZ_D02169                     147   6e-37    



>ref|XP_009589785.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=410

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+DMMD L+EV+DENGR+L+DEEIIDVLVMYLNAGHESSGHITMWAT FLQ HPE FK+
Sbjct  181  EKKDMMDILLEVEDENGRKLNDEEIIDVLVMYLNAGHESSGHITMWATYFLQKHPEIFKK  240

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+N P DQKG+TL+EIRQM+YLSKVIDETLR+VTFS  VFREAKKD  ++GY
Sbjct  241  AKAEQEAIVKNRPCDQKGVTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAKKDFMINGY  300

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY DPL FNPSRWD  TP+AG FLPFGAGSRLCPGNDLAK
Sbjct  301  TIPKGWKVLVWFRSVHLDPEIYNDPLEFNPSRWDGLTPKAGTFLPFGAGSRLCPGNDLAK  360

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELER+NP CPLMYLPH RPKDNCLG
Sbjct  361  LEISIFLHYFLLDYELERENPSCPLMYLPHCRPKDNCLG  399



>ref|XP_009589784.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=492

 Score =   392 bits (1007),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+DMMD L+EV+DENGR+L+DEEIIDVLVMYLNAGHESSGHITMWAT FLQ HPE FK+
Sbjct  263  EKKDMMDILLEVEDENGRKLNDEEIIDVLVMYLNAGHESSGHITMWATYFLQKHPEIFKK  322

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+N P DQKG+TL+EIRQM+YLSKVIDETLR+VTFS  VFREAKKD  ++GY
Sbjct  323  AKAEQEAIVKNRPCDQKGVTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAKKDFMINGY  382

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY DPL FNPSRWD  TP+AG FLPFGAGSRLCPGNDLAK
Sbjct  383  TIPKGWKVLVWFRSVHLDPEIYNDPLEFNPSRWDGLTPKAGTFLPFGAGSRLCPGNDLAK  442

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELER+NP CPLMYLPH RPKDNCLG
Sbjct  443  LEISIFLHYFLLDYELERENPSCPLMYLPHCRPKDNCLG  481



>ref|XP_010097724.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis]
 gb|EXB70679.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis]
Length=493

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+DENGR+L DEEIIDVL+MYLNAGHESSGH  MWA VFLQ  PE F++
Sbjct  268  KKKDMMDALLDVEDENGRKLTDEEIIDVLLMYLNAGHESSGHTMMWAVVFLQHRPEIFQK  327

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGL+L+EIR+M+YLSKV+DETLR+VTFSLTVFREAK+DV V+GY
Sbjct  328  AKAEQEEIIKKRPPTQKGLSLKEIREMDYLSKVVDETLRVVTFSLTVFREAKQDVQVTGY  387

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY DP  FNPSRWDN+TPRAG+FLPFGAGSRLCPGNDLAK
Sbjct  388  TIPKGWKVLVWFRSVHLDPEIYPDPKEFNPSRWDNYTPRAGSFLPFGAGSRLCPGNDLAK  447

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLLGY L+R NPDCPLMYLPH+RPKDNCL 
Sbjct  448  LEISIFLHHFLLGYRLKRANPDCPLMYLPHSRPKDNCLA  486



>ref|XP_010323137.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Solanum 
lycopersicum]
Length=406

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+EV+DENGR+L+DEEIIDVLVMYLNAGHESSGHITMW T FLQ HP+ FK+
Sbjct  176  DKKDMMDILLEVQDENGRKLNDEEIIDVLVMYLNAGHESSGHITMWVTYFLQKHPDFFKK  235

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE IV+N P +QKGLTL+EIR M+YLSKVIDETLRL+TFS  VFREAK+DV + GY
Sbjct  236  AKEEQESIVKNRPAEQKGLTLKEIRNMDYLSKVIDETLRLITFSFVVFREAKEDVAIHGY  295

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY+DPL FNPSRWD  TP+ G FLPFG G RLCPGNDLAK
Sbjct  296  TIPKGWKVLVWFRSVHLDPEIYKDPLEFNPSRWDGLTPKVGTFLPFGGGGRLCPGNDLAK  355

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELERKNP CP+MYLPH RPKDNCLG
Sbjct  356  LEISIFLHYFLLDYELERKNPSCPVMYLPHCRPKDNCLG  394



>ref|XP_006354607.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Solanum tuberosum]
Length=497

 Score =   383 bits (983),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 194/219 (89%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+EV+DENGR+L+DEEIIDVLVMYLNAGHESSGHITMW T FLQ HPE FK+
Sbjct  267  DKKDMMDILLEVQDENGRKLNDEEIIDVLVMYLNAGHESSGHITMWVTYFLQKHPEFFKK  326

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQ+ IV+N P DQKGLTL+EIR M+YLSKVIDETLRL+TFS  VFREAK+DV + GY
Sbjct  327  AKAEQDAIVKNRPSDQKGLTLKEIRNMDYLSKVIDETLRLITFSFVVFREAKEDVAIHGY  386

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY+DPL FNPSRWD  TP+ G FLPFG G RLCPGNDLAK
Sbjct  387  TIPKGWKVLVWFRSVHLDPEIYKDPLEFNPSRWDELTPKVGTFLPFGGGGRLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELERKNP CP+MYLPH RPKDNCLG
Sbjct  447  LEISIFLHYFLLDYELERKNPSCPVMYLPHCRPKDNCLG  485



>gb|EYU40296.1| hypothetical protein MIMGU_mgv1a006460mg [Erythranthe guttata]
Length=443

 Score =   380 bits (977),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DMMD L+  +DENGR+L DEEIIDVL+MYLNAGHESSGH TMWA VFLQ +P+ FKRA
Sbjct  218  RKDMMDSLLSAEDENGRKLTDEEIIDVLIMYLNAGHESSGHTTMWAAVFLQKNPDVFKRA  277

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEIVRN P DQKGLTL+EIR+MEYLSKVIDETLR+VTFSL VFREAKKDVNV GYT
Sbjct  278  KAEQEEIVRNRPADQKGLTLKEIRKMEYLSKVIDETLRVVTFSLMVFREAKKDVNVCGYT  337

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VH D E Y +P+ F+PSRWD FTP+AG F+PFGAGSRLCPGNDLAKL
Sbjct  338  IPKGWKVLVWFRSVHFDPETYIEPMKFDPSRWDGFTPKAGNFIPFGAGSRLCPGNDLAKL  397

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL YELE+ NP  PLMYLPHTRPKDNCLG
Sbjct  398  EISIFLHHFLLNYELEQHNPASPLMYLPHTRPKDNCLG  435



>gb|EYU42301.1| hypothetical protein MIMGU_mgv1a005890mg [Erythranthe guttata]
Length=466

 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD LME +DENGR+LDDEEIIDVLVMYLNAGHESSGHITMWAT+FLQ HP+ FKRA
Sbjct  242  KKDMMDALMEAEDENGRKLDDEEIIDVLVMYLNAGHESSGHITMWATLFLQKHPDVFKRA  301

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEIV+N   DQ GL+L+EIRQM+YLSKVIDETLR++TFSL VFREAKKDV+V GYT
Sbjct  302  KAEQEEIVKNRSADQNGLSLKEIRQMDYLSKVIDETLRVITFSLVVFREAKKDVHVCGYT  361

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VH D E Y +P  F+PSRWD FTP+AG FLPFG GSRLCPGNDLAK+
Sbjct  362  IPKGWKVLVWFRSVHFDPETYVEPKKFDPSRWDGFTPKAGNFLPFGGGSRLCPGNDLAKI  421

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL YELER NP  P+MYLPHTRPKDNCLG
Sbjct  422  EISIFLHHFLLNYELERHNPASPMMYLPHTRPKDNCLG  459



>ref|XP_004229509.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Solanum 
lycopersicum]
Length=497

 Score =   379 bits (974),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+EV+DENGR+L+DEEIIDVLVMYLNAGHESSGHITMW T FLQ HP+ FK+
Sbjct  267  DKKDMMDILLEVQDENGRKLNDEEIIDVLVMYLNAGHESSGHITMWVTYFLQKHPDFFKK  326

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE IV+N P +QKGLTL+EIR M+YLSKVIDETLRL+TFS  VFREAK+DV + GY
Sbjct  327  AKEEQESIVKNRPAEQKGLTLKEIRNMDYLSKVIDETLRLITFSFVVFREAKEDVAIHGY  386

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY+DPL FNPSRWD  TP+ G FLPFG G RLCPGNDLAK
Sbjct  387  TIPKGWKVLVWFRSVHLDPEIYKDPLEFNPSRWDGLTPKVGTFLPFGGGGRLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELERKNP CP+MYLPH RPKDNCLG
Sbjct  447  LEISIFLHYFLLDYELERKNPSCPVMYLPHCRPKDNCLG  485



>ref|XP_011085042.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Sesamum indicum]
Length=493

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD L++ +DE+GR+L DEEIID+L+MYLNAGHESSGH  MWATVFLQ +P+ FKRA
Sbjct  261  KKDMMDALVDAEDEHGRKLTDEEIIDILIMYLNAGHESSGHTAMWATVFLQKNPDVFKRA  320

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEIVRN PPDQKGLTL+EIR+MEYL+KVIDETLR+VTFSL VFREAKKDVNV GYT
Sbjct  321  KAEQEEIVRNRPPDQKGLTLKEIRKMEYLNKVIDETLRVVTFSLVVFREAKKDVNVCGYT  380

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VH D E Y DP  F+PSRWD FTP+AG FLPFG GSRLCPGNDLAKL
Sbjct  381  IPKGWKVLVWFRSVHFDPETYTDPKKFDPSRWDGFTPKAGNFLPFGGGSRLCPGNDLAKL  440

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EIS+FLH+FLL YELE++NP  PLMYLPHTRPKDNCLG
Sbjct  441  EISVFLHHFLLNYELEQQNPGSPLMYLPHTRPKDNCLG  478



>ref|XP_010269971.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Nelumbo nucifera]
Length=495

 Score =   374 bits (960),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 192/218 (88%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD LM V+DENGR L D+EIIDVLVMYLNAGHESS HITMWATV LQ HPE F++A
Sbjct  268  KKDMMDVLMYVEDENGRRLSDDEIIDVLVMYLNAGHESSAHITMWATVLLQKHPELFQKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEIVRN  P QKGLTL+EIRQM+YLSKVIDETLRL+  SL VFREA+KDVN+SGY+
Sbjct  328  KAEQEEIVRNRLPTQKGLTLKEIRQMDYLSKVIDETLRLINISLVVFREARKDVNISGYS  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VHLD EIY +P  FNPSRWD +TP+AG +LPFGAGSRLCPGNDLAKL
Sbjct  388  IPKGWKVLVWFRSVHLDAEIYPNPKEFNPSRWDGYTPKAGTYLPFGAGSRLCPGNDLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y+LER NP+CP+ YLPHTRP DNCL 
Sbjct  448  EISIFLHYFLLNYQLERLNPECPVRYLPHTRPIDNCLA  485



>gb|AEF32085.1| ent-kaurenoic acid oxidase [Castanea mollissima]
Length=492

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 195/219 (89%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++VKDENGR+L DEEIID+LVMYLNAGHESSGH  MWAT+FL  HPE  ++
Sbjct  264  KKKDMMDALIDVKDENGRKLTDEEIIDILVMYLNAGHESSGHTAMWATIFLNQHPEYLQK  323

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEIVR   P+QKGLTL+EIR+MEYLSKVIDETLR++TFSLTVFREAK+DVN++GY
Sbjct  324  AKKEQEEIVRKRLPEQKGLTLKEIREMEYLSKVIDETLRVITFSLTVFREAKQDVNIAGY  383

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GW+VLVWFR VHLD EIYE+P  F PSRWDNFTP+AGAFLPFGAG+RLCPGNDLAK
Sbjct  384  TIPKGWRVLVWFRSVHLDPEIYENPKEFKPSRWDNFTPKAGAFLPFGAGTRLCPGNDLAK  443

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y+LER NP  P MYLPHTRP DNCL 
Sbjct  444  LEISIFLHHFLLNYQLERLNPGSPSMYLPHTRPVDNCLA  482



>gb|AJD25209.1| cytochrome P450 CYP88A52 [Salvia miltiorrhiza]
Length=487

 Score =   371 bits (953),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
             K+DMMD LM+ +D+ GR L DEEIIDVLVMYLNAGHESSGHITMWAT+FLQ+HP+  +R
Sbjct  260  SKKDMMDALMDAQDDKGRSLKDEEIIDVLVMYLNAGHESSGHITMWATLFLQNHPDVLQR  319

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE+IV+  PP QKGLTL+EIR+M+YL KVIDETLR+VTFSLTVFREAKKDV+V GY
Sbjct  320  AKAEQEQIVKKRPPGQKGLTLKEIREMDYLDKVIDETLRVVTFSLTVFREAKKDVHVCGY  379

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFRGVH D E Y DP  F+PSRWD FTP+AG FLPFG GSRLCPGNDLAK
Sbjct  380  TIPKGWKVLVWFRGVHFDPETYPDPKKFDPSRWDGFTPKAGNFLPFGGGSRLCPGNDLAK  439

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EISIFLH+F+L YEL+R NP  PLMYLPHTRPKDNCLG
Sbjct  440  IEISIFLHHFVLNYELKRHNPASPLMYLPHTRPKDNCLG  478



>ref|XP_006445516.1| hypothetical protein CICLE_v10019986mg [Citrus clementina]
 gb|ESR58756.1| hypothetical protein CICLE_v10019986mg [Citrus clementina]
Length=475

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+ V+DENGR+L+DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  ++
Sbjct  247  KKKDMMDALLSVEDENGRKLEDEEIIDVLLMYLNAGHESSGHTMMWATIFLQEHPEFLQK  306

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP QKGLTL+EIR+M+YLSKV+DETLR++TFSLTVFREAK DVN+SGY
Sbjct  307  AKAEQEMIVKKRPPTQKGLTLKEIREMDYLSKVVDETLRIITFSLTVFREAKTDVNISGY  366

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY +P  FNPSRWDN+T +AG FLPFG GSRLCPGNDLAK
Sbjct  367  TIPKGWKVLVWFRSVHLDPEIYPNPKEFNPSRWDNYTAKAGTFLPFGGGSRLCPGNDLAK  426

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLHYFLL Y +ER NP C +MYLPHTRPKDNCL 
Sbjct  427  LEITIFLHYFLLNYRVERLNPGCQVMYLPHTRPKDNCLA  465



>ref|XP_008375674.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Malus 
domestica]
Length=422

 Score =   367 bits (941),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V++++GR+L DEEIIDVL+MYLNAGHESSGH  MWATVFLQ++PEAF+R
Sbjct  194  KKKDMMDALLDVEEDBGRKLTDEEIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQR  253

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKG+TL+E R+M+YLSKVIDETLR++TFSLTVFREAKKDV ++GY
Sbjct  254  AKAEQEEILKRRPPTQKGMTLKEYREMDYLSKVIDETLRVITFSLTVFREAKKDVKINGY  313

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D E+Y +P+ FNPSRWDN TP+A +FLPFGAGS LCPGNDLAK
Sbjct  314  SIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNLTPKALSFLPFGAGSHLCPGNDLAK  373

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER N  CPLMYLPHTRPKDNC+ 
Sbjct  374  LEIAIFLHHFLLNYKMERANAGCPLMYLPHTRPKDNCVA  412



>gb|KDO85362.1| hypothetical protein CISIN_1g010697mg [Citrus sinensis]
Length=503

 Score =   369 bits (948),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+ V+DENGR+L+DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  ++
Sbjct  275  KKKDMMDALLSVEDENGRKLEDEEIIDVLLMYLNAGHESSGHTMMWATIFLQEHPEFLQK  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP QKGLTL+EIR+M+YLSKV+DETLR++TFSLTVFREAK DVN+SGY
Sbjct  335  AKAEQEMIVKKRPPTQKGLTLKEIREMDYLSKVVDETLRIITFSLTVFREAKTDVNISGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY +P  FNPSRWDN+T +AG FLPFG GSRLCPGNDLAK
Sbjct  395  TIPKGWKVLVWFRSVHLDPEIYPNPKEFNPSRWDNYTAKAGTFLPFGGGSRLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLHYFLL Y +ER NP C +MYLPHTRPKDNCL 
Sbjct  455  LEITIFLHYFLLNYRVERLNPGCQVMYLPHTRPKDNCLA  493



>ref|XP_006464339.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Citrus sinensis]
Length=514

 Score =   369 bits (948),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+ V+DENGR+L+DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  ++
Sbjct  286  KKKDMMDALLSVEDENGRKLEDEEIIDVLLMYLNAGHESSGHTMMWATIFLQEHPEFLQK  345

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP QKGLTL+EIR+M+YLSKV+DETLR++TFSLTVFREAK DVN+SGY
Sbjct  346  AKAEQEMIVKKRPPTQKGLTLKEIREMDYLSKVVDETLRIITFSLTVFREAKTDVNISGY  405

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVLVWFR VHLD EIY +P  FNPSRWDN+T +AG FLPFG GSRLCPGNDLAK
Sbjct  406  TIPKGWKVLVWFRSVHLDPEIYPNPKEFNPSRWDNYTAKAGTFLPFGGGSRLCPGNDLAK  465

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLHYFLL Y +ER NP C +MYLPHTRPKDNCL 
Sbjct  466  LEITIFLHYFLLNYRVERLNPGCQVMYLPHTRPKDNCLA  504



>ref|XP_002264215.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Vitis vinifera]
 emb|CBI16744.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 189/218 (87%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L+ V+DENGR+L DEEIID+L+MYLNAGHESSGH+TMWAT+ LQ HPE F+RA
Sbjct  265  EKDMLDALLHVEDENGRKLTDEEIIDLLIMYLNAGHESSGHVTMWATLLLQGHPEIFQRA  324

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEIV+N PP QKGLTLRE+R+MEYLS+VIDETLR +TFSL VFREAK DVN+ GY 
Sbjct  325  KAEQEEIVKNRPPTQKGLTLREVRKMEYLSQVIDETLRWLTFSLMVFREAKADVNIGGYL  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
             P+GWKVLVWFR VH D EIY +P  FNPSRWDNFTP+AG FLPFGAGSRLCPGNDLAKL
Sbjct  385  FPKGWKVLVWFRAVHYDPEIYPNPEVFNPSRWDNFTPKAGTFLPFGAGSRLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y LER NP C LMYLPH RP DNCL 
Sbjct  445  EISIFLHYFLLNYRLERVNPGCELMYLPHPRPVDNCLA  482



>ref|XP_009376861.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Pyrus x bretschneideri]
Length=503

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+D++GR+L+DE+IIDVL+MYLNAGHESSGH  MWATVFLQ++PEAF+R
Sbjct  275  KKKDMMDALLDVEDDDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQR  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGLTL+E R+M+YL +VIDETLR++TFSLTVFREAKKDV ++GY
Sbjct  335  AKAEQEEILKRRPPTQKGLTLKEYREMDYLCQVIDETLRVITFSLTVFREAKKDVKINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D E+Y +P+ FNPSRWDNFTP+A +FLPFGAGS LCPGNDLAK
Sbjct  395  SIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNFTPKAFSFLPFGAGSHLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NP CPLMYLPHTRPKDNC+ 
Sbjct  455  LEIAIFLHHFLLNYKMERTNPGCPLMYLPHTRPKDNCVA  493



>gb|AGF25266.1| ent-kaurenoic acid oxidase [Pyrus communis]
Length=503

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+D++GR+L+DE+IIDVL+MYLNAGHESSGH  MWATVFLQ++PEAF+R
Sbjct  275  KKKDMMDALLDVEDDDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQR  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGLTL+E R+M+YL +VIDETLR++TFSLTVFREAKKDV ++GY
Sbjct  335  AKAEQEEILKRRPPTQKGLTLKEYREMDYLCQVIDETLRVITFSLTVFREAKKDVKINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D E+Y +P+ FNPSRWDNFTP+A +FLPFGAGS LCPGNDLAK
Sbjct  395  SIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNFTPKAFSFLPFGAGSHLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NP CPLMYLPHTRPKDNC+ 
Sbjct  455  LEIAIFLHHFLLNYKMERTNPGCPLMYLPHTRPKDNCVA  493



>ref|XP_006375612.1| hypothetical protein POPTR_0014s17720g [Populus trichocarpa]
 gb|ERP53409.1| hypothetical protein POPTR_0014s17720g [Populus trichocarpa]
Length=405

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+ V+DENGR+L DEEIIDV++MYLNAGHESSGHIT WAT+FLQ HPE  ++
Sbjct  177  KKKDMMDSLLGVEDENGRKLTDEEIIDVILMYLNAGHESSGHITTWATIFLQEHPEFLQK  236

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE+IV+  PP Q GL+L+E+R+M+YLSKVIDETLRL+TFSLTVFREAK D +++GY
Sbjct  237  AKEEQEQIVKRRPPAQNGLSLKEVREMDYLSKVIDETLRLITFSLTVFREAKTDFSINGY  296

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVWFR VHLD EIY++P  FNPSRWDN+TP+AG FLPFGAGSRLCPGNDLAK
Sbjct  297  IIPKGWKVLVWFRTVHLDPEIYQNPKEFNPSRWDNYTPKAGTFLPFGAGSRLCPGNDLAK  356

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL Y LER+NP+C  M+LPHTRP DNC+ 
Sbjct  357  LEISIFLHYFLLDYMLERENPECRWMFLPHTRPTDNCVA  395



>ref|XP_009347589.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Pyrus x bretschneideri]
Length=503

 Score =   367 bits (942),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+D++GR+L+DE+IIDVL+MYLNAGHESSGH  MWATVFLQ++PEAF+R
Sbjct  275  KKKDMMDALLDVEDDDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQR  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGLTL+E R+M+YL +VIDETLR++TFSLTVFREAKKDV ++GY
Sbjct  335  AKAEQEEILKRRPPTQKGLTLKEYREMDYLCQVIDETLRVITFSLTVFREAKKDVKINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D E+Y +P+ FNPSRWDNFTP+A +FLPFGAGS LCPGNDLAK
Sbjct  395  SIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNFTPKAFSFLPFGAGSHLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NP CPLMYLPHTRPKDNC+ 
Sbjct  455  LEIAIFLHHFLLNYKMERTNPGCPLMYLPHTRPKDNCVA  493



>ref|XP_010275286.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Nelumbo nucifera]
Length=492

 Score =   367 bits (941),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 190/218 (87%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD L++VK ENG+ L DEEIID+LVMYLNAGHESSGHITMWATV LQ+HPE  ++A
Sbjct  265  KKDMMDALLDVKYENGKMLTDEEIIDILVMYLNAGHESSGHITMWATVLLQNHPEIHQKA  324

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEI+R  PP QKGLTL+EIRQM+YLSKVIDETLRL+  S  VFREA+KDVNV+GYT
Sbjct  325  KAEQEEIIRKRPPTQKGLTLKEIRQMDYLSKVIDETLRLINISSVVFREARKDVNVNGYT  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VH+D EIY DP  FNPSRWD FTP+AG ++PFGAGSRLCPGNDLAKL
Sbjct  385  IPKGWKVLVWFRSVHMDSEIYSDPKEFNPSRWDGFTPKAGTYIPFGAGSRLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y LER NPD PL YLPHTRP DNCL 
Sbjct  445  EISIFLHHFLLNYRLERLNPDSPLRYLPHTRPIDNCLA  482



>gb|AGZ93669.1| ent-kaurene acid oxidase [Malus domestica]
Length=503

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+D++GR+L+DE+IIDVL+MYLNAGHESSGH  MWATVFLQ++PEAF+R
Sbjct  275  KKKDMMDALLDVEDDDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQR  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGLTL+E R+M+YLS+VIDETLR++TFSLTVFREAKKDV ++GY
Sbjct  335  AKAEQEEILKRRPPTQKGLTLKEYREMDYLSQVIDETLRVITFSLTVFREAKKDVKINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D E+Y +P+ FNPSRWDN TP+A +FLPFGAGS LCPGNDLAK
Sbjct  395  SIPKGWKVLVWFRSIHYDSELYPNPMEFNPSRWDNHTPKALSFLPFGAGSHLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NP CPLMYLPHTRPKDNC+ 
Sbjct  455  LEIAIFLHHFLLKYKMERTNPGCPLMYLPHTRPKDNCVA  493



>ref|XP_008354800.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Malus domestica]
Length=503

 Score =   365 bits (937),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+D++GR+L+DE+IIDVL+MYLNAGHESSGH  MWATVFLQ++PEAF+R
Sbjct  275  KKKDMMDALLDVEDDDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQR  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGLTL+E R+M+YLS+VIDETLR++TFSLTVFREAKKDV ++GY
Sbjct  335  AKAEQEEILKRRPPTQKGLTLKEYREMDYLSQVIDETLRVITFSLTVFREAKKDVKINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D E+Y +P  FNPSRWDN TP+A +FLPFGAGS LCPGNDLAK
Sbjct  395  SIPKGWKVLVWFRSIHYDSELYPNPXEFNPSRWDNHTPKALSFLPFGAGSHLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NP CPLMYLPHTRPKDNC+ 
Sbjct  455  LEIAIFLHHFLLNYKMERTNPGCPLMYLPHTRPKDNCVA  493



>gb|AGI65630.1| ent-kaurenoic acid oxidase [Malus domestica]
Length=503

 Score =   365 bits (937),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+D++GR+L+DE+IIDVL+MYLNAGHESSGH  MWATVFLQ++PEAF+R
Sbjct  275  KKKDMMDALLDVEDDDGRKLNDEDIIDVLLMYLNAGHESSGHTIMWATVFLQANPEAFQR  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGLTL+E R+M+YLS+VIDETLR++TFSLTVFREAKKDV ++GY
Sbjct  335  AKAEQEEILKRRPPTQKGLTLKEYREMDYLSQVIDETLRVITFSLTVFREAKKDVKINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D E+Y +P  FNPSRWDN TP+A +FLPFGAGS LCPGNDLAK
Sbjct  395  SIPKGWKVLVWFRSIHYDSELYPNPTEFNPSRWDNHTPKALSFLPFGAGSHLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NP CPLMYLPHTRPKDNC+ 
Sbjct  455  LEIAIFLHHFLLNYKMERTNPGCPLMYLPHTRPKDNCVA  493



>emb|CDP09340.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK DMMD LM+  D+ GR+LDDEEIIDVLVMYLNAGHESSGH++MWAT+FLQ +PE  ++
Sbjct  265  EKMDMMDALMDAVDDKGRKLDDEEIIDVLVMYLNAGHESSGHVSMWATLFLQKNPEVLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP Q GLTL+EIRQM+YLSKVIDETLR+VTFS  VFREAKKD+N++GY
Sbjct  325  AKAEQEAIVKKRPPGQVGLTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAKKDINITGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWK LVWFR VH D E+Y DP  F+P RWD  T +AG+FLPFGAG+R CPGNDLAK
Sbjct  385  TIPKGWKALVWFRNVHFDPELYPDPKRFDPDRWDGLTAKAGSFLPFGAGTRTCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELER+NP CP+MYLPH RPKDNCLG
Sbjct  445  LEISIFLHYFLLDYELERQNPSCPIMYLPHQRPKDNCLG  483



>ref|XP_007218023.1| hypothetical protein PRUPE_ppa005937mg [Prunus persica]
 gb|EMJ19222.1| hypothetical protein PRUPE_ppa005937mg [Prunus persica]
Length=436

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 195/219 (89%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGHI MWATVFLQ HPE F++
Sbjct  210  KKKDMMDALLDVVDDDGRKLTDSEIIDVLLMYLNAGHESSGHIMMWATVFLQKHPEYFQK  269

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++  PP QKGLTL+E R+M+YLS VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  270  AKAEQEEILKRRPPTQKGLTLKEYREMDYLSNVIDETLRVVTFSLTVFREAKKDVNINGY  329

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            +IP+GWKVLVWFR +H D EIY +P+ FNP RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  330  SIPKGWKVLVWFRSIHYDSEIYPNPMEFNPFRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  389

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLHYFLL Y++ER NPDCPLMYLPHTRPKDNCL 
Sbjct  390  LEIAIFLHYFLLNYKMERANPDCPLMYLPHTRPKDNCLA  428



>ref|XP_011093453.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Sesamum indicum]
Length=486

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 187/218 (86%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD LM+ +DENGR L DEEIIDVLVMYLNAGHESSGHI MWATVFL  HP+  KRA
Sbjct  262  KKDMMDALMDAEDENGRRLTDEEIIDVLVMYLNAGHESSGHIIMWATVFLLKHPDVLKRA  321

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEIVRN  P Q GLTL+E+RQM+YLSKVIDETLR+VTFSL VFREAKKDV V GY 
Sbjct  322  KAEQEEIVRNRRPGQNGLTLKEVRQMDYLSKVIDETLRVVTFSLVVFREAKKDVRVCGYI  381

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            +P+GWKVLVWFR VH D E Y +P  F+PSRWD FTP+AG FLPFG GSRLCPGNDLAK+
Sbjct  382  VPKGWKVLVWFRSVHFDPETYPEPKKFDPSRWDEFTPKAGHFLPFGGGSRLCPGNDLAKI  441

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y+LE+ NP  P+MYLPHTRPKDNCLG
Sbjct  442  EISIFLHHFLLNYKLEQCNPASPVMYLPHTRPKDNCLG  479



>emb|CDP09339.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EKRDMMD LM+  D+ GR+LDDEEIIDVLVMYLNAGHESSGH++MWAT+FLQ +PE  ++
Sbjct  265  EKRDMMDALMDAVDDKGRKLDDEEIIDVLVMYLNAGHESSGHVSMWATLFLQKNPEVLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+N PP Q GLTL+EIRQM+YLSKVIDETLR+VTFS  VFREA+KD+N+SG+
Sbjct  325  AKAEQEAIVKNRPPGQVGLTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAQKDINISGF  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWK LVWFR VH D E+Y +P  F+P RWD  T +AG FLPFGAG+R CPGNDLAK
Sbjct  385  TIPKGWKALVWFRNVHFDPELYPEPKKFDPDRWDGLTAKAGTFLPFGAGARTCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELER+NP CPL+YLPH RP DNCLG
Sbjct  445  LEISIFLHYFLLDYELERQNPSCPLIYLPHQRPIDNCLG  483



>ref|XP_011656712.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Cucumis sativus]
Length=484

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 189/218 (87%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            KRDM+D L+E +DE+GR L DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HP   ++A
Sbjct  261  KRDMLDALLEAEDEDGRRLSDEEIIDVLIMYLNAGHESSGHTMMWATIFLQQHPHFLQKA  320

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEE+++  P  QKGLTL+E+RQM YLSKVIDETLR+VTFSLTVFREAK DV +SGYT
Sbjct  321  KAEQEEMIKKRPVGQKGLTLKEVRQMPYLSKVIDETLRVVTFSLTVFREAKHDVKISGYT  380

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VH D E Y DP  FNPSRWD+F P+AG+FLPFGAGSRLCPGNDLAKL
Sbjct  381  IPKGWKVLVWFRSVHFDSETYPDPREFNPSRWDDFIPKAGSFLPFGAGSRLCPGNDLAKL  440

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EIS+FLHYFLL Y+LER NP+ P+ YLPH++P+DNCLG
Sbjct  441  EISVFLHYFLLNYKLERVNPESPIRYLPHSKPEDNCLG  478



>ref|XP_012083781.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Jatropha 
curcas]
 gb|KDP28926.1| hypothetical protein JCGZ_14697 [Jatropha curcas]
Length=493

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +KRDMMD L++V+DENGR+L +EEI+DVL+MYLNAGHESSGHITMWAT+ LQ HPE  ++
Sbjct  265  KKRDMMDALIDVEDENGRKLSEEEIVDVLLMYLNAGHESSGHITMWATILLQEHPEFLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QKGLTL E+R+M+YLSKVIDETLRL+TFSLTVFREAK ++N++GY
Sbjct  325  AKEEQEEIIKRRPPTQKGLTLNEVREMKYLSKVIDETLRLITFSLTVFREAKANINLNGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVWFR VHLD EIY +P  FNPSRWDN   +AG FLPFGAGSR+CPGNDLAK
Sbjct  385  IIPKGWKVLVWFRSVHLDPEIYPNPKEFNPSRWDNRIVKAGTFLPFGAGSRMCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y+L+R NP+C LMYLPH+RPKDNCL 
Sbjct  445  LEISIFLHHFLLNYQLQRLNPECSLMYLPHSRPKDNCLA  483



>gb|KCW76778.1| hypothetical protein EUGRSUZ_D01134 [Eucalyptus grandis]
Length=491

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 192/218 (88%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L+EV+DENGR+LD+EEIIDVL+MYLNAGHESSGHITMWAT+FLQ + E  K+A
Sbjct  264  KKDMLDALLEVEDENGRKLDNEEIIDVLLMYLNAGHESSGHITMWATIFLQENQEFLKKA  323

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++  PP QKGLTL+E RQMEYLSKVIDETLRL+TFSL VFREAK DV+++GYT
Sbjct  324  KEEQEEIMKKRPPTQKGLTLKEFRQMEYLSKVIDETLRLITFSLVVFREAKSDVSMNGYT  383

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VHLD EIY +P  F+PSRWDN+ PRAG+FLPFGAGSR+CPGNDLAKL
Sbjct  384  IPQGWKVLVWFRTVHLDPEIYPNPNKFDPSRWDNYIPRAGSFLPFGAGSRMCPGNDLAKL  443

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI+IFLH+FLL Y LER NP C   YLPH+RPKDNCL 
Sbjct  444  EIAIFLHHFLLNYRLERLNPGCATRYLPHSRPKDNCLA  481



>ref|XP_010052709.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Eucalyptus grandis]
Length=480

 Score =   362 bits (928),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 192/218 (88%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L+EV+DENGR+LD+EEIIDVL+MYLNAGHESSGHITMWAT+FLQ + E  K+A
Sbjct  253  KKDMLDALLEVEDENGRKLDNEEIIDVLLMYLNAGHESSGHITMWATIFLQENQEFLKKA  312

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++  PP QKGLTL+E RQMEYLSKVIDETLRL+TFSL VFREAK DV+++GYT
Sbjct  313  KEEQEEIMKKRPPTQKGLTLKEFRQMEYLSKVIDETLRLITFSLVVFREAKSDVSMNGYT  372

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR VHLD EIY +P  F+PSRWDN+ PRAG+FLPFGAGSR+CPGNDLAKL
Sbjct  373  IPQGWKVLVWFRTVHLDPEIYPNPNKFDPSRWDNYIPRAGSFLPFGAGSRMCPGNDLAKL  432

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI+IFLH+FLL Y LER NP C   YLPH+RPKDNCL 
Sbjct  433  EIAIFLHHFLLNYRLERLNPGCATRYLPHSRPKDNCLA  470



>ref|XP_002526524.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
 gb|EEF35915.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
Length=492

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+DE GR+L DEEI+DVL+MYLNAGHESSGHITMWATVFLQ HPE  ++
Sbjct  266  KKKDMMDALLDVEDEKGRKLSDEEIVDVLLMYLNAGHESSGHITMWATVFLQEHPEFLQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            A+ EQEEI++  PP QKGLTL+E+R MEYLSKVIDETLRL+TFSL VFREAK +VN+SGY
Sbjct  326  ARQEQEEIIKRRPPTQKGLTLKEVRDMEYLSKVIDETLRLITFSLVVFREAKTNVNISGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWK+LVWFR VHLD EIY +P  FNPSRWDN T +AG FLPFGAGSR+CPGNDLAK
Sbjct  386  VIPKGWKILVWFRSVHLDPEIYPNPREFNPSRWDNHTAKAGTFLPFGAGSRMCPGNDLAK  445

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL YELER NP   +MYLPH+RPKDNCL 
Sbjct  446  LEIAIFLHHFLLNYELERLNPGSSMMYLPHSRPKDNCLA  484



>emb|CBV36747.1| ent-kaurenoic acid oxidase [Helianthus annuus]
 emb|CBV36750.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=492

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            KRDM+D L+E +DENG++LDDEEIID LVMYLNAGHESSGH+TMWAT+FLQSHPE FK A
Sbjct  269  KRDMLDALLETEDENGKKLDDEEIIDTLVMYLNAGHESSGHVTMWATIFLQSHPEYFKIA  328

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE I ++MPP Q GLTL+E RQMEYLSKVIDETLRLVTFSL  FREAKKDV++ GY 
Sbjct  329  KEEQERIAKDMPPGQ-GLTLKEFRQMEYLSKVIDETLRLVTFSLMTFREAKKDVDIKGYL  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GW VLVWFR VH + +IY  P  FNPSRWDN  P+ G FLPFGAG+RLCPGNDLAKL
Sbjct  388  IPKGWNVLVWFRSVHHNPDIYPQPKEFNPSRWDNLVPKPGTFLPFGAGTRLCPGNDLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI+IFLH+FLL Y+LER NP CP+MYLPH RPKDNCLG
Sbjct  448  EIAIFLHHFLLNYKLERVNPACPMMYLPHPRPKDNCLG  485



>emb|CDP09338.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   360 bits (923),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EKRDMMD LM+  D+ GR+LDDEEIIDVLVMYLNAGHESSGH++MWAT+FLQ +PE  ++
Sbjct  265  EKRDMMDALMDAVDDKGRKLDDEEIIDVLVMYLNAGHESSGHVSMWATLFLQKNPEVLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+N P  Q GLTL+EIRQM+YLSKVIDETLR+VTFS  VFREA+KD+N+SG+
Sbjct  325  AKAEQEAIVKNRPLGQVGLTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAQKDINISGF  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWK LVWFR VH D E+Y +P  F+P RWD  T +AG FLPFGAG+R CPGNDLAK
Sbjct  385  TIPKGWKALVWFRNVHFDPELYPEPKKFDPDRWDGLTAKAGTFLPFGAGARTCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELER+NP CPL+YLPH RP DNCLG
Sbjct  445  LEISIFLHYFLLDYELERQNPSCPLIYLPHQRPIDNCLG  483



>emb|CDP09336.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   360 bits (923),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EKRDMMD LM+  D+ GR+LDDEEIIDVLVMYLNAGHESSGH++MWAT+FLQ +PE  ++
Sbjct  265  EKRDMMDALMDAVDDKGRKLDDEEIIDVLVMYLNAGHESSGHVSMWATLFLQKNPEVLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+N P  Q GLTL+EIRQM+YLSKVIDETLR+VTFS  VFREA+KD+N+SG+
Sbjct  325  AKAEQEAIVKNRPLGQVGLTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAQKDINISGF  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWK LVWFR VH D E+Y +P  F+P RWD  T +AG FLPFGAG+R CPGNDLAK
Sbjct  385  TIPKGWKALVWFRNVHFDPELYPEPKKFDPDRWDGLTAKAGTFLPFGAGARTCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELER+NP CPL+YLPH RP DNCLG
Sbjct  445  LEISIFLHYFLLDYELERQNPSCPLIYLPHQRPIDNCLG  483



>ref|XP_011013095.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Populus euphratica]
Length=493

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+ V+DENGR+L DEEIIDV++MYLNAGHESSGHIT W T+FLQ HP+  ++
Sbjct  265  KKKDMMDSLLGVEDENGRKLTDEEIIDVMLMYLNAGHESSGHITTWGTIFLQEHPKFLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE+IV+   P QKGL+L+E+R+M+YLSKVIDETLRL+TFSLTVFREAK D N++GY
Sbjct  325  AKEEQEQIVKKRLPTQKGLSLKEVREMDYLSKVIDETLRLITFSLTVFREAKTDFNINGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVWFR VHLD EIY +P  FNPSRWDN+TP+ G FLPFGAGSRLCPGNDLAK
Sbjct  385  IIPKGWKVLVWFRTVHLDPEIYPNPKEFNPSRWDNYTPKPGTFLPFGAGSRLCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLLGY LER+NP+C  M+LPHTRP DNC+ 
Sbjct  445  LEISIFLHYFLLGYRLERENPECRWMFLPHTRPTDNCMA  483



>ref|XP_008460072.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Cucumis 
melo]
Length=418

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 189/220 (86%), Gaps = 1/220 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            ++RDMMD L+E +DE+GR L DEEIIDVL+MYLNAGHESSGH  MWA +FL  HP+  ++
Sbjct  193  KRRDMMDALLEAEDEDGRRLSDEEIIDVLLMYLNAGHESSGHTMMWAAIFLHQHPQFLQK  252

Query  632  AKAEQEEIVRNMPPDQKGLTLREIR-QMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            AKAEQEEIVR  P  QKGLTL+E+R QM YL+KVIDETLR+VTFSLTVFREAK DV +SG
Sbjct  253  AKAEQEEIVRKRPLGQKGLTLKEVRSQMPYLTKVIDETLRVVTFSLTVFREAKHDVKISG  312

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            YTIP+GWKVLVWFR VH D E Y +P  FNPSRWD+FTP+AG+FLPFGAGSRLCPGNDLA
Sbjct  313  YTIPKGWKVLVWFRSVHFDPETYPNPKEFNPSRWDDFTPKAGSFLPFGAGSRLCPGNDLA  372

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLE++IFLH+FLL Y+LER NP+ P+ YLPHTRPKDNCL 
Sbjct  373  KLEVAIFLHHFLLNYKLERVNPESPVRYLPHTRPKDNCLA  412



>gb|EPS65596.1| hypothetical protein M569_09175, partial [Genlisea aurea]
Length=481

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +KRDMMD LM+V+DE GR L DEEIIDVLVMYLNAGHESS HITMWA VFLQ+HP  F+R
Sbjct  257  KKRDMMDALMDVEDEGGRRLSDEEIIDVLVMYLNAGHESSAHITMWAVVFLQNHPRVFER  316

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEIVRN P DQKGLTLR++R+MEYLS VIDETLR+VTFS  VFREA+KDV++ GY
Sbjct  317  AKAEQEEIVRNRPGDQKGLTLRDLRRMEYLSNVIDETLRVVTFSSMVFREARKDVSICGY  376

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWK LVWFR VH + E Y DP  F+PSRW+ FTP+AG FLPFG GSRLCPGNDLAK
Sbjct  377  TIPKGWKALVWFRSVHFNPETYPDPKEFDPSRWEGFTPKAGHFLPFGLGSRLCPGNDLAK  436

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EI+IFLH+FLL Y+L+R+NP   +MYLPHTRPKDNC G
Sbjct  437  IEIAIFLHHFLLHYKLQRQNPRSAVMYLPHTRPKDNCRG  475



>dbj|BAG71199.1| ent-kaurenoic acid oxidase [Lactuca sativa]
Length=493

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 188/218 (86%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L++  DE GR+LDDEEIID LVMYLNAGHESSGHITMW+T+ LQ+HPE F  A
Sbjct  269  KKDMLDALLDTTDEKGRKLDDEEIIDTLVMYLNAGHESSGHITMWSTILLQAHPEFFHIA  328

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+NMPP Q+GLTL+E RQMEYLSKVIDETLRLVTFSL  FREAKKDV++ GY 
Sbjct  329  KEEQERIVKNMPPTQEGLTLKEYRQMEYLSKVIDETLRLVTFSLMTFREAKKDVDIKGYF  388

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL+WFR VH + E+Y  P  FNPSRWD+  P+ G FLPFGAGSRLCPGNDLAKL
Sbjct  389  IPKGWKVLLWFRSVHHNPELYPQPKEFNPSRWDDLVPKPGTFLPFGAGSRLCPGNDLAKL  448

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI+IFLH+FL+ YE ER+NP+CP+MYLPH+RPKDNC+G
Sbjct  449  EIAIFLHHFLVNYEFERENPECPIMYLPHSRPKDNCVG  486



>emb|CBI16745.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD L++++DENGR+L DEEIID+LVMYLNAGHESS H+TMWATV LQ +PE F+RA
Sbjct  210  KKDMMDALLDIEDENGRKLSDEEIIDILVMYLNAGHESSAHVTMWATVKLQENPEFFQRA  269

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEI+R  PP+QK LTL+EIR+MEYL KVIDETLR +TFS  VFREAK D+N+ GYT
Sbjct  270  KAEQEEIIRKRPPNQKRLTLKEIREMEYLPKVIDETLRWITFSFVVFREAKADINICGYT  329

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR +H D E Y DP  FNP RWD++T + G FLPFG GSRLCPGNDLAKL
Sbjct  330  IPKGWKVLVWFRSLHFDPETYPDPKEFNPCRWDDYTAKPGTFLPFGLGSRLCPGNDLAKL  389

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EIS+FLH+FLL Y+LER NP CP MYLPH+RP+DNCL 
Sbjct  390  EISVFLHHFLLNYQLERLNPGCPRMYLPHSRPRDNCLA  427



>ref|XP_012084984.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Jatropha curcas]
 gb|KDP26990.1| hypothetical protein JCGZ_22182 [Jatropha curcas]
Length=498

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+DE G++L DEEIID+L+MYLNAGHESSGHITMWAT+FLQ+HPE  K+
Sbjct  270  KKKDMMDALLDVEDEKGQKLSDEEIIDILLMYLNAGHESSGHITMWATIFLQAHPEYLKK  329

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QKGLTL+E R+M YLS+VIDETLRLVTFSLTVFREAK D+N+ GY
Sbjct  330  AKKEQEEILKRRPPTQKGLTLKETREMIYLSQVIDETLRLVTFSLTVFREAKADINLDGY  389

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVL WFR VHLD EIY +P  F PSRWDN T +AG FLPFGAGSRLCPGNDLAK
Sbjct  390  IIPKGWKVLTWFRSVHLDPEIYPNPTEFYPSRWDNHTAKAGTFLPFGAGSRLCPGNDLAK  449

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y+LER  P+  +MYLPH+RPKDNCL 
Sbjct  450  LEISIFLHHFLLNYQLERLTPESKVMYLPHSRPKDNCLA  488



>gb|KJB67442.1| hypothetical protein B456_010G190900 [Gossypium raimondii]
 gb|KJB67443.1| hypothetical protein B456_010G190900 [Gossypium raimondii]
Length=499

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DM+D LM+VKDE G  LDDEEIID+++MYLNAGHESSGH TMWAT+FLQ HPE  ++
Sbjct  271  KKKDMLDALMDVKDEKGETLDDEEIIDIMLMYLNAGHESSGHTTMWATIFLQQHPEFLEK  330

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP QKGLTL++IR+MEYLSKVIDETLRL+TFSL VFREAK DV +SGY
Sbjct  331  AKAEQERIVKKRPPTQKGLTLKDIREMEYLSKVIDETLRLITFSLMVFREAKTDVKISGY  390

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVL WFR +HLD EIY +P  F+PSRWD++  +AG FLPFGAGSRLCPGNDLAK
Sbjct  391  TIPKGWKVLAWFRSIHLDPEIYPNPKEFDPSRWDDYNAKAGTFLPFGAGSRLCPGNDLAK  450

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y+LER NP+  + YLPHTRP DNCL 
Sbjct  451  LEISIFLHHFLLNYQLERLNPESKIRYLPHTRPHDNCLA  489



>ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vitis vinifera]
Length=492

 Score =   353 bits (907),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD L++++DENGR+L DEEIID+LVMYLNAGHESS H+TMWATV LQ +PE F+RA
Sbjct  265  KKDMMDALLDIEDENGRKLSDEEIIDILVMYLNAGHESSAHVTMWATVKLQENPEFFQRA  324

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEI+R  PP+QK LTL+EIR+MEYL KVIDETLR +TFS  VFREAK D+N+ GYT
Sbjct  325  KAEQEEIIRKRPPNQKRLTLKEIREMEYLPKVIDETLRWITFSFVVFREAKADINICGYT  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR +H D E Y DP  FNP RWD++T + G FLPFG GSRLCPGNDLAKL
Sbjct  385  IPKGWKVLVWFRSLHFDPETYPDPKEFNPCRWDDYTAKPGTFLPFGLGSRLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EIS+FLH+FLL Y+LER NP CP MYLPH+RP+DNCL 
Sbjct  445  EISVFLHHFLLNYQLERLNPGCPRMYLPHSRPRDNCLA  482



>ref|XP_008438234.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Cucumis melo]
Length=498

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +++DMMD L++V+DENGR+L DEEIID+LVMYLNAGHESSGH  MWAT+ L  HPE  K+
Sbjct  270  KRKDMMDALIDVEDENGRKLTDEEIIDILVMYLNAGHESSGHTMMWATILLNQHPEVLKK  329

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEIVR  PP QKGLTL+E R+MEYLSKV+DETLR V+FSL VFREA+ DVN++GY
Sbjct  330  AKEEQEEIVRRRPPGQKGLTLKECREMEYLSKVVDETLRYVSFSLVVFREAQMDVNLNGY  389

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVL WFR +H D+E+Y DP  F+PSRWD F P+AG FLPFGAGSRLCPGNDLAK
Sbjct  390  LIPKGWKVLAWFRSIHYDDEVYPDPKKFDPSRWDGFIPKAGEFLPFGAGSRLCPGNDLAK  449

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI IF+HYFLL Y+LE   PDCP++YLPH+RPKDNCL 
Sbjct  450  LEICIFIHYFLLNYKLEWLTPDCPILYLPHSRPKDNCLA  488



>ref|XP_011010024.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Populus 
euphratica]
 ref|XP_011010025.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Populus 
euphratica]
Length=493

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+ V+DENGR+L DEEIIDV++MYLNAGHESSGHIT WAT+FLQ HP+  ++
Sbjct  265  KKKDMMDSLLGVEDENGRKLTDEEIIDVILMYLNAGHESSGHITTWATIFLQEHPKFLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE+IV+   P QKGL+L+E+R+M+YLSKVIDETLRL+TFSLTVFREAK D +++GY
Sbjct  325  AKEEQEQIVKRRLPAQKGLSLKEVREMDYLSKVIDETLRLITFSLTVFREAKTDFSINGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVWFR VHLD EIY +P  FNPSRWDN+TP+ G FLPFGAGSRLCPGNDLAK
Sbjct  385  IIPKGWKVLVWFRTVHLDPEIYPNPKEFNPSRWDNYTPKPGTFLPFGAGSRLCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL Y L R+NP+C  M+LPHTRP DNC+ 
Sbjct  445  LEISIFLHYFLLDYRLGRENPECRWMFLPHTRPTDNCVA  483



>ref|XP_010941218.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Elaeis guineensis]
Length=492

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +DMMDRLMEV+DENGR+L +EEIID+L+MYLNAGHESSGHITMWATVFLQ HPE F++AK
Sbjct  266  KDMMDRLMEVEDENGRKLSNEEIIDILIMYLNAGHESSGHITMWATVFLQEHPEFFQKAK  325

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
            AEQEEI RN PP QKGLTLRE+R+MEYLSKVIDETLR+V  S   FR+A  DV V+GY I
Sbjct  326  AEQEEIRRNKPPMQKGLTLREVRKMEYLSKVIDETLRIVNISFVAFRKATADVYVNGYLI  385

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GW+V  W+R VH+D E+Y DP  FNPSRWD  TP++G FLPFG GSRLCPGN+LAK+E
Sbjct  386  PKGWRVQTWYRSVHMDPEVYPDPKKFNPSRWDGLTPKSGTFLPFGGGSRLCPGNELAKIE  445

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            ISIFLHYFLL Y+L R NP CP+ YLPH RP DNCL 
Sbjct  446  ISIFLHYFLLKYQLTRLNPKCPVRYLPHPRPTDNCLA  482



>ref|XP_004308741.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+DE+GR+L DEEIID+LVMYLNAGHESSGH  MWATV LQ HP+ F++
Sbjct  268  KKKDMMDALVDVQDEDGRKLTDEEIIDILVMYLNAGHESSGHTMMWATVLLQEHPKVFQK  327

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI+   PP QKGLTL+E R+MEYLSKVIDETLR  +FSL VFREAK DVN++GY
Sbjct  328  AKAEQEEILERRPPTQKGLTLQEYREMEYLSKVIDETLRYNSFSLMVFREAKMDVNINGY  387

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWK L WFR +H D EIY +P  FNPSRWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  388  IIPKGWKALTWFREIHWDSEIYPNPNEFNPSRWDNYTPKPATFLPFGAGSRLCPGNDLAK  447

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI++FLH+FLL YELER +P CP+M+LPH RPKDNCLG
Sbjct  448  LEIAVFLHHFLLDYELERVDPKCPMMHLPHPRPKDNCLG  486



>ref|XP_010457593.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Camelina 
sativa]
Length=489

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 185/218 (85%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K DM+D L+ VKDE+GR LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KIDMLDNLLNVKDEDGRTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I+ N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILENRPEGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVELNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VH+D E+Y +P  F+PSRWD F P+AGAFLPFGAGS LCPGNDLAKL
Sbjct  387  IPKGWKVLTWFRDVHIDPEVYPNPRKFDPSRWDGFVPKAGAFLPFGAGSHLCPGNDLAKL  446

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y ++R NP+CP+MYLPHTRP DNCL 
Sbjct  447  EISIFLHHFLLKYRVKRSNPECPVMYLPHTRPTDNCLA  484



>ref|XP_008232238.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Prunus mume]
Length=501

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGH  MWA VFLQ HP  F++
Sbjct  275  KKKDMMDALLDVVDDDGRKLTDAEIIDVLLMYLNAGHESSGHTMMWAAVFLQKHPNFFQK  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEIV+  PP QKG+T +E R+MEYLS+VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  335  AKAEQEEIVKRRPPTQKGMTFKEYREMEYLSQVIDETLRVVTFSLTVFREAKKDVNINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            ++P+GWKVLVWFR +H D EIY +PL FNP RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  395  SVPKGWKVLVWFRSIHYDSEIYPNPLEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NPD PLMYLPHTRPKDNCL 
Sbjct  455  LEIAIFLHHFLLNYKMERTNPDGPLMYLPHTRPKDNCLA  493



>ref|XP_007008706.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
 gb|EOY17516.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
Length=496

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D LM+VKDE G  LDDEEIID+++MYLNAGHESSGH TMWAT+FLQ + E  ++A
Sbjct  265  KKDMLDALMDVKDEKGETLDDEEIIDIMLMYLNAGHESSGHTTMWATIFLQQYSEFLEKA  324

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I++  P  QKGLTL+EIR+M+YLSKVIDETLRL+TFSLTVFREAK DV++SGYT
Sbjct  325  KAEQERIIKKRPSTQKGLTLKEIREMDYLSKVIDETLRLITFSLTVFREAKTDVHISGYT  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR +HLD EIY +P  FNPSRWD    RAG FLPFGAGSRLCPGNDLAKL
Sbjct  385  IPKGWKVLVWFRSIHLDPEIYTNPKEFNPSRWDYHAARAGTFLPFGAGSRLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI+IFLH+FLL Y+LER NP+  + YLPH+RP DNCL 
Sbjct  445  EIAIFLHHFLLNYQLERLNPESKIRYLPHSRPADNCLA  482



>ref|XP_007217929.1| hypothetical protein PRUPE_ppa004901mg [Prunus persica]
 gb|EMJ19128.1| hypothetical protein PRUPE_ppa004901mg [Prunus persica]
Length=486

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGH  MWA VFLQ HP+ F++
Sbjct  260  KKKDMMDALLDVVDDDGRKLTDAEIIDVLLMYLNAGHESSGHTMMWAAVFLQKHPKIFQK  319

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEIV+  PP QKG+  +E R+MEYLS+VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  320  AKAEQEEIVKRRPPTQKGMAFKEYREMEYLSQVIDETLRVVTFSLTVFREAKKDVNINGY  379

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            ++P+GWKVLVWFR +H D EIY +P+ FNP RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  380  SVPKGWKVLVWFRSIHYDSEIYPNPMEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  439

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NPD PLMYLPHTRPKDNCL 
Sbjct  440  LEIAIFLHHFLLNYKMERTNPDGPLMYLPHTRPKDNCLA  478



>ref|XP_010556999.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Tarenaya hassleriana]
 ref|XP_010557000.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Tarenaya hassleriana]
Length=491

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 187/220 (85%), Gaps = 1/220 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +++DM+D LM+V+DENGR LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ +PE  ++
Sbjct  265  KRKDMLDNLMDVEDENGRHLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQENPEYLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE I++  P  QKGLTL+E R+MEYLS+V+DETLR++TFSLTVFREAK DVNV+GY
Sbjct  325  AKEEQERILKKRPAGQKGLTLKETREMEYLSQVVDETLRVITFSLTVFREAKTDVNVNGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDN-FTPRAGAFLPFGAGSRLCPGNDLA  276
             IP+GWKVL WFR VHLD EIY +P  FNP RWD+ FTP+AGAFLPFG G  LCPGNDLA
Sbjct  385  LIPKGWKVLTWFRNVHLDPEIYPNPKKFNPDRWDDGFTPKAGAFLPFGGGRHLCPGNDLA  444

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLE+SIFLH+FLL Y +ER NP CP+MYLPH RPKDNCL 
Sbjct  445  KLEVSIFLHHFLLNYRVERSNPKCPVMYLPHNRPKDNCLA  484



>ref|XP_010691953.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   348 bits (894),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD L+EV+D+NGR+L DEEIID+LVMYLNAGHESS H  MWATV LQ HPE  ++A
Sbjct  266  KKDMMDALLEVEDDNGRKLTDEEIIDLLVMYLNAGHESSAHTIMWATVLLQQHPEFLQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEIV+N P  QKGLTL+E R+M YLS+VIDETLR VTFS  VFREA  DVN++GYT
Sbjct  326  KAEQEEIVKNRPVGQKGLTLKETRKMTYLSEVIDETLRWVTFSFVVFREAISDVNINGYT  385

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR  HLD E++ +P+ FNPSRW N  P+AG FLPFGAGSRLCPGNDLAKL
Sbjct  386  IPKGWKVLTWFRTCHLDPEVWPEPMKFNPSRWKNLVPKAGTFLPFGAGSRLCPGNDLAKL  445

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y LER NP+C + +LPH RPKDNCL 
Sbjct  446  EISIFLHYFLLNYRLERVNPECTMQFLPHRRPKDNCLA  483



>ref|XP_007008707.1| Ent-kaurenoic acid oxidase 1 isoform 2 [Theobroma cacao]
 gb|EOY17517.1| Ent-kaurenoic acid oxidase 1 isoform 2 [Theobroma cacao]
Length=539

 Score =   350 bits (898),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D LM+VKDE G  LDDEEIID+++MYLNAGHESSGH TMWAT+FLQ + E  ++A
Sbjct  308  KKDMLDALMDVKDEKGETLDDEEIIDIMLMYLNAGHESSGHTTMWATIFLQQYSEFLEKA  367

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I++  P  QKGLTL+EIR+M+YLSKVIDETLRL+TFSLTVFREAK DV++SGYT
Sbjct  368  KAEQERIIKKRPSTQKGLTLKEIREMDYLSKVIDETLRLITFSLTVFREAKTDVHISGYT  427

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR +HLD EIY +P  FNPSRWD    RAG FLPFGAGSRLCPGNDLAKL
Sbjct  428  IPKGWKVLVWFRSIHLDPEIYTNPKEFNPSRWDYHAARAGTFLPFGAGSRLCPGNDLAKL  487

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI+IFLH+FLL Y+LER NP+  + YLPH+RP DNCL 
Sbjct  488  EIAIFLHHFLLNYQLERLNPESKIRYLPHSRPADNCLA  525



>ref|XP_006307341.1| hypothetical protein CARUB_v10008960mg [Capsella rubella]
 gb|EOA40239.1| hypothetical protein CARUB_v10008960mg [Capsella rubella]
Length=492

 Score =   348 bits (894),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K DM+D L+ VKDE+GR LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KIDMLDNLLNVKDEDGRTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I++N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILKNRPEGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD-NFTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D E+Y DP  F+PSRWD  F P+AGAFLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHIDPEVYPDPKKFDPSRWDKGFVPKAGAFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y ++R NP+CP+MYLPHTRP DNCL 
Sbjct  447  LEISIFLHHFLLKYRVKRSNPECPVMYLPHTRPTDNCLA  485



>ref|XP_007039941.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
 gb|EOY24442.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
Length=499

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DM+D L++VKDE G  LDDEEIID+++MYLNAGHESSGH  MWAT+FLQ HPE  ++
Sbjct  264  KKKDMLDALIDVKDEKGETLDDEEIIDIMLMYLNAGHESSGHTIMWATIFLQRHPEFLEK  323

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE I++  PP QKGL+L++IR+M+YLSKVIDETLRLVTFSL VFREA  DVN+SGY
Sbjct  324  AKAEQERIIKKRPPTQKGLSLKDIREMDYLSKVIDETLRLVTFSLMVFREAITDVNISGY  383

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVL WFR VHLD EIY +P  FNPSRWD++  +AG FLPFGAGSRLCPGNDLAK
Sbjct  384  TIPKGWKVLTWFRSVHLDPEIYTNPKEFNPSRWDDYAAKAGTFLPFGAGSRLCPGNDLAK  443

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y+LER NP+  + YLPH+RP DNC+ 
Sbjct  444  LEIAIFLHHFLLNYQLERLNPESKIRYLPHSRPADNCMA  482



>ref|XP_007217930.1| hypothetical protein PRUPE_ppa004910mg [Prunus persica]
 gb|EMJ19129.1| hypothetical protein PRUPE_ppa004910mg [Prunus persica]
Length=486

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGH  MWA VFLQ HP+ F++
Sbjct  260  KKKDMMDALLDVVDDDGRKLTDAEIIDVLLMYLNAGHESSGHTMMWAAVFLQKHPKFFQK  319

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEIV+  PP QKG+T +E R+MEYLS+VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  320  AKAEQEEIVKRRPPTQKGMTFKEYREMEYLSQVIDETLRVVTFSLTVFREAKKDVNINGY  379

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            ++P+GWKVLVWFR +H D EIY +PL FNP RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  380  SVPKGWKVLVWFRSIHYDSEIYPNPLEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  439

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++E  NPD PLMYLPHTRPKDNCL 
Sbjct  440  LEIAIFLHHFLLNYKMEPTNPDGPLMYLPHTRPKDNCLA  478



>ref|XP_008232229.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Prunus mume]
Length=501

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGH  MWA VFLQ HP+ F++
Sbjct  275  KKKDMMDALLDVVDDDGRKLTDAEIIDVLLMYLNAGHESSGHTIMWAAVFLQKHPKFFQK  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEIV+  PP QKG+T +E R+MEYLS+VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  335  AKAEQEEIVKRRPPTQKGMTFKEYREMEYLSQVIDETLRVVTFSLTVFREAKKDVNINGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            ++P+GWKVLVWFR +H D EIY +PL FNP RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  395  SVPKGWKVLVWFRSIHYDSEIYPNPLEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  454

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++E  NPD PLMYLPHTRPKDNCL 
Sbjct  455  LEIAIFLHHFLLNYKMEPTNPDGPLMYLPHTRPKDNCLA  493



>gb|KFK31124.1| hypothetical protein AALP_AA6G071000 [Arabis alpina]
Length=492

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 182/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K DM+D L++ KDENGR L+DEEIIDV++MYLNAGHESSGH  MWAT+ LQ HPE  ++A
Sbjct  267  KEDMLDNLIDAKDENGRTLEDEEIIDVMLMYLNAGHESSGHTIMWATILLQEHPEILQKA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P QKGLTL+E R+MEYLS+VIDETLR++TFSLT FREAK DV V+GY 
Sbjct  327  KEEQEWIVKKKAPGQKGLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVFVNGYI  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY +P  F+PSRW  +TP+AG FLPFG GSRLCPGNDLAKL
Sbjct  387  IPKGWKVLTWFRDVHLDPEIYPEPKKFDPSRWKGYTPKAGTFLPFGLGSRLCPGNDLAKL  446

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y LER NP CP+M+LPHTRPKDNCL 
Sbjct  447  EISIFLHHFLLKYRLERTNPACPVMFLPHTRPKDNCLA  484



>ref|XP_008232239.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Prunus mume]
Length=499

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGHI MWAT+FLQ HPE F++
Sbjct  273  KKKDMMDALLDVVDDDGRKLTDSEIIDVLLMYLNAGHESSGHIIMWATIFLQKHPEYFQK  332

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QKGL L+E R+M +LS VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  333  AKVEQEEILKRRPPTQKGLMLKEYREMVFLSNVIDETLRVVTFSLTVFREAKKDVNINGY  392

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            ++P+GWKVLVWFR +H D EIY +PL FNP RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  393  SVPKGWKVLVWFRSIHYDSEIYPNPLEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  452

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++ER NPD PLMYLPHTRPKDNCL 
Sbjct  453  LEIAIFLHHFLLNYKMERTNPDGPLMYLPHTRPKDNCLA  491



>ref|NP_172008.1| ent-kaurenoic acid oxidase 1 [Arabidopsis thaliana]
 sp|O23051.1|KAO1_ARATH RecName: Full=Ent-kaurenoic acid oxidase 1; Short=AtKAO1; AltName: 
Full=Cytochrome P450 88A3 [Arabidopsis thaliana]
 gb|AAB71462.1| Similar to Zea DWARF3 (gb|U32579) [Arabidopsis thaliana]
 dbj|BAF00896.1| cytochrome P450 like protein [Arabidopsis thaliana]
 gb|ABJ17104.1| At1g05160 [Arabidopsis thaliana]
 gb|AEE27796.1| Ent-kaurenoic acid oxidase 1 [Arabidopsis thaliana]
Length=490

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 189/219 (86%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L+ VKDE+G+ LDDEEIIDVL+MYLNAGHESSGH  MWATVFLQ HPE  +RA
Sbjct  267  KKDMLDNLLNVKDEDGKTLDDEEIIDVLLMYLNAGHESSGHTIMWATVFLQEHPEVLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I+++ P  QKGL+L+E R+ME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILKSRPEGQKGLSLKETRKMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDN-FTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D E++ DP  F+P+RWDN F P+AGAFLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHIDPEVFPDPRKFDPARWDNGFVPKAGAFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y+++R NP+CP+MYLPHTRP DNCL 
Sbjct  447  LEISIFLHHFLLKYQVKRSNPECPVMYLPHTRPTDNCLA  485



>ref|XP_002892270.1| ent-kaurenoic acid hydroxylase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68529.1| ent-kaurenoic acid hydroxylase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 187/220 (85%), Gaps = 2/220 (1%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L+ VKDE+GR LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KKDMLDNLLNVKDEDGRTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KA-EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            K  EQE I++N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY
Sbjct  327  KVNEQEMILKNRPEGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGY  386

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDN-FTPRAGAFLPFGAGSRLCPGNDLA  276
             IP+GWKVL WFR VH+D E+Y DP  F+PSRWDN F P+AGAFLPFGAGS LCPGNDLA
Sbjct  387  LIPKGWKVLTWFRDVHIDPEVYPDPRKFDPSRWDNGFVPKAGAFLPFGAGSHLCPGNDLA  446

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLEISIFLH+FLL Y+++R NP CP+MYLPHTRP DNCL 
Sbjct  447  KLEISIFLHHFLLKYQVKRSNPKCPVMYLPHTRPTDNCLA  486



>ref|XP_009420467.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   346 bits (887),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 187/218 (86%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD L++V+DENGR L+DEEIID+L+MYLNAGHESSGHITMWATVFLQ +P+ F++A
Sbjct  269  KKDMMDNLIDVEDENGRRLNDEEIIDILIMYLNAGHESSGHITMWATVFLQENPDIFEKA  328

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEEI R+MPP QKGLTL E+R+M+YLSKV DETLR+V  S   FR+A KDV ++GY 
Sbjct  329  KAEQEEIRRSMPPAQKGLTLTEVRKMKYLSKVTDETLRMVNISFVTFRQATKDVYLNGYL  388

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+ WKV +WFR VHLD ++Y DP  F+PSRWD+FTP+AG FLPFG GSRLCPGN+LAKL
Sbjct  389  IPKDWKVQLWFRNVHLDPQVYTDPKKFDPSRWDDFTPKAGTFLPFGGGSRLCPGNELAKL  448

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI++FLH+FLLGYEL+R NP CP+ YLPH RP DNC+ 
Sbjct  449  EIAVFLHHFLLGYELKRLNPKCPIRYLPHPRPTDNCMA  486



>ref|XP_004307312.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K DMMD L+EV+DE G++L DE+IID+L+MYLNAGHESSGH  MWAT +LQ HPE F++
Sbjct  279  KKNDMMDSLLEVEDEEGKKLTDEDIIDILLMYLNAGHESSGHTIMWATTYLQKHPEYFQK  338

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE I++  PP QKGL L+E R+MEYLS VIDETLR+V+FSL VFREAK+DVNV+GY
Sbjct  339  AKAEQEAILKRRPPTQKGLNLKEYREMEYLSDVIDETLRIVSFSLMVFREAKQDVNVNGY  398

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVL WFR VHLD  IYE+PL F P RW N+TP+   F+PFG GSRLCPGNDLAK
Sbjct  399  IIPKGWKVLTWFRSVHLDSGIYENPLEFKPDRWKNYTPKPATFMPFGVGSRLCPGNDLAK  458

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +E+ IFLH+FLL Y+LER NP+CPL YLPH RPKDNCL 
Sbjct  459  MEVGIFLHHFLLNYKLERVNPECPLRYLPHPRPKDNCLA  497



>ref|XP_010475187.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Camelina sativa]
 ref|XP_010475188.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Camelina sativa]
Length=490

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 185/219 (84%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K DM+D L+ VKDE+GR LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KVDMLDNLLNVKDEDGRTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I+ N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILENRPEGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVELNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD-NFTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D E+Y +P  F+PSRWD  F P+AGAFLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHIDPEVYPNPRKFDPSRWDKGFVPKAGAFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y ++R NP+CP+MYLPHTRP DNCL 
Sbjct  447  LEISIFLHHFLLKYRVKRSNPECPVMYLPHTRPTDNCLA  485



>ref|XP_004133946.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Cucumis sativus]
Length=498

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +++DMMD L++V+DENGR+L DEEIID+LVMYLNAGHESSGH  MWAT+ L  HPE  K+
Sbjct  270  KRKDMMDALIDVEDENGRKLTDEEIIDILVMYLNAGHESSGHTMMWATILLNQHPEVLKK  329

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEIVR  P  QKGLTL+E R MEYLSKV+DETLR V+FSL VFREA+ DVN++GY
Sbjct  330  AKEEQEEIVRRRPAGQKGLTLKECRDMEYLSKVVDETLRYVSFSLVVFREAQMDVNLNGY  389

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVL WFR +H D+E+Y DP  F+PSRWD F P+AG FLPFGAGSRLCPGNDLAK
Sbjct  390  LIPKGWKVLAWFRSIHYDDEVYPDPKKFDPSRWDGFIPKAGEFLPFGAGSRLCPGNDLAK  449

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI IF+HYFLL Y+LE   PDC ++YLPH+RPKDNCL 
Sbjct  450  LEICIFIHYFLLNYKLEWLTPDCQILYLPHSRPKDNCLA  488



>ref|XP_010457591.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010457592.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Camelina 
sativa]
Length=490

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 185/219 (84%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K DM+D L+ VKDE+GR LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KIDMLDNLLNVKDEDGRTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I+ N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILENRPEGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVELNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD-NFTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D E+Y +P  F+PSRWD  F P+AGAFLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHIDPEVYPNPRKFDPSRWDKGFVPKAGAFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y ++R NP+CP+MYLPHTRP DNCL 
Sbjct  447  LEISIFLHHFLLKYRVKRSNPECPVMYLPHTRPTDNCLA  485



>ref|XP_007219798.1| hypothetical protein PRUPE_ppa026558mg [Prunus persica]
 gb|EMJ20997.1| hypothetical protein PRUPE_ppa026558mg [Prunus persica]
Length=492

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGH  MWA VFLQ HP+ F++
Sbjct  266  KKKDMMDALLDVVDDDGRKLTDAEIIDVLLMYLNAGHESSGHTMMWAAVFLQKHPKFFQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP QKG+T +E R+MEYLS+VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  326  AKAEQEGIVKRRPPTQKGMTFKEYREMEYLSQVIDETLRVVTFSLTVFREAKKDVNINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            ++P+GWKVLVWFR +H D EIY +PL FNP RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  386  SVPKGWKVLVWFRSIHYDSEIYPNPLEFNPDRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  445

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++E  NPD PLMYLPHTRPKDNCL 
Sbjct  446  LEIAIFLHHFLLNYKMEPTNPDGPLMYLPHTRPKDNCLA  484



>ref|XP_006418058.1| hypothetical protein EUTSA_v10009356mg [Eutrema salsugineum]
 gb|ESQ36411.1| hypothetical protein EUTSA_v10009356mg [Eutrema salsugineum]
Length=491

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L++VKDE G+ LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KKDMLDNLLDVKDEKGKTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I++N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILKNRPKGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD-NFTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D EIY DP  F+PSRWD  F P+AG+FLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHMDPEIYPDPRKFDPSRWDKGFVPKAGSFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEIS+FLH+F+L Y ++R N +CP+MYLPHTRP DNCL 
Sbjct  447  LEISVFLHHFILKYRVKRSNTECPVMYLPHTRPTDNCLA  485



>ref|XP_010510017.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Camelina 
sativa]
Length=367

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++V+DENGR LDDEEIID+L+MYLNAGHESSGH+ MW+T+ LQ HPE  ++A
Sbjct  144  RKDMLDNLIDVEDENGRTLDDEEIIDILLMYLNAGHESSGHLIMWSTILLQEHPEILQKA  203

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IVR   P QK LTL+E R+ME+LS+VIDETLR++TFSLT FREAK DV ++GY 
Sbjct  204  KDEQERIVRKRAPGQK-LTLKETREMEFLSQVIDETLRVITFSLTAFREAKSDVQINGYI  262

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW  +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  263  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWKGYTPKAGTFLPFGLGSHLCPGNDLAKL  322

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPH RPKDNCL 
Sbjct  323  EISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNCLA  360



>ref|XP_008788752.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Phoenix 
dactylifera]
Length=423

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +DMMDRLME +DE G  L +EEIID+++MYLNAGHESSGHITMWATV LQ HPE F++AK
Sbjct  199  KDMMDRLMEAEDETGSRLSNEEIIDIMIMYLNAGHESSGHITMWATVLLQDHPEIFQKAK  258

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
            AEQEEI RN PP QKGLTL+E R+MEYLSKVIDETLR+V  S   FR+A  DV V+GY I
Sbjct  259  AEQEEIRRNKPPMQKGLTLKEFRKMEYLSKVIDETLRVVNISFVAFRQATDDVYVNGYLI  318

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GW+V  W+R VH+D ++Y DP  FNPSRWD+ TP+ G FLPFG GSRLCPGN+LAKLE
Sbjct  319  PKGWRVQTWYRSVHMDPQVYPDPKDFNPSRWDDLTPKPGTFLPFGGGSRLCPGNELAKLE  378

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            IS+FLH+FLLGY+L R NP CP+ YLPH RP DNCL 
Sbjct  379  ISVFLHHFLLGYQLARVNPTCPIRYLPHPRPMDNCLA  415



>ref|XP_006410376.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
 ref|XP_006410377.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
 gb|ESQ51829.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
 gb|ESQ51830.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
Length=489

 Score =   343 bits (880),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L++ +DENGR LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  K+A
Sbjct  266  KKDMLDNLIDAEDENGRTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEILKKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P Q  LTL+E R+MEYLS+VIDETLR++TFSLT FREAK DV ++GY 
Sbjct  326  KEEQERIVKKRAPGQ-SLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQMNGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD E Y DP  F+PSRW+ +TP+AG FLPFG GSRLCPGNDLAKL
Sbjct  385  IPKGWKVLAWFRDVHLDPETYPDPKKFDPSRWEGYTPKAGTFLPFGLGSRLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPHTRPKDNCL 
Sbjct  445  EISIFLHHFLLKYRVERSNPGCPVMFLPHTRPKDNCLA  482



>emb|CDY48265.1| BnaA05g10890D [Brassica napus]
Length=489

 Score =   343 bits (880),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L+E KDENGR L+DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  ++A
Sbjct  266  KKDMLDNLIEAKDENGRTLEDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEILQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P Q  LTL+E R+MEYLS+VIDETLR++TFSLT FREAK DV ++GY 
Sbjct  326  KEEQERIVKKRAPGQ-SLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQMNGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW+ +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  385  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPHTRPKDNCL 
Sbjct  445  EISIFLHHFLLKYRVERSNPGCPVMFLPHTRPKDNCLA  482



>emb|CDY49505.1| BnaC05g03170D [Brassica napus]
Length=490

 Score =   343 bits (880),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L++V+DENG+ LDDEEI+DVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KKDMLDNLIDVEDENGKTLDDEEIVDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I+ N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILENRPKGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD-NFTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D E++ DP  F+PSRWD  F P+AGAFLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHMDPEVFPDPRKFDPSRWDKGFIPKAGAFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y ++R N +CP+MYLPHTRP DNCL 
Sbjct  447  LEISIFLHHFLLKYRVKRSNTECPVMYLPHTRPTDNCLA  485



>ref|XP_009143990.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143991.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143992.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143993.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143994.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
Length=489

 Score =   343 bits (880),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L+E KDENGR L+DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  ++A
Sbjct  266  KKDMLDNLIEAKDENGRTLEDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEILQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P Q  LTL+E R+MEYLS+VIDETLR++TFSLT FREAK DV ++GY 
Sbjct  326  KEEQERIVKKRAPGQ-SLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQMNGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW+ +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  385  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPHTRPKDNCL 
Sbjct  445  EISIFLHHFLLKYRVERSNPGCPVMFLPHTRPKDNCLA  482



>ref|XP_010691952.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   343 bits (880),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 181/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DMMD L+EV+DEN R+L DEEIID+LVMYLNAGHESSGH  MWATV LQ +PE  ++A
Sbjct  266  KKDMMDALLEVEDENRRKLTDEEIIDLLVMYLNAGHESSGHTLMWATVLLQQNPEFMQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE+IV+  P  QKGLTL+E RQM YLS+V+DETLR +TFS  VFREA  DV ++GYT
Sbjct  326  KAEQEDIVKRRPAGQKGLTLKETRQMTYLSQVVDETLRWLTFSFVVFREAISDVKINGYT  385

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVWFR  HLD EI+ +P+ FNPSRW++  PRAG FLPFGAGSRLCPGNDLAKL
Sbjct  386  IPQGWKVLVWFRTCHLDPEIWPEPMKFNPSRWNDLVPRAGTFLPFGAGSRLCPGNDLAKL  445

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI IFLHYFLL Y LER NPDC + YLPH RPKDNCL 
Sbjct  446  EILIFLHYFLLNYRLERVNPDCAVQYLPHRRPKDNCLA  483



>ref|XP_008799425.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Phoenix dactylifera]
Length=455

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +DMMDRLMEV+DENGR L +EEIID+L+MYLNAGHESSGHITMWATVFLQ +PE F++AK
Sbjct  229  KDMMDRLMEVEDENGRRLSNEEIIDILLMYLNAGHESSGHITMWATVFLQENPEYFQKAK  288

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
            AEQEEI RN PP QKGLTL+E++QMEYLSKVIDETLR+V  S   FR+A  DV V+GY I
Sbjct  289  AEQEEIRRNKPPMQKGLTLKEVKQMEYLSKVIDETLRIVNISFVAFRKATADVYVNGYLI  348

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GW+V  W+R VHLD E+Y DP  FNPSRWD  TP++G FL FG GSRLCPGN+LAKLE
Sbjct  349  PKGWRVQTWYRSVHLDPEVYPDPKKFNPSRWDGLTPKSGTFLAFGGGSRLCPGNELAKLE  408

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            I++FLHYFLL Y L R NP C + YLPH RP DNCL 
Sbjct  409  ITVFLHYFLLDYRLTRLNPKCLMRYLPHPRPTDNCLA  445



>gb|AAK11564.1|AF318500_1 ent-kaurenoic acid hydroxylase [Arabidopsis thaliana]
Length=490

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 188/219 (86%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L+ VKDE+G+ LDDEEIIDVL+MYLNAGHESSGH  MWATVFLQ HPE  +RA
Sbjct  267  KKDMLDNLLNVKDEDGKTLDDEEIIDVLLMYLNAGHESSGHTIMWATVFLQEHPEVLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I+++ P  QKGL+L+E R+ME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILKSRPEGQKGLSLKETRKMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDN-FTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D E++ DP  F+P+RWDN F P+AGAFLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHIDPEVFPDPRKFDPARWDNGFVPKAGAFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y+++R NP+C +MYLPHTRP DNCL 
Sbjct  447  LEISIFLHHFLLKYQVKRSNPECLVMYLPHTRPTDNCLA  485



>gb|AAG41777.1|AF212991_1 ent-kaurenoic acid oxidase [Cucurbita maxima]
Length=496

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 180/219 (82%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +++DMMD+L+++ DENGR+LDDEEIID+L+MYLNAGHESSGH  MWAT+ L  HPE  K+
Sbjct  268  KRKDMMDQLIDIVDENGRKLDDEEIIDILIMYLNAGHESSGHTMMWATILLNQHPEVLKK  327

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            A+ EQE IVRN P  Q GLTL+E R MEYLSKV+DETLR V+FSL VFREA+ DVN++GY
Sbjct  328  AREEQEAIVRNRPAGQTGLTLKECRDMEYLSKVVDETLRYVSFSLVVFREAQMDVNLNGY  387

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVL WFR +H D E+Y DP  F PSRWD F P+AG FLPFGAGSRLCPGNDLAK
Sbjct  388  LIPKGWKVLAWFRSIHYDSEVYPDPKKFEPSRWDGFVPKAGEFLPFGAGSRLCPGNDLAK  447

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI IF+HYFLL Y LE   PDC ++YLPH+RPKDNC+ 
Sbjct  448  LEICIFVHYFLLNYNLEWLTPDCEILYLPHSRPKDNCMA  486



>ref|XP_007147426.1| hypothetical protein PHAVU_006G123600g [Phaseolus vulgaris]
 gb|ESW19420.1| hypothetical protein PHAVU_006G123600g [Phaseolus vulgaris]
Length=488

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 187/219 (85%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++V DE+GR+L+DE+IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++
Sbjct  266  KAKDMMDALIDVADEDGRKLNDEDIIDIMLMYLNAGHESSGHITMWATFFLQKHPEYLQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEIVR  PP QKGLTL+E+R+M++L KVIDET+R++TFSL VFREAK DVN++GY
Sbjct  326  AKAEQEEIVRRRPPTQKGLTLQEVREMDFLYKVIDETMRVITFSLVVFREAKSDVNINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWK LVWFR VHLD EIY +P  FNP RW N   +AG FLPFGAGSRLCPGNDLAK
Sbjct  386  IIPKGWKALVWFRSVHLDPEIYPNPKEFNPYRW-NKEHKAGEFLPFGAGSRLCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EI++FLH FLL Y  E++NP+CP+ YLPHTRP DNCLG
Sbjct  445  MEIAVFLHNFLLNYRFEQQNPNCPVRYLPHTRPMDNCLG  483



>ref|XP_002319447.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
 gb|EEE95370.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
Length=490

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 189/219 (86%), Gaps = 3/219 (1%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V+DENGR+L DEE+ID+++MYLNAGHESSGHIT WAT+FLQ HPE F++
Sbjct  265  KKKDMMDSLLDVEDENGRKLTDEEVIDIMLMYLNAGHESSGHITTWATIFLQDHPEYFQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE+I++  P  QK L+L+E+R+M+YLSKVIDETLR+VTFSLTVFREAK D  ++GY
Sbjct  325  AKEEQEQIIKRRPLTQKRLSLKEVREMKYLSKVIDETLRMVTFSLTVFREAKTDFCMNGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVL WFR +HLD E+Y +P  FNPSRWD++TP+AG FLPFGAGSRLCPGN+LAK
Sbjct  385  TIPKGWKVLAWFRTIHLDPEVYPNPKEFNPSRWDDYTPKAGTFLPFGAGSRLCPGNNLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL Y   R+NP+C   +LPHTRP DNCL 
Sbjct  445  LEISIFLHYFLLDY---RQNPECSWRFLPHTRPIDNCLA  480



>gb|KHN14287.1| Ent-kaurenoic acid oxidase 2 [Glycine soja]
Length=493

 Score =   341 bits (875),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 187/219 (85%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++V+D++GR+L DE+IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++
Sbjct  266  KAKDMMDALIDVEDDDGRKLSDEDIIDIMLMYLNAGHESSGHITMWATFFLQKHPEYLQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI+R  PP QKGLTL+E+R+M++L KVIDETLR++TFSL VFREAK DVN++GY
Sbjct  326  AKAEQEEIIRRRPPTQKGLTLKEVREMDFLYKVIDETLRVITFSLVVFREAKSDVNINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWK LVWFR VHLD EIY +P  FNP RW N   +AG FLPFG GSRLCPGNDLAK
Sbjct  386  TIPKGWKALVWFRSVHLDPEIYPNPKEFNPYRW-NKEHKAGEFLPFGGGSRLCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EI++FLH+FLL Y  E+ NP+CP+ YLPHTRP DNCLG
Sbjct  445  MEIAVFLHHFLLNYRFEQHNPNCPVRYLPHTRPMDNCLG  483



>ref|XP_003546291.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Glycine max]
Length=494

 Score =   341 bits (875),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 187/219 (85%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++V+D++GR+L DE+IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++
Sbjct  267  KAKDMMDALIDVEDDDGRKLSDEDIIDIMLMYLNAGHESSGHITMWATFFLQKHPEYLQK  326

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI+R  PP QKGLTL+E+R+M++L KVIDETLR++TFSL VFREAK DVN++GY
Sbjct  327  AKAEQEEIIRRRPPTQKGLTLKEVREMDFLYKVIDETLRVITFSLVVFREAKSDVNINGY  386

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWK LVWFR VHLD EIY +P  FNP RW N   +AG FLPFG GSRLCPGNDLAK
Sbjct  387  TIPKGWKALVWFRSVHLDPEIYPNPKEFNPYRW-NKEHKAGEFLPFGGGSRLCPGNDLAK  445

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EI++FLH+FLL Y  E+ NP+CP+ YLPHTRP DNCLG
Sbjct  446  MEIAVFLHHFLLNYRFEQHNPNCPVRYLPHTRPMDNCLG  484



>ref|XP_009119194.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 ref|XP_009119195.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 ref|XP_009119196.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 emb|CDY46834.1| BnaA10g03180D [Brassica napus]
Length=490

 Score =   341 bits (874),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 185/219 (84%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L++V+DENG+ LDDEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  +RA
Sbjct  267  KKDMLDNLIDVEDENGKTLDDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEFLQRA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQE I+ N P  QKGLTL+E RQME+LS+V+DETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KAEQEMILENRPKGQKGLTLKETRQMEFLSQVVDETLRVITFSLTAFREAKTDVEMNGYL  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD-NFTPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL WFR VH+D E++ DP  F+PSRWD  F P+AGAFLPFGAGS LCPGNDLAK
Sbjct  387  IPKGWKVLTWFRDVHMDPEVFPDPRKFDPSRWDKGFIPKAGAFLPFGAGSHLCPGNDLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLH+FLL Y ++R N +C +MYLPHTRP DNCL 
Sbjct  447  LEISIFLHHFLLKYRVKRSNTECQVMYLPHTRPTDNCLA  485



>ref|XP_002879389.1| ent-kaurenoic acid hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55648.1| ent-kaurenoic acid hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++VKDENGR LDDEEIID+L+MYLNAGHESSGH+TMWAT+ +Q HPE  ++A
Sbjct  266  RKDMLDNLIDVKDENGRVLDDEEIIDLLLMYLNAGHESSGHLTMWATILMQEHPEILQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+N    QK LTL+E R+MEYLS+VIDETLR++TFSLT FREAK DV + GY 
Sbjct  326  KEEQERIVKNRALGQK-LTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQIDGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW+ +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  385  IPKGWKVLTWFRNVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPH RPKDNCL 
Sbjct  445  EISIFLHHFLLRYRVERSNPGCPVMFLPHNRPKDNCLA  482



>ref|XP_010934998.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Elaeis guineensis]
Length=489

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +DMMDRLME +DE G  L +EEIID+++MYLNAGHESSGHITMW TV LQ HPE F++AK
Sbjct  265  KDMMDRLMEAEDEKGSRLSNEEIIDIMIMYLNAGHESSGHITMWVTVLLQEHPEIFQKAK  324

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
            AEQEEI R++PP QK LTL+E R+MEYLSKVIDETLR+V  S   FR+A  DV V+GY I
Sbjct  325  AEQEEIRRSLPPMQKRLTLKEFRKMEYLSKVIDETLRMVNISFVAFRQATDDVYVNGYLI  384

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GWKV  W+R VH+D E+Y DP  FNPSRWD  TP+ G FLPFG GSRLCPGN+LAKLE
Sbjct  385  PKGWKVQTWYRTVHMDPEVYPDPKNFNPSRWDGITPKPGTFLPFGGGSRLCPGNELAKLE  444

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            IS+FLH+FLLGY+L+R+NP CP+ YLPH RP DNCL 
Sbjct  445  ISVFLHHFLLGYQLKRRNPKCPIRYLPHPRPMDNCLA  481



>ref|XP_009392783.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +DMMD LMEV+D+ GR LDDEEIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F++ K
Sbjct  267  KDMMDALMEVEDDKGRRLDDEEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFEKTK  326

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
             EQEEI R++PP QKGLT++EIR+MEYLSKVIDETLR+V  +   FR+A +D  V+GY I
Sbjct  327  LEQEEIQRSIPPTQKGLTMKEIRKMEYLSKVIDETLRIVNIAFVSFRQATEDTYVNGYLI  386

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GWKV +W+R V+LD  IY DP  FNPSRWD+FTP+AG+FLPFG GSRLCPGN+LAKLE
Sbjct  387  PKGWKVQLWYRSVNLDPHIYPDPTNFNPSRWDHFTPKAGSFLPFGLGSRLCPGNELAKLE  446

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            IS+FLHYF+LGY+L RK+P C + YLPH RP DNC+ 
Sbjct  447  ISVFLHYFVLGYQLTRKDPHCRVRYLPHPRPTDNCMA  483



>ref|XP_010228115.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Brachypodium 
distachyon]
Length=422

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 181/216 (84%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+EV+DE GR L+DEEIIDVLVMYLNAGHESS HITMWATVFLQ +P+   +AKA
Sbjct  196  DMMDRLIEVEDEQGRRLEDEEIIDVLVMYLNAGHESSAHITMWATVFLQENPDILAKAKA  255

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV V+GY +P
Sbjct  256  EQEEIMRSIPPTQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLVP  315

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  FNPSRW+   PRAG FLPFG GSRLCPGNDLAKLEI
Sbjct  316  KGWKVQLWYRSVHMDPQVYPDPKKFNPSRWEGPPPRAGTFLPFGLGSRLCPGNDLAKLEI  375

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FL+GY LER+NP+C + YLPH RP DNCL 
Sbjct  376  SVFLHHFLVGYRLERENPNCRVRYLPHPRPVDNCLA  411



>ref|XP_010469584.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Camelina sativa]
 ref|XP_010469585.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Camelina sativa]
Length=489

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++V+DENGR LDDEEIID+L+MYLNAGHESSGH+ MW+T+ LQ HPE  ++A
Sbjct  266  RKDMLDNLIDVEDENGRTLDDEEIIDILLMYLNAGHESSGHLIMWSTILLQEHPEILQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE I+R   P QK LTL+E R+MEYLS+VIDETLR++TFSLT FREAK DV ++GY 
Sbjct  326  KEEQERILRKRAPGQK-LTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQINGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW  +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  385  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWKGYTPKAGTFLPFGLGSHLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPH RPKDNCL 
Sbjct  445  EISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNCLA  482



>ref|XP_011469589.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca 
subsp. vesca]
Length=566

 Score =   341 bits (875),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+EV+DE G +L DE+IID+LVMYLNAGHESSGH  MWAT +LQ HPE F++
Sbjct  279  KKKDMMDSLLEVEDEEGNKLTDEDIIDILVMYLNAGHESSGHTIMWATTYLQQHPEYFQK  338

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE I++  PP Q GL L+E R+MEYLS VIDETL +V+FS  VFREAKKDVNV+GY
Sbjct  339  AKAEQEAILKRRPPTQNGLNLKEYREMEYLSHVIDETLCVVSFSSFVFREAKKDVNVNGY  398

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVL WFR VHLD  IYE+PL F P RW N+TP+   F+PFGAGSRLCPGNDLA+
Sbjct  399  IIPKGWKVLTWFRSVHLDSGIYENPLEFKPDRWKNYTPKPATFMPFGAGSRLCPGNDLAQ  458

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +E+ IFLH+FLL Y+LER NP+CPL YLPH RPKDNCL 
Sbjct  459  MEVGIFLHHFLLNYKLERVNPECPLRYLPHLRPKDNCLA  497



>ref|XP_006847688.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Amborella trichopoda]
 gb|ERN09269.1| hypothetical protein AMTR_s00149p00053760 [Amborella trichopoda]
Length=494

 Score =   338 bits (868),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 184/218 (84%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D LM+V+DENGR L D+EIID L+MYLNAGHESSGHITMWAT+ LQ +P AF++A
Sbjct  268  RKDMLDSLMDVQDENGRHLADDEIIDTLIMYLNAGHESSGHITMWATLLLQQNPLAFQKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+R  PP+QKGL+L+E R+M YLSKVIDETLR+V  S  VFR+A  DV ++GY 
Sbjct  328  KEEQEEILRRRPPNQKGLSLQETREMVYLSKVIDETLRVVNISFVVFRQAVNDVMINGYI  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            +P+GWK  VW R VH+D ++Y +P TFNPSRWD++TP+AG+F+PF AGSRLCPGNDLAKL
Sbjct  388  VPKGWKTQVWLRNVHMDPKVYHEPGTFNPSRWDDYTPKAGSFIPFSAGSRLCPGNDLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EIS+FLHYFLL Y+LER NPDC + YLPH RPKDNCL 
Sbjct  448  EISVFLHYFLLDYQLERVNPDCAVNYLPHPRPKDNCLA  485



>ref|XP_010510015.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010510016.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Camelina 
sativa]
Length=489

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++V+DENGR LDDEEIID+L+MYLNAGHESSGH+ MW+T+ LQ HPE  ++A
Sbjct  266  RKDMLDNLIDVEDENGRTLDDEEIIDILLMYLNAGHESSGHLIMWSTILLQEHPEILQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IVR   P QK LTL+E R+ME+LS+VIDETLR++TFSLT FREAK DV ++GY 
Sbjct  326  KDEQERIVRKRAPGQK-LTLKETREMEFLSQVIDETLRVITFSLTAFREAKSDVQINGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW  +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  385  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWKGYTPKAGTFLPFGLGSHLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPH RPKDNCL 
Sbjct  445  EISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNCLA  482



>ref|XP_007219847.1| hypothetical protein PRUPE_ppa027023mg [Prunus persica]
 gb|EMJ21046.1| hypothetical protein PRUPE_ppa027023mg [Prunus persica]
Length=486

 Score =   338 bits (866),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L++V D++GR+L D EIIDVL+MYLNAGHESSGH  MWA VFLQ HP+ F++
Sbjct  260  KKKDMMDALLDVVDDDGRKLTDAEIIDVLLMYLNAGHESSGHTMMWAAVFLQKHPKFFQK  319

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP QKG+T +E R+MEYLS+VIDETLR+VTFSLTVFREAKKDVN++GY
Sbjct  320  AKAEQEGIVKRRPPTQKGMTFKEYREMEYLSQVIDETLRVVTFSLTVFREAKKDVNINGY  379

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            ++P+GWKVLVWFR +H D EIY +PL FN  RWDN+TP+   FLPFGAGSRLCPGNDLAK
Sbjct  380  SVPKGWKVLVWFRSIHYDSEIYPNPLEFNHDRWDNYTPKPLTFLPFGAGSRLCPGNDLAK  439

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL Y++E  NPD PLM LPHTRPKDNCL 
Sbjct  440  LEIAIFLHHFLLNYKMEPTNPDGPLMNLPHTRPKDNCLA  478



>ref|XP_006294074.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 ref|XP_006294075.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 gb|EOA26972.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 gb|EOA26973.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
Length=498

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++V+DENGR LDDEEIIDVL+MYLNAGHESSGH+TMW+T+ +  HPE  ++A
Sbjct  275  RKDMLDNLIDVEDENGRTLDDEEIIDVLLMYLNAGHESSGHLTMWSTILMHEHPEILQKA  334

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P QK LTL+E R+MEYLS+VIDET R++TFSLT FREAK DV ++GY 
Sbjct  335  KEEQERIVKKRAPGQK-LTLKETREMEYLSQVIDETFRIITFSLTAFREAKSDVQINGYI  393

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW+ +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  394  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKL  453

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP+CP+M+LPH RPKDNCL 
Sbjct  454  EISIFLHHFLLKYRVERSNPECPVMFLPHNRPKDNCLA  491



>ref|XP_004486502.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Cicer arietinum]
Length=486

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
             + +DMMD L++VKDENG+ L D+EIID+++MYLNAGHESSGHITMWAT FLQ HPE F+
Sbjct  260  QKAKDMMDALIDVKDENGKILGDDEIIDIMLMYLNAGHESSGHITMWATYFLQRHPEFFR  319

Query  635  RAKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            +AK EQEEI+R  PP QKGL L E+R+MEYLSKVIDET+R+VTFSL VFREA  DVN++G
Sbjct  320  KAKEEQEEIIRKRPPTQKGLKLEEVRKMEYLSKVIDETMRVVTFSLMVFREATSDVNING  379

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            Y IP+GWKVL WFR VHLD EIY +P  FNP RW N   +AG FLPFGAG+RLCPGNDLA
Sbjct  380  YLIPKGWKVLTWFRSVHLDPEIYPNPKEFNPERW-NEVHKAGEFLPFGAGTRLCPGNDLA  438

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNC  162
            KLEIS+FLH+FLL Y+LE+ NP  P+M+LPHTRP DNC
Sbjct  439  KLEISVFLHHFLLNYKLEQLNPKSPVMFLPHTRPVDNC  476



>ref|XP_010413993.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Camelina sativa]
 ref|XP_010413994.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Camelina sativa]
Length=492

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++V+DENGR LDDEEIID+L+MYLNAGHESSGH+ MW+T+ LQ HPE  ++A
Sbjct  269  RKDMLDNLIDVEDENGRTLDDEEIIDILLMYLNAGHESSGHLIMWSTILLQEHPEILQKA  328

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE I+R   P QK LTL+E R+MEYLS+VIDETLR++TFSLT FREAK D+ ++GY 
Sbjct  329  KEEQERILRKRAPGQK-LTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDLQINGYI  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW  +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  388  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWKGYTPKAGTFLPFGLGSHLCPGNDLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPH RPKDNCL 
Sbjct  448  EISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNCLA  485



>gb|KEH37115.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=490

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 182/220 (83%), Gaps = 0/220 (0%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
             + +DMMD L++V DENGR+L D+EIID+++MYLNAGHESSGH+TMWAT FLQ HPE FK
Sbjct  263  QKAKDMMDALVDVVDENGRKLGDDEIIDIMLMYLNAGHESSGHVTMWATYFLQRHPEFFK  322

Query  635  RAKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            +AK EQEEI+R  P  QKGL L ++R+M+YLSKVIDETLRL+TFSL VFREA  DVN++G
Sbjct  323  KAKEEQEEILRRRPSTQKGLKLEDVRKMDYLSKVIDETLRLITFSLVVFREATSDVNING  382

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            Y IP+GW+VLVWFR VHLD EIY  P  FNP RW++   RAG FLPFG G+RLCPGNDLA
Sbjct  383  YLIPKGWRVLVWFRSVHLDPEIYPKPFEFNPDRWESEVHRAGEFLPFGVGTRLCPGNDLA  442

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLEIS+FLH+FLL YELE+ NP  P+ +LPHTRP DNCL 
Sbjct  443  KLEISVFLHHFLLNYELEQINPKSPVRFLPHTRPMDNCLA  482



>ref|XP_004486504.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Cicer 
arietinum]
Length=491

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 186/216 (86%), Gaps = 1/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMD L++V+D+NGR+L DE IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++AK 
Sbjct  269  DMMDSLIDVEDDNGRKLSDEYIIDIMLMYLNAGHESSGHITMWATYFLQKHPEYLQKAKE  328

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI++  PP QKGLTL+EIR M++L KVIDET+R++TFSL VFREAK DV+++GYTIP
Sbjct  329  EQEEIIKKRPPTQKGLTLKEIRAMDFLYKVIDETMRVITFSLVVFREAKSDVSMNGYTIP  388

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKVLVWFR +HLD EIY +P  FNP+RW N   +AG FLPFGAG+RLCPGNDLAK+EI
Sbjct  389  KGWKVLVWFRSIHLDPEIYPNPKEFNPNRW-NKEHKAGEFLPFGAGTRLCPGNDLAKMEI  447

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            ++FLH+F+L Y+LE+ NP CP+ YLPHTRP DNCLG
Sbjct  448  AVFLHHFILNYQLEQLNPKCPVRYLPHTRPMDNCLG  483



>ref|XP_004486505.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Cicer 
arietinum]
Length=490

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMD L++V+D+NGR+L DE IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++AK 
Sbjct  269  DMMDSLIDVEDDNGRKLSDEYIIDIMLMYLNAGHESSGHITMWATYFLQKHPEYLQKAKE  328

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI++  PP QKGLTL+EIR M++L KVIDET+R++TFSL VFREAK DV+++GYTIP
Sbjct  329  EQEEIIKKRPPTQKGLTLKEIRAMDFLYKVIDETMRVITFSLVVFREAKSDVSMNGYTIP  388

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKVLVWFR +HLD EIY +P  FNP+RW+    +AG FLPFGAG+RLCPGNDLAK+EI
Sbjct  389  KGWKVLVWFRSIHLDPEIYPNPKEFNPNRWNEH--KAGEFLPFGAGTRLCPGNDLAKMEI  446

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            ++FLH+F+L Y+LE+ NP CP+ YLPHTRP DNCLG
Sbjct  447  AVFLHHFILNYQLEQLNPKCPVRYLPHTRPMDNCLG  482



>gb|KEH37116.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=491

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 187/219 (85%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++V+D+NGR+L DE+IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++
Sbjct  266  KAKDMMDSLIDVEDDNGRKLGDEDIIDIMLMYLNAGHESSGHITMWATYFLQKHPEYLQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QKGLTL+EIR M++L KVIDET+R++TFSL VFREAK DV ++GY
Sbjct  326  AKEEQEEIIKRRPPTQKGLTLKEIRGMDFLYKVIDETMRVITFSLVVFREAKSDVMINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVL WFR VHLD EIY +P  FNP+RW N   +AG FLPFGAG+RLCPGNDLAK
Sbjct  386  TIPKGWKVLTWFRSVHLDPEIYPNPKEFNPNRW-NKEHKAGEFLPFGAGTRLCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EI++FLH+F+L Y+LE+ NP CP+ YLPHTRP DNCLG
Sbjct  445  MEIAVFLHHFILNYQLEQLNPKCPVRYLPHTRPMDNCLG  483



>ref|XP_007147425.1| hypothetical protein PHAVU_006G123500g [Phaseolus vulgaris]
 gb|ESW19419.1| hypothetical protein PHAVU_006G123500g [Phaseolus vulgaris]
Length=486

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 184/217 (85%), Gaps = 1/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +DMMD L++V+DENGR+L DE++ID+++MYLNAGHESSGHIT WAT FLQ HPE FK+AK
Sbjct  265  KDMMDALIDVEDENGRKLGDEDVIDIMLMYLNAGHESSGHITTWATYFLQRHPEFFKKAK  324

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
             EQEEI+RN P  QKGLTL E+R+MEYLSKV+DETLR++TFSL VFRE K DVN++GY I
Sbjct  325  EEQEEIIRNRPATQKGLTLAEVRKMEYLSKVVDETLRIITFSLMVFRETKNDVNINGYLI  384

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GWKV+ WFR VHLD EIY +P  FNP RW N   +AG FLPFGAG+RLCPGNDLAKLE
Sbjct  385  PKGWKVMTWFRSVHLDPEIYPNPKDFNPERW-NEVRKAGEFLPFGAGTRLCPGNDLAKLE  443

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            IS+FLH+FLLGY+LE+ NP  P+ +LPHTRP DNC+ 
Sbjct  444  ISVFLHHFLLGYQLEQLNPLAPMKFLPHTRPIDNCMA  480



>ref|NP_180803.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
 ref|NP_001189657.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
 sp|Q9C5Y2.2|KAO2_ARATH RecName: Full=Ent-kaurenoic acid oxidase 2; Short=AtKAO2; AltName: 
Full=Cytochrome P450 88A4 [Arabidopsis thaliana]
 gb|AAC69934.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|ABJ17103.1| At2g32440 [Arabidopsis thaliana]
 gb|AEC08685.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
 gb|AEC08686.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
Length=489

 Score =   336 bits (861),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++VKDENGR LDDEEIID+L+MYLNAGHESSGH+TMWAT+ +Q HP   ++A
Sbjct  266  RKDMLDNLIDVKDENGRVLDDEEIIDLLLMYLNAGHESSGHLTMWATILMQEHPMILQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P QK LTL+E R+M YLS+VIDETLR++TFSLT FREAK DV + GY 
Sbjct  326  KEEQERIVKKRAPGQK-LTLKETREMVYLSQVIDETLRVITFSLTAFREAKSDVQMDGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW+ +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  385  IPKGWKVLTWFRNVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPH RPKDNCL 
Sbjct  445  EISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNCLA  482



>gb|AAO23063.1| ent-kaurenoic acid oxidase [Pisum sativum]
Length=488

 Score =   335 bits (860),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 185/219 (84%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++V+D+NGR+L+DE+IID+++MYLNAGHESSGHITMWAT FLQ HPE  K+
Sbjct  266  KAKDMMDSLIDVEDDNGRKLNDEDIIDIMLMYLNAGHESSGHITMWATYFLQKHPEYLKK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  P  QKGLTL+EIR M++L KVIDET+R++TFSL VFREAK DV ++GY
Sbjct  326  AKEEQEEIIKRRPSTQKGLTLKEIRGMDFLYKVIDETMRVITFSLVVFREAKSDVTINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVL WFR VHLD EIY +P  FNP+RW N   +AG FLPFGAG+RLCPGNDLAK
Sbjct  386  TIPKGWKVLTWFRSVHLDPEIYPNPKEFNPNRW-NKEHKAGEFLPFGAGTRLCPGNDLAK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EI++FLH+F L Y LE+ NP CP+ YLPHTRP DNCLG
Sbjct  445  MEIAVFLHHFTLNYRLEQLNPKCPIRYLPHTRPMDNCLG  483



>emb|CBV36748.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=489

 Score =   335 bits (860),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L+E +D+NGR LD+EEIID L+ YLNAGHESSGHITMWA++FLQ+HPE FK A
Sbjct  265  RKDMLDLLLECEDDNGRRLDNEEIIDTLIAYLNAGHESSGHITMWASIFLQAHPEVFKTA  324

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+NMP  Q GLTL E RQMEYLSKVIDETLR+V+F+   FREAKKDV   GY 
Sbjct  325  KEEQERIVKNMPAGQNGLTLNEYRQMEYLSKVIDETLRVVSFAFMTFREAKKDVEFKGYV  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWK+L+W+R +H + E Y  P  FNPSRWD++ P+ G FLPFG GSRLCPGNDLAKL
Sbjct  385  IPKGWKILLWYRSLHHNPENYPQPKEFNPSRWDSYVPKPGTFLPFGGGSRLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y+LER+NP CP+ YLPH RPKDN LG
Sbjct  445  EISIFLHHFLLKYKLERENPGCPVRYLPHPRPKDNRLG  482



>ref|XP_008660301.1| PREDICTED: cytochrome P450 88A1-like [Zea mays]
 gb|AFW88847.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=484

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL++ +DE+GR LDDEEIID+LVMYLNAGHESSGHI MWATV+LQ HPE F +AKA
Sbjct  264  DMMDRLIDAEDEHGRRLDDEEIIDILVMYLNAGHESSGHICMWATVYLQKHPEIFAKAKA  323

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  Q GL+LR+ R+MEYLS+VIDETLRLV  S   FREA KDV V+GY IP
Sbjct  324  EQEEIMRSIPSSQMGLSLRDFRRMEYLSQVIDETLRLVNISYVSFREATKDVFVNGYLIP  383

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GW V +W+R VH+D E+Y D   FNPSRW+ +TPRAG FLPFG G+R CPGNDLAKLEI
Sbjct  384  KGWNVQLWYRSVHMDPEVYRDSKEFNPSRWEGYTPRAGTFLPFGLGTRFCPGNDLAKLEI  443

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP+C + YLPH RP DNCL 
Sbjct  444  SVFLHHFLLGYKLTRTNPNCRIRYLPHPRPVDNCLA  479



>gb|ACE76904.1| ent-kaurenoic acid oxidase [Leersia tisserantii]
Length=401

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+   RAKA
Sbjct  185  DMMDRLIEAEDERGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDILARAKA  244

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++PP QKGLTLR+ ++M +L +V+DETLR V  S   FR+A KDV V+GY IP
Sbjct  245  EQEEIMRSIPPTQKGLTLRDFKKMHFLQQVVDETLRCVNISFVSFRQATKDVYVNGYLIP  304

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP TFNPSRW+   PRAG FLPFG GSRLCPGNDLAKLEI
Sbjct  305  KGWKVQLWYRSVHMDDQVYPDPKTFNPSRWEGPPPRAGTFLPFGLGSRLCPGNDLAKLEI  364

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  365  SVFLHHFLLGYKLTRTNPKCRVRYLPHPRPVDNCLA  400



>ref|XP_008659025.1| PREDICTED: cytochrome P450 88A1 isoform X1 [Zea mays]
Length=425

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  203  DMMDRLIEAQDERGRHLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  262

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  263  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  322

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL FG G+RLCPGNDLAKLEI
Sbjct  323  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFLAFGLGARLCPGNDLAKLEI  382

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  383  SVFLHHFLLGYKLARTNPRCRVRYLPHPRPVDNCLA  418



>emb|CDY12205.1| BnaC04g12350D [Brassica napus]
Length=490

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 180/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+DM+D L++ KDENGR L+DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  ++A
Sbjct  267  KKDMLDNLIDAKDENGRTLEDEEIIDVLLMYLNAGHESSGHTIMWATIFLQEHPEILQKA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P Q  LTL+E R+MEYLS+VIDETLR++TFSLT FREAK DV ++GY 
Sbjct  327  KEEQERIVKKRVPGQ-SLTLKETREMEYLSQVIDETLRVITFSLTAFREAKSDVQMNGYI  385

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW+ + P+AG FLPFG GS LCPGNDLAKL
Sbjct  386  IPKGWKVLTWFRDVHLDPEIYPDPKKFDPSRWEGYIPKAGTFLPFGLGSHLCPGNDLAKL  445

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y ++R NP C +M+LPHTRPKDNCL 
Sbjct  446  EISIFLHHFLLKYRVDRSNPGCQVMFLPHTRPKDNCLA  483



>gb|AAK11565.1|AF318501_1 ent-kaurenoic acid hydroxylase [Arabidopsis thaliana]
Length=489

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++DM+D L++VKDENGR LDDE+IID+L+MYLNAGHESSGH+TMWAT+ +Q HP   ++A
Sbjct  266  RKDMLDNLIDVKDENGRVLDDEKIIDLLLMYLNAGHESSGHLTMWATILMQEHPMILQKA  325

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE IV+   P QK LTL+E R+M YLS+VIDETLR++TFSLT FREAK DV + GY 
Sbjct  326  KEEQERIVKKRAPGQK-LTLKETREMVYLSQVIDETLRVITFSLTAFREAKSDVQMDGYI  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL WFR VHLD EIY DP  F+PSRW+ +TP+AG FLPFG GS LCPGNDLAKL
Sbjct  385  IPKGWKVLTWFRNVHLDPEIYPDPKKFDPSRWEGYTPKAGTFLPFGLGSHLCPGNDLAKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH+FLL Y +ER NP CP+M+LPH RPKDNCL 
Sbjct  445  EISIFLHHFLLKYRVERSNPGCPVMFLPHNRPKDNCLA  482



>ref|XP_003561220.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Brachypodium 
distachyon]
Length=501

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 181/216 (84%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+EV+DE GR L+DEEIIDVLVMYLNAGHESS HITMWATVFLQ +P+   +AKA
Sbjct  275  DMMDRLIEVEDEQGRRLEDEEIIDVLVMYLNAGHESSAHITMWATVFLQENPDILAKAKA  334

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV V+GY +P
Sbjct  335  EQEEIMRSIPPTQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLVP  394

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  FNPSRW+   PRAG FLPFG GSRLCPGNDLAKLEI
Sbjct  395  KGWKVQLWYRSVHMDPQVYPDPKKFNPSRWEGPPPRAGTFLPFGLGSRLCPGNDLAKLEI  454

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FL+GY LER+NP+C + YLPH RP DNCL 
Sbjct  455  SVFLHHFLVGYRLERENPNCRVRYLPHPRPVDNCLA  490



>gb|ACE76902.1| ent-kaurenoic acid oxidase [Oryza brachyantha]
Length=401

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  185  DMMDRLIEAQDERGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  244

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  QKGLTLR+ ++M++LS+VIDETLR V  S   FR+A +DV V+GY IP
Sbjct  245  EQEEIMRSIPATQKGLTLRDFKKMQFLSQVIDETLRCVNISFVSFRQATRDVYVNGYLIP  304

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  305  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPRAGTFLPFGLGARLCPGNDLAKLEI  364

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  365  SVFLHHFLLGYKLTRTNPKCRVRYLPHPRPVDNCLA  400



>gb|EMS55313.1| Ent-kaurenoic acid oxidase 1 [Triticum urartu]
Length=465

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +PE   +AKA
Sbjct  241  DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPEILAKAKA  300

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV+V+GY IP
Sbjct  301  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVSVNGYLIP  360

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  361  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  420

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  421  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  456



>gb|ACE76903.1| ent-kaurenoic acid oxidase [Oryza granulata]
Length=401

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +D+ GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  185  DMMDRLIEAEDDRGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  244

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++PP QKGL LR+ ++M++LS+VIDETLR V  S   FR A +DV V+GY IP
Sbjct  245  EQEEIMRSIPPTQKGLNLRDFKKMQFLSQVIDETLRCVNISFVSFRRATRDVYVNGYLIP  304

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  305  KGWKVQLWYRSVHMDDQVYPDPKVFNPSRWEGPPPRAGTFLPFGLGARLCPGNDLAKLEI  364

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  365  SVFLHHFLLGYKLTRTNPKCRVRYLPHPRPVDNCLA  400



>ref|XP_002436354.1| hypothetical protein SORBIDRAFT_10g000920 [Sorghum bicolor]
 gb|EER87721.1| hypothetical protein SORBIDRAFT_10g000920 [Sorghum bicolor]
Length=505

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F +AKA
Sbjct  281  DMMDRLIEAEDERGRRLDDDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFAKAKA  340

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A KDV V+GY IP
Sbjct  341  EQEAIMRSIPASQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATKDVFVNGYLIP  400

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  FNPSRW+  +PRAG FL FG G+RLCPGNDLAKLEI
Sbjct  401  KGWKVQLWYRSVHMDPQVYPDPTKFNPSRWEGHSPRAGTFLAFGLGARLCPGNDLAKLEI  460

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY L R NP C + YLPH RP DNCL 
Sbjct  461  SVFLHHFLLGYRLARTNPRCRVRYLPHPRPVDNCLA  496



>ref|XP_006655700.1| PREDICTED: cytochrome P450 88A1-like [Oryza brachyantha]
Length=447

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  223  DMMDRLIEAQDERGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  282

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  QKGLTLR+ ++M++LS+VIDETLR V  S   FR+A +DV V+GY IP
Sbjct  283  EQEEIMRSIPATQKGLTLRDFKKMQFLSQVIDETLRCVNISFVSFRQATRDVYVNGYLIP  342

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  343  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPRAGTFLPFGLGARLCPGNDLAKLEI  402

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  403  SVFLHHFLLGYKLTRTNPKCRVRYLPHPRPVDNCLA  438



>ref|NP_001105586.1| cytochrome P450 88A1 [Zea mays]
 sp|Q43246.1|C88A1_MAIZE RecName: Full=Cytochrome P450 88A1; AltName: Full=Dwarf3 protein 
[Zea mays]
 gb|AAC49067.1| DWARF3 [Zea mays]
 gb|ACF86671.1| unknown [Zea mays]
 gb|AFW86170.1| dwarf plant3 [Zea mays]
Length=519

 Score =   332 bits (851),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  297  DMMDRLIEAQDERGRHLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  356

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  357  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  416

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL FG G+RLCPGNDLAKLEI
Sbjct  417  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFLAFGLGARLCPGNDLAKLEI  476

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  477  SVFLHHFLLGYKLARTNPRCRVRYLPHPRPVDNCLA  512



>ref|XP_003533093.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Glycine max]
 gb|KHN44669.1| Ent-kaurenoic acid oxidase 1 [Glycine soja]
Length=496

 Score =   331 bits (848),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 186/219 (85%), Gaps = 2/219 (1%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++++D+  R+L DE+IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++
Sbjct  270  KAKDMMDALIDLEDDE-RKLSDEDIIDIMLMYLNAGHESSGHITMWATFFLQKHPEYLQK  328

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI+R  P  QKGLTL+E+R+M++L KVIDETLR++TFSL VFREAK DVN++GY
Sbjct  329  AKAEQEEIIRRRPSTQKGLTLKEVREMDFLYKVIDETLRVITFSLVVFREAKTDVNINGY  388

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            T+P+GWKVLVWFR VHLD EI+ DP  FNP+RW N   +AG FLPFG GSRLCPGNDLAK
Sbjct  389  TVPKGWKVLVWFRSVHLDPEIFPDPKEFNPNRW-NKEHKAGEFLPFGGGSRLCPGNDLAK  447

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EI++FLH+FLL Y  E+ NP+CP+ YLPHTRP DNCLG
Sbjct  448  MEIAVFLHHFLLNYRFEQHNPNCPVRYLPHTRPMDNCLG  486



>gb|ACE76899.1| ent-kaurenoic acid oxidase [Oryza punctata]
Length=393

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +D+ GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  177  DMMDRLIEAEDDRGRHLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  236

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  QKGLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  237  EQEEIMRSIPATQKGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIYVNGYLIP  296

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG GSRLCPGNDLAKLEI
Sbjct  297  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGSRLCPGNDLAKLEI  356

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  357  SVFLHHFLLGYKLTRTNPKCRVRYLPHPRPVDNCLA  392



>gb|ADZ55288.1| ent-kaurene acid oxidase [Triticum aestivum]
Length=491

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DM+DRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +PE   +AKA
Sbjct  267  DMIDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPEILAKAKA  326

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV+V+GY IP
Sbjct  327  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVSVNGYLIP  386

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  387  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  446

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  447  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  482



>emb|CBY78887.1| KAO protein [Aegilops speltoides]
Length=492

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+ V+DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ + +   RAKA
Sbjct  268  DMMDRLIAVEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENTDILARAKA  327

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV+V+GY IP
Sbjct  328  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVSVNGYRIP  387

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  388  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  447

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  448  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  483



>gb|ADZ55287.1| ent-kaurene acid oxidase [Triticum aestivum]
Length=492

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +PE   RAKA
Sbjct  268  DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPEILARAKA  327

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV+V+GY IP
Sbjct  328  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVSVNGYLIP  387

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y  P  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  388  KGWKVQLWYRSVHMDPQVYPHPNKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  447

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  448  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  483



>gb|ACU44686.1| ent-kaurenoic acid oxidase, partial [Triticum aestivum]
Length=256

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +PE   +AKA
Sbjct  48   DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPEILAKAKA  107

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV+V+GY IP
Sbjct  108  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVSVNGYLIP  167

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  168  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  227

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTR  177
            S+FLH+FLLGYEL RKNP+C + YLPH R
Sbjct  228  SVFLHHFLLGYELTRKNPNCRVRYLPHPR  256



>gb|ACE76900.1| ent-kaurenoic acid oxidase [Oryza officinalis]
Length=388

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL++ +DE GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  172  DMMDRLIDAEDERGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  231

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  QKGLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  232  EQEEIMRSIPATQKGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIYVNGYLIP  291

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  292  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  351

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  352  SVFLHHFLLGYKLTRTNPKCRVRYLPHPRPVDNCLA  387



>gb|ACV91868.1| KAO1 [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+ V+DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +PE   +AKA
Sbjct  274  DMMDRLIAVEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPEILAKAKA  333

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+M YLS+V+DETLR V  S   FR+A +DV V+GY IP
Sbjct  334  EQEAIMRSIPPGQKGLTLRDFRKMAYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLIP  393

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  394  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  453

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  454  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  489



>sp|Q9AXH9.1|KAO1_HORVU RecName: Full=Ent-kaurenoic acid oxidase 1; AltName: Full=gpr5 
[Hordeum vulgare]
 gb|AAK11616.1|AF326277_1 ent-kaurenoic acid oxidase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+ V+DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +PE   +AKA
Sbjct  274  DMMDRLIAVEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPEILAKAKA  333

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+M YLS+V+DETLR V  S   FR+A +DV V+GY IP
Sbjct  334  EQEAIMRSIPPGQKGLTLRDFRKMAYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLIP  393

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  394  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  453

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  454  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  489



>gb|ACE76901.1| ent-kaurenoic acid oxidase [Oryza australiensis]
Length=401

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F  AKA
Sbjct  185  DMMDRLIEAEDERGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFATAKA  244

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  QKGLTLR+ ++M +LS+VIDETLR V  S   FR+A +D+ V+GY IP
Sbjct  245  EQEEIMRSIPATQKGLTLRDFKKMRFLSQVIDETLRCVNISFVSFRQATRDIYVNGYLIP  304

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  305  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  364

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R NP C + YLPH RP DNCL 
Sbjct  365  SVFLHHFLLGYKLTRTNPKCRVRYLPHPRPVDNCLA  400



>gb|ACE76898.1| ent-kaurenoic acid oxidase [Oryza rufipogon]
Length=401

 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EI+DVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  185  DMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  244

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  Q GLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  245  EQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIFVNGYLIP  304

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  305  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  364

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L+R NP C + YLPH RP DNCL 
Sbjct  365  SVFLHHFLLGYKLKRANPKCRVRYLPHPRPVDNCLA  400



>gb|ADK62526.1| ent-kaurenoic acid oxidase [Triticum aestivum]
Length=491

 Score =   328 bits (841),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+   +AKA
Sbjct  267  DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDILAKAKA  326

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV V+GY IP
Sbjct  327  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLIP  386

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  387  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  446

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  447  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  482



>gb|ACU44682.1| ent-kaurenoic acid oxidase, partial [Triticum aestivum]
Length=256

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+   +AKA
Sbjct  48   DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDILAKAKA  107

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV V+GY IP
Sbjct  108  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLIP  167

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  168  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  227

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTR  177
            S+FLH+FLLGY+L RKNP+C + YLPH R
Sbjct  228  SVFLHHFLLGYKLTRKNPNCRVRYLPHPR  256



>gb|ACU44680.1| ent-kaurenoic acid oxidase, partial [Triticum aestivum]
Length=256

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+   +AKA
Sbjct  48   DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDILAKAKA  107

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+MEYLS+V+DETLR +  S   FR+A +DV V+GY IP
Sbjct  108  EQEAIMRSIPPGQKGLTLRDFRKMEYLSQVVDETLRFINISFVSFRQATRDVFVNGYLIP  167

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  168  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  227

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTR  177
            S+FLH+FLLGY+L RKNP+C + YLPH R
Sbjct  228  SVFLHHFLLGYKLTRKNPNCRVRYLPHPR  256



>gb|EEC73049.1| hypothetical protein OsI_07000 [Oryza sativa Indica Group]
Length=499

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EI+DVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  275  DMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  334

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  Q GLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  335  EQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIFVNGYLIP  394

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  395  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  454

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L+R NP C + YLPH RP DNCL 
Sbjct  455  SVFLHHFLLGYKLKRANPKCRVRYLPHPRPVDNCLA  490



>ref|NP_001056579.1| Os06g0110000 [Oryza sativa Japonica Group]
 dbj|BAD67695.1| putative cytochrome P450 DWARF3 [Oryza sativa Japonica Group]
 dbj|BAD67898.1| putative cytochrome P450 DWARF3 [Oryza sativa Japonica Group]
 dbj|BAF18493.1| Os06g0110000 [Oryza sativa Japonica Group]
Length=506

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EI+DVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  282  DMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  341

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  Q GLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  342  EQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIFVNGYLIP  401

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  402  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  461

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L+R NP C + YLPH RP DNCL 
Sbjct  462  SVFLHHFLLGYKLKRANPKCRVRYLPHPRPVDNCLA  497



>emb|CBY78885.1| KAO protein [Triticum urartu]
Length=491

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHES GHITMWATVFLQ +PE   +AKA
Sbjct  267  DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESPGHITMWATVFLQENPEILAKAKA  326

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  QKGLTLR+ R+MEYLS+V+DETLR V  S   FR+A +DV+V+GY IP
Sbjct  327  EQEAIMRSIPQGQKGLTLRDFRKMEYLSRVVDETLRFVNISFVSFRQATRDVSVNGYLIP  386

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+  VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  387  KGWKVQLWYGSVHMDPQVYPDPKEFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  446

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  447  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  482



>ref|XP_010104358.1| Ent-kaurenoic acid oxidase 2 [Morus notabilis]
 gb|EXB99778.1| Ent-kaurenoic acid oxidase 2 [Morus notabilis]
Length=498

 Score =   323 bits (828),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 182/220 (83%), Gaps = 0/220 (0%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
             EK+DMMD L++V+D++GR+LDDEEI DV++MYLNAGHES+ H T+WA +FL  HPE  +
Sbjct  271  QEKKDMMDLLLDVEDDDGRKLDDEEIADVILMYLNAGHESTAHATLWAILFLYEHPEYLQ  330

Query  635  RAKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            +AKAEQEEI+R   P ++GL+ +EI+QMEYLSKVIDETLR+V  SL   REAK DVN+ G
Sbjct  331  KAKAEQEEILRRRSPTEEGLSFKEIKQMEYLSKVIDETLRVVNVSLFTCREAKTDVNICG  390

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            YTIPEGWKVL+WFRGVHLD E Y++P  FNPSRW+   PR GAF+PFGAGSRLCPG+DL 
Sbjct  391  YTIPEGWKVLIWFRGVHLDSEHYQNPKEFNPSRWNEIKPRKGAFIPFGAGSRLCPGSDLT  450

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLE+S FLHYFLL YELER NP C + YLPHTRPKDNCL 
Sbjct  451  KLELSTFLHYFLLYYELERLNPGCAVGYLPHTRPKDNCLA  490



>ref|XP_003581683.2| PREDICTED: ent-kaurenoic acid oxidase 1-like [Brachypodium distachyon]
Length=495

 Score =   323 bits (827),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+EV+DE GR L+DE+IID+LV YLNAGHESS HITMWAT+FLQ +P+   RAKA
Sbjct  257  DMMDRLIEVEDEQGRRLEDEDIIDLLVTYLNAGHESSAHITMWATMFLQDNPDILARAKA  316

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE+I RN+PP QKGLTL++ R+M+YLS+V+DETLR V  S   FR+A +DV V+GY +P
Sbjct  317  EQEDITRNIPPTQKGLTLKDFRKMDYLSQVVDETLRFVNISFVSFRQATRDVFVNGYLVP  376

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWK+ +W+R VH+D ++Y DP  FNPSRW+   PRAG FLPFG GSR+C GNDLAKLEI
Sbjct  377  KGWKLQLWYRSVHMDPQVYPDPKKFNPSRWEGPPPRAGTFLPFGLGSRICAGNDLAKLEI  436

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY LER+NP+C + YLPH RP DNCL 
Sbjct  437  SVFLHHFLLGYRLERENPNCRVRYLPHPRPVDNCLA  472



>emb|CBY78889.1| KAO protein [Aegilops tauschii]
Length=493

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+   DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+   +AKA
Sbjct  269  DMMDRLIAAGDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDILAKAKA  328

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP QKGLTLR+ R+M YLS+V+DETLR V  S   FR+A + V V+GY IP
Sbjct  329  EQEAIMRSIPPGQKGLTLRDFRKMGYLSQVVDETLRFVNISFVSFRQATRGVFVNGYLIP  388

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPG DLAKLEI
Sbjct  389  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGIDLAKLEI  448

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  449  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  484



>gb|AAO23064.1| ent-kaurenoic acid oxidase [Pisum sativum]
Length=490

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 181/221 (82%), Gaps = 5/221 (2%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++  DENGR+L D+EIID+++MYLNAGHESSGHITMWAT FLQ HPE F++
Sbjct  265  KAKDMMDSLIDAVDENGRKLGDDEIIDIMLMYLNAGHESSGHITMWATYFLQRHPEFFRK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQ E+++  PP QKGL L ++R+MEYLSKVIDET+R+VTFSL VFR+A+ DV V+GY
Sbjct  325  AKEEQVEMLKRRPPSQKGLKLEDVRKMEYLSKVIDETMRVVTFSLMVFRQARNDVKVNGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFT--PRAGAFLPFGAGSRLCPGNDL  279
             IP+GW+VL WFR VH D E+Y DP  FNP   +NF+   +AG FLPFGAG+RLCPGNDL
Sbjct  385  LIPKGWRVLTWFRSVHFDSELYPDPREFNP---ENFSVVRKAGEFLPFGAGTRLCPGNDL  441

Query  278  AKLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            AKLEIS+FLH+FLL YELE+ NP  P+ +LPHTRP DNCL 
Sbjct  442  AKLEISVFLHHFLLKYELEQLNPKSPIRFLPHTRPLDNCLA  482



>emb|CBV36749.1| ent-kaurenoic acid oxidase [Helianthus annuus]
 emb|CBV36751.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=481

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            KRDM+D L+E +DENG++LDDEEIID LVMYLNAGHESSGH+TMWAT+FLQSHPE FK A
Sbjct  269  KRDMLDALLETEDENGKKLDDEEIIDTLVMYLNAGHESSGHVTMWATIFLQSHPEYFKIA  328

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE I ++MPP Q GLTL+E RQMEYLSKVIDETLRLVTFSL  FREAKKDV++ GY 
Sbjct  329  KEEQERIAKDMPPGQ-GLTLKEFRQMEYLSKVIDETLRLVTFSLMTFREAKKDVDIKGYL  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GW VLVWFR VH + +IY  P  FNPSRWDN  P+ G FLPFGAG+RLCPGNDLAKL
Sbjct  388  IPKGWNVLVWFRSVHHNPDIYPQPKEFNPSRWDNLVPKPGTFLPFGAGTRLCPGNDLAKL  447

Query  269  EISIFLHYFLLGYELERKN  213
            EI+IFLH+FLL Y+ E  N
Sbjct  448  EIAIFLHHFLLNYKNEYSN  466



>ref|XP_003580920.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Brachypodium distachyon]
Length=493

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 175/216 (81%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+EV+DE GR L+DEEIID+LV+YLNAGHESS HITMWATVF+Q +     +AKA
Sbjct  268  DMMDRLIEVEDEGGRRLEDEEIIDMLVLYLNAGHESSAHITMWATVFMQENSHILSKAKA  327

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI++N+P  QKGLTLR+ ++MEYLS+VIDETLR V  S   FR+A +DV V+GY IP
Sbjct  328  EQEEIMKNIPLTQKGLTLRDYKKMEYLSQVIDETLRFVNISFVTFRQATRDVFVNGYLIP  387

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y +P  FNPSRW+   P+ G FLPFG G +LCPGNDLAKLEI
Sbjct  388  KGWKVQLWYRSVHMDPQLYSEPNKFNPSRWEGPPPKVGTFLPFGLGPKLCPGNDLAKLEI  447

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L R+NP C + YLPH RP DNCL 
Sbjct  448  SVFLHHFLLGYKLTRENPSCRIRYLPHPRPVDNCLA  483



>ref|XP_004980663.1| PREDICTED: cytochrome P450 88A1-like [Setaria italica]
Length=510

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 180/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE+GR LDD+EIID+L+MYLNAGHESSGHITMWATVFLQ +P+ F +AKA
Sbjct  286  DMMDRLIEAEDEHGRRLDDDEIIDILIMYLNAGHESSGHITMWATVFLQENPDIFAKAKA  345

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP Q+GLTLR+ R+MEYLS+VIDETLR V  S   FR+A KDV V+GY IP
Sbjct  346  EQEAIMRSIPPTQQGLTLRDYRKMEYLSQVIDETLRFVNTSFVSFRQATKDVFVNGYLIP  405

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  FNPSRW+  +PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  406  KGWKVQLWYRSVHMDPQVYPDPKKFNPSRWEGHSPRAGTFLPFGLGARLCPGNDLAKLEI  465

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY L R NP C + YLPH RP DNCL 
Sbjct  466  SVFLHHFLLGYRLTRTNPSCRVRYLPHPRPVDNCLA  501



>ref|XP_004973029.1| PREDICTED: cytochrome P450 88A1-like [Setaria italica]
Length=511

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 180/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+EV+DE+GR LDD+EIID+L+MYLNAGHESSGHITMWATVFLQ +P+ F +AKA
Sbjct  287  DMMDRLIEVEDEHGRRLDDDEIIDILIMYLNAGHESSGHITMWATVFLQENPDIFAKAKA  346

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++PP Q+GLTLR+ R+M YLS+VIDETLR V  S   FR+A KDV V+GY IP
Sbjct  347  EQEAIMRSIPPTQQGLTLRDFRKMGYLSQVIDETLRFVNISFVSFRQATKDVFVNGYLIP  406

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  FNPSRW+  +PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  407  KGWKVQLWYRSVHMDPQVYPDPKKFNPSRWEGHSPRAGTFLPFGLGARLCPGNDLAKLEI  466

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY L R NP C + YLPH RP DNCL 
Sbjct  467  SVFLHHFLLGYRLTRTNPSCRVRYLPHPRPVDNCLA  502



>ref|XP_007209946.1| hypothetical protein PRUPE_ppa004753mg [Prunus persica]
 gb|EMJ11145.1| hypothetical protein PRUPE_ppa004753mg [Prunus persica]
Length=493

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 174/220 (79%), Gaps = 0/220 (0%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
             E+ D+MD LMEV+DENG+ LDDEEIID+++MYLNAG+ES+ H T+WAT+FL  HPE ++
Sbjct  264  QERTDLMDLLMEVEDENGKTLDDEEIIDIILMYLNAGYESTAHATLWATLFLNEHPEYYQ  323

Query  635  RAKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            +AKAEQ EI++     ++GL  +  +QMEYLSKVI+ETLR+V  SL  +REA  D NVSG
Sbjct  324  KAKAEQVEILKRESSPEEGLNFKGTKQMEYLSKVINETLRVVNVSLYGYREAATDANVSG  383

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            YTIP+GWKV++W+RGVHL+ E Y DP  FNPSRW+    +AG F+PFG GSRLCPG+DL 
Sbjct  384  YTIPKGWKVMMWYRGVHLNPEYYPDPKEFNPSRWNENKGKAGTFIPFGIGSRLCPGSDLT  443

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLEISIFLHYFLL YELER NP C + YLPH  PKDNCL 
Sbjct  444  KLEISIFLHYFLLHYELERLNPACGVRYLPHASPKDNCLA  483



>ref|XP_008238293.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Prunus mume]
Length=496

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 175/219 (80%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E+ D+MD L+EV+DENG+ LDDEEIID+++MYLNAG+ES+ H T+W+T+FL  HPE +++
Sbjct  268  ERTDLMDLLIEVEDENGKTLDDEEIIDIILMYLNAGYESTAHATLWSTLFLNEHPEYYQK  327

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQ EI++     ++GL  +  +QMEYLSKVIDETLR+V  SL  +REA  D NVSGY
Sbjct  328  AKAEQVEILKRESSPEEGLNFKGTKQMEYLSKVIDETLRMVNVSLYGYREAATDANVSGY  387

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKV++W+RGVHL+ E Y DP  FNPSRW+    +AG F+PFG GSRLCPG+DL K
Sbjct  388  TIPKGWKVMMWYRGVHLNPEYYPDPKEFNPSRWNENKGKAGTFIPFGIGSRLCPGSDLTK  447

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL YELER NP C + YLPHT PKDNCL 
Sbjct  448  LEISIFLHYFLLYYELERLNPACGVRYLPHTSPKDNCLA  486



>gb|ABY49060.1| ent-kaurenoic acid oxidase [Luziola fluitans]
Length=350

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
             + DMMDRL+E +DE GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +P+ F R
Sbjct  151  SRMDMMDRLIEAEDERGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPDIFAR  210

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI+R++PP QKGL+LR+ ++M+YLS+VIDETLR V  S   FR+A +DV V+GY
Sbjct  211  AKAEQEEIMRSIPPTQKGLSLRDFKKMQYLSQVIDETLRFVNISFVSFRQATRDVYVNGY  270

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKV +W+R VH+D ++Y DP  FNPSRW+   PRAG FLPFG G+RLCPGNDLAK
Sbjct  271  LIPKGWKVQLWYRSVHMDPQVYPDPYKFNPSRWEGPPPRAGTFLPFGLGARLCPGNDLAK  330

Query  272  LEISIFLHYFLLGYELERKN  213
            LEIS+FLH+FLLGY+L R N
Sbjct  331  LEISVFLHHFLLGYKLTRTN  350



>gb|ABY49059.1| ent-kaurenoic acid oxidase [Rhynchoryza subulata]
Length=349

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            RDMMDRL+E +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +PE F RAK
Sbjct  152  RDMMDRLIEAEDERGRRLGDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPEIFARAK  211

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
            AEQEEI+RN+P  QKGL LR+ ++M YLS+V+DETLR V  S   FR+A +D  V+GY I
Sbjct  212  AEQEEIMRNIPSTQKGLNLRDFKKMHYLSQVVDETLRCVNISFVSFRQATRDAFVNGYLI  271

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GWKV +W+R VH+D ++Y DP  FNPSRW+   PRAG FLPFG GSRLCPGNDLAKLE
Sbjct  272  PKGWKVQLWYRSVHMDSQVYPDPKKFNPSRWEGPPPRAGTFLPFGLGSRLCPGNDLAKLE  331

Query  266  ISIFLHYFLLGYELERKN  213
            IS+FLH+FLLGY+L R N
Sbjct  332  ISVFLHHFLLGYKLTRTN  349



>ref|XP_007209137.1| hypothetical protein PRUPE_ppa005745mg [Prunus persica]
 gb|EMJ10336.1| hypothetical protein PRUPE_ppa005745mg [Prunus persica]
Length=446

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 171/219 (78%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E+ D+MD LME +DENG+ LD+EEIID+++MYLNAGHESS H T+WA +FL  HPE +K+
Sbjct  218  ERTDLMDLLMEAEDENGKTLDNEEIIDIILMYLNAGHESSAHATLWAILFLHEHPEYYKK  277

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQ EI++     ++GL  +E +QMEYLSKVIDETLR+V  SL  +REA  D NV+GY
Sbjct  278  AKAEQMEILKRASSPEEGLDFKETKQMEYLSKVIDETLRVVNISLYSYREATTDANVAGY  337

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKV++W+R VHL+ E Y DP  FNPSRW+    +AG F+PFG GSRLCPG+DL K
Sbjct  338  TIPKGWKVMMWYRSVHLNPEYYPDPKEFNPSRWNENKGKAGTFIPFGIGSRLCPGSDLTK  397

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI +FLHYFLL YELE  NP C + YLPHT P+DNCL 
Sbjct  398  LEIYVFLHYFLLYYELELVNPGCGVKYLPHTTPRDNCLA  436



>gb|ABY49058.1| ent-kaurenoic acid oxidase [Chikusichloa aquatica]
Length=349

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EIIDVL+MYLNAGHESSGHITMWATVFLQ +PE F RAKA
Sbjct  153  DMMDRLIEAEDERGRRLADDEIIDVLIMYLNAGHESSGHITMWATVFLQENPEIFARAKA  212

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++PP QKGL LR+ ++M+YLS+VIDETLR V  S   FR+A +DV V+GY IP
Sbjct  213  EQEEIMRSIPPTQKGLNLRDFKKMQYLSQVIDETLRCVNISFVSFRQATRDVFVNGYLIP  272

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  FNPSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  273  KGWKVQLWYRSVHMDPQVYPDPNKFNPSRWEGPPPRAGTFLPFGLGARLCPGNDLAKLEI  332

Query  263  SIFLHYFLLGYELERKN  213
            S+FLH+FLLGY+L R N
Sbjct  333  SVFLHHFLLGYKLTRTN  349



>ref|XP_008238332.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Prunus mume]
Length=493

 Score =   307 bits (787),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 171/219 (78%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E+ D+MD LME +DENG+ LD+EEIID+++MYLNAGHESS H T+WA +FL  HPE +++
Sbjct  265  ERTDLMDLLMEAEDENGKTLDNEEIIDIILMYLNAGHESSAHATLWAILFLHEHPEYYQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQ EI++     + GL  +E +QMEYLSKVIDETLR+V  SL  +REA  D NV+GY
Sbjct  325  AKAEQMEILKRASSPEAGLDFKETKQMEYLSKVIDETLRVVNISLYSYREATTDANVAGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKV++W+RGVHL+ E Y DP  FNPSRW+    +AG F+PFG GSRLCPG+DL K
Sbjct  385  TIPKGWKVMMWYRGVHLNPEYYPDPKDFNPSRWNENKGKAGTFIPFGIGSRLCPGSDLTK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI +FLHYFLL YELE  NP C + YLPHT P+DNCL 
Sbjct  445  LEIYVFLHYFLLYYELELVNPGCGVKYLPHTTPRDNCLA  483



>gb|KJB25352.1| hypothetical protein B456_004G187300 [Gossypium raimondii]
Length=402

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 175/218 (80%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+ M+D LME++DENG++L DE+IID+L+M+L AGHESS H+ MWA ++L ++PE  K+A
Sbjct  179  KKGMIDLLMEIEDENGQKLPDEDIIDLLLMFLLAGHESSAHVAMWAILYLHNNPEILKKA  238

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++N    +KGLTL++IR+M YL KVIDETLR  + S   FREAK DVN++GY 
Sbjct  239  KEEQEEILKNRQSTEKGLTLKDIREMYYLQKVIDETLRRASVSFCNFREAKVDVNINGYL  298

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RGVH+D ++Y +P  F P RW+N  PRAG+FLPFGAGSR+CPG DLAKL
Sbjct  299  IPKGWKVLVWNRGVHMDPQVYSNPKEFLPQRWENHQPRAGSFLPFGAGSRICPGADLAKL  358

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y+LE+ NP  P++YLP  RP DNCL 
Sbjct  359  EISIFLHYFLLNYKLEQINPGGPIVYLPLPRPVDNCLA  396



>ref|XP_003516638.1| PREDICTED: beta-amyrin 11-oxidase-like [Glycine max]
 gb|KHN42618.1| Ent-kaurenoic acid oxidase 2 [Glycine soja]
Length=493

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 171/216 (79%), Gaps = 0/216 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K DMMD LMEVKDE+GR+L+DE+IID+L+++L AG+ESS H  +W  ++L  HP  F+RA
Sbjct  270  KLDMMDLLMEVKDEDGRQLEDEDIIDLLLVFLLAGYESSAHGILWTIIYLTEHPLVFQRA  329

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+   P  QKGL L+EI+QMEYLSKVIDE LR  + S   FR+AK D+N++GYT
Sbjct  330  KKEQEEIMETRPLSQKGLNLKEIKQMEYLSKVIDEMLRRTSISFANFRQAKVDLNINGYT  389

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RGVH+D E Y +P  ++PSRW+N T RAG+FLPFG GSR CPG+DLAKL
Sbjct  390  IPKGWKVLVWNRGVHMDPETYRNPKEYDPSRWENHTARAGSFLPFGLGSRFCPGSDLAKL  449

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNC  162
            EI+IFLH+FLL Y +ER NPDCP  YLP  RP DNC
Sbjct  450  EITIFLHHFLLNYRMERINPDCPATYLPVPRPSDNC  485



>gb|ABY49057.1| ent-kaurenoic acid oxidase [Leersia perrieri]
Length=350

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE+GR L D+EIID+L+MYLNAGHESSGHITMWATVFLQ +P    RAKA
Sbjct  154  DMMDRLIEAEDESGRRLADDEIIDILIMYLNAGHESSGHITMWATVFLQENPNILARAKA  213

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++PP QKGLTLR+ ++M++L +V+DETLR V  S   FR+A +DV V+GY IP
Sbjct  214  EQEEIMRSIPPTQKGLTLRDFKKMQFLHQVVDETLRCVNISFVSFRQATRDVYVNGYLIP  273

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP TF+PSRW+   PRAG FLPFG GSRLCPGNDLAKLEI
Sbjct  274  KGWKVQLWYRSVHMDDQVYPDPKTFDPSRWEGPPPRAGTFLPFGLGSRLCPGNDLAKLEI  333

Query  263  SIFLHYFLLGYELERKN  213
            S+FLH+FLLGY+L R N
Sbjct  334  SVFLHHFLLGYKLTRTN  350



>ref|XP_008356451.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Malus domestica]
Length=493

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E+ D+ D LME +DENG +LDDEEIID+++MYLNAGHES+ H T+WAT+FL  +PE +++
Sbjct  266  ERTDLTDMLMETEDENGNKLDDEEIIDIVLMYLNAGHESTAHATLWATLFLHENPEYYQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQ EI++   P++ GL  +  +QMEYLSKVIDETLR+V  SL  +REA  DV VSGY
Sbjct  326  AKAEQLEILKTASPEE-GLNFKGTKQMEYLSKVIDETLRIVNVSLYSYREAATDVKVSGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP GWKV++W+RGVHL+ E Y DP  FNPSRW+    +A +F+PFG GSRLCPG+DL K
Sbjct  385  TIPRGWKVMMWYRGVHLNPEYYPDPKKFNPSRWNGSNAKARSFIPFGIGSRLCPGSDLTK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLHYFLL YELER NP   + YLPH RPKDNCL 
Sbjct  445  LEITIFLHYFLLNYELERLNPAIGVSYLPHPRPKDNCLA  483



>ref|XP_004301697.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Fragaria vesca 
subsp. vesca]
Length=495

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 181/219 (83%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EKRD++D L+E +DE GR+L DEEIID+++MYLNAGHESS H TMWAT+FL  +PE +++
Sbjct  266  EKRDLLDLLLEAEDETGRKLYDEEIIDIILMYLNAGHESSAHATMWATLFLHQNPEFYQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQEEI++++ P+  GL+ +E +QMEYLSKVIDET+R+V  SL  +REA  DVN+SGY
Sbjct  326  AKAEQEEILKSLSPEN-GLSFKETKQMEYLSKVIDETMRVVNISLYTYREATADVNISGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKV++WFRG+HL+ EIY+DP  FNPSRW+    +AG ++PFG GSR CPG+DL K
Sbjct  385  TIPKGWKVMMWFRGIHLNPEIYQDPKEFNPSRWNESKVKAGTYIPFGIGSRQCPGSDLTK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+ FLHYFLL YELER NP C L YLPHTRP+DNCL 
Sbjct  445  LEITTFLHYFLLNYELERLNPGCELRYLPHTRPEDNCLA  483



>ref|XP_009373442.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=493

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E+ D+ D L+E +DENG +LDDEEIID+++MYLNAGHES+ H T+WAT+FL  HPE +++
Sbjct  266  ERTDLTDMLIETEDENGNKLDDEEIIDIILMYLNAGHESTAHATLWATLFLHEHPEYYQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQ EI++   P++ G   R  +QMEYLSKVIDETLR+V  SL  +REA  +V +SGY
Sbjct  326  AKAEQLEILKTASPEE-GFNFRGTKQMEYLSKVIDETLRIVNVSLYSYREAATEVKISGY  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP GWKV++W+RGVHL+ E Y DP  FNPSRW+    +AG+F+PFG GSRLCPG DL K
Sbjct  385  TIPRGWKVMMWYRGVHLNPEYYPDPKEFNPSRWNESNAKAGSFIPFGMGSRLCPGIDLTK  444

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLHYFLL YELER NP   + YLPH RPKDNCL 
Sbjct  445  LEITIFLHYFLLNYELERLNPAIGVSYLPHPRPKDNCLA  483



>ref|XP_007156654.1| hypothetical protein PHAVU_002G005900g [Phaseolus vulgaris]
 gb|ESW28648.1| hypothetical protein PHAVU_002G005900g [Phaseolus vulgaris]
Length=492

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            KRDMMD L+EV DE+GR+L+DE I+D+L+++L AGHESS H  +W  ++L  H + F+RA
Sbjct  269  KRDMMDSLLEVTDEDGRKLEDENIMDLLLVFLLAGHESSAHGILWTIIYLTQHSQFFQRA  328

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++  P  QKGL L+EI+QMEYLSKVIDE LR  + S   +R+AK D +++G+T
Sbjct  329  KKEQEEIMQARPSTQKGLNLKEIKQMEYLSKVIDEMLRKTSISFANYRQAKVDFSINGFT  388

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RGVH+D EIY +P  F+PSRWDN T RAG+FLPFG GSR CPG+DLAKL
Sbjct  389  IPKGWKVLVWNRGVHMDPEIYNNPKEFDPSRWDNHTGRAGSFLPFGLGSRFCPGSDLAKL  448

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNC  162
            EI+IFLH+FLL Y +ER NPDCP+ YLP  RP DNC
Sbjct  449  EITIFLHHFLLNYRMERINPDCPITYLPLPRPSDNC  484



>ref|XP_009373441.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=502

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E+ D+ D L+E +DENG +LDDEEIID+++MYLNAGHES+ H T+WAT+FL  HPE +++
Sbjct  275  ERTDLTDMLIETEDENGNKLDDEEIIDIILMYLNAGHESTAHATLWATLFLHEHPEYYQK  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQ EI++   P++ G   R  +QMEYLSKVIDETLR+V  SL  +REA  +V +SGY
Sbjct  335  AKAEQLEILKTASPEE-GFNFRGTKQMEYLSKVIDETLRIVNVSLYSYREAATEVKISGY  393

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP GWKV++W+RGVHL+ E Y DP  FNPSRW+    +AG+F+PFG GSRLCPG DL K
Sbjct  394  TIPRGWKVMMWYRGVHLNPEYYPDPKEFNPSRWNESNAKAGSFIPFGMGSRLCPGIDLTK  453

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLHYFLL YELER NP   + YLPH RPKDNCL 
Sbjct  454  LEITIFLHYFLLNYELERLNPAIGVSYLPHPRPKDNCLA  492



>gb|KJB25353.1| hypothetical protein B456_004G187300 [Gossypium raimondii]
Length=451

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 175/218 (80%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+ M+D LME++DENG++L DE+IID+L+M+L AGHESS H+ MWA ++L ++PE  K+A
Sbjct  228  KKGMIDLLMEIEDENGQKLPDEDIIDLLLMFLLAGHESSAHVAMWAILYLHNNPEILKKA  287

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++N    +KGLTL++IR+M YL KVIDETLR  + S   FREAK DVN++GY 
Sbjct  288  KEEQEEILKNRQSTEKGLTLKDIREMYYLQKVIDETLRRASVSFCNFREAKVDVNINGYL  347

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RGVH+D ++Y +P  F P RW+N  PRAG+FLPFGAGSR+CPG DLAKL
Sbjct  348  IPKGWKVLVWNRGVHMDPQVYSNPKEFLPQRWENHQPRAGSFLPFGAGSRICPGADLAKL  407

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y+LE+ NP  P++YLP  RP DNCL 
Sbjct  408  EISIFLHYFLLNYKLEQINPGGPIVYLPLPRPVDNCLA  445



>gb|KJB25350.1| hypothetical protein B456_004G187300 [Gossypium raimondii]
Length=487

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 175/218 (80%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+ M+D LME++DENG++L DE+IID+L+M+L AGHESS H+ MWA ++L ++PE  K+A
Sbjct  264  KKGMIDLLMEIEDENGQKLPDEDIIDLLLMFLLAGHESSAHVAMWAILYLHNNPEILKKA  323

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++N    +KGLTL++IR+M YL KVIDETLR  + S   FREAK DVN++GY 
Sbjct  324  KEEQEEILKNRQSTEKGLTLKDIREMYYLQKVIDETLRRASVSFCNFREAKVDVNINGYL  383

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RGVH+D ++Y +P  F P RW+N  PRAG+FLPFGAGSR+CPG DLAKL
Sbjct  384  IPKGWKVLVWNRGVHMDPQVYSNPKEFLPQRWENHQPRAGSFLPFGAGSRICPGADLAKL  443

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y+LE+ NP  P++YLP  RP DNCL 
Sbjct  444  EISIFLHYFLLNYKLEQINPGGPIVYLPLPRPVDNCLA  481



>gb|KHG22736.1| Cytochrome P450 [Gossypium arboreum]
Length=487

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 174/218 (80%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            KR M+D LME+KDENG++L DE+IID+L+M+L AGHESS H+ MWA ++L ++PE  K+A
Sbjct  264  KRGMIDLLMEIKDENGQKLSDEDIIDLLLMFLLAGHESSAHVAMWAILYLHNNPEILKKA  323

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++N    +KGLTL++IR+M YL KVIDETLR  + S   FREAK DVN++GY 
Sbjct  324  KEEQEEILKNRQITEKGLTLKDIREMYYLQKVIDETLRRASVSFCNFREAKVDVNINGYL  383

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RG+H+D ++Y +P  F P RW+N  PRAG+FLPFGAGSR+CPG DLAKL
Sbjct  384  IPKGWKVLVWNRGIHMDPQVYSNPKEFLPQRWENHQPRAGSFLPFGAGSRICPGADLAKL  443

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y+LE+  P  P++YLP  RP DNCL 
Sbjct  444  EISIFLHYFLLNYDLEQIKPGGPIVYLPLPRPVDNCLA  481



>gb|ABY49055.1| ent-kaurenoic acid oxidase [Oryza meridionalis]
Length=351

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EI+DVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  155  DMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  214

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  Q GLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  215  EQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIYVNGYLIP  274

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  275  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  334

Query  263  SIFLHYFLLGYELERKN  213
            S+FLH+FLLGY+L+R N
Sbjct  335  SVFLHHFLLGYKLKRAN  351



>gb|ABY49053.1| ent-kaurenoic acid oxidase [Oryza glumipatula]
Length=351

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EI+DVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  155  DMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  214

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  Q GLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  215  EQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIYVNGYLIP  274

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  275  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  334

Query  263  SIFLHYFLLGYELERKN  213
            S+FLH+FLLGY+L+R N
Sbjct  335  SVFLHHFLLGYKLKRAN  351



>gb|ABY49048.1| ent-kaurenoic acid oxidase [Oryza sativa Japonica Group]
 gb|ABY49049.1| ent-kaurenoic acid oxidase [Oryza sativa Indica Group]
 gb|ABY49050.1| ent-kaurenoic acid oxidase [Oryza nivara]
 gb|ABY49051.1| ent-kaurenoic acid oxidase [Oryza glaberrima]
 gb|ABY49052.1| ent-kaurenoic acid oxidase [Oryza barthii]
 gb|ABY49054.1| ent-kaurenoic acid oxidase [Oryza longistaminata]
Length=351

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR L D+EI+DVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  155  DMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKA  214

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  Q GLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  215  EQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIFVNGYLIP  274

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  275  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  334

Query  263  SIFLHYFLLGYELERKN  213
            S+FLH+FLLGY+L+R N
Sbjct  335  SVFLHHFLLGYKLKRAN  351



>ref|XP_010677318.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=497

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+DM+D LM  +DENG +L DEEI+D+++M+LNAGHESSGH  MWA V LQ HPE F++
Sbjct  268  EKKDMLDVLMGNEDENGGKLSDEEIVDLIIMFLNAGHESSGHAAMWAVVLLQDHPEVFQK  327

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE IV    P+QKGLTL+E RQMEYLSKVIDETLR+V  S T+FREA KDVN++G+
Sbjct  328  AKEEQENIVNKRGPNQKGLTLKETRQMEYLSKVIDETLRVVNISFTLFREATKDVNINGF  387

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             +P+GW++L W R  H D + Y +   FNP+RWD+   RA  F+PFGAGSR+CPG DLA+
Sbjct  388  IVPKGWRILPWLRSAHRDSDKYLNSKEFNPARWDDPKTRAN-FIPFGAGSRMCPGRDLAR  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LE+  FLHYFLL Y+LER NP CP+ YLP +RP DNCL 
Sbjct  447  LEVYTFLHYFLLDYKLERINPGCPVRYLPISRPIDNCLA  485



>gb|AAT28221.1| putative ent-Kaurenoic acid hydroxylase-like cytochrome P450 
[Ginkgo biloba]
Length=485

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 165/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +D+++ L+ VKDENG  L DEEIID+LVMYLNAGHESS HITMWA +FL SHP  +  AK
Sbjct  262  KDVLNALLHVKDENGSLLTDEEIIDLLVMYLNAGHESSAHITMWAIIFLVSHPRLYAEAK  321

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
            AEQE+IV   P  Q  L + EIR+M YL K+IDE+LR+V  SL VFREA  DV ++GYTI
Sbjct  322  AEQEKIVNKRPDGQTHLIMYEIREMNYLRKIIDESLRMVNISLMVFREAMDDVEINGYTI  381

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GWK  VW R VH+D ++Y +P  F+P RWD   P++G F+PFGAGSRLCPG+DLAK+E
Sbjct  382  PKGWKTQVWLRSVHMDPQVYPNPTKFDPDRWDKLIPKSGMFIPFGAGSRLCPGSDLAKME  441

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            I +F+H+ L  Y++ER NPDCP+ YLPH RP D C G
Sbjct  442  ICVFIHHLLFHYKIERLNPDCPVRYLPHPRPTDYCKG  478



>ref|XP_003611463.1| Cytochrome P450 ent-kaurenoic acid oxidase [Medicago truncatula]
 gb|AES94421.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=491

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -3

Query  782  EVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKAEQEEIVR  603
            EVKDE GR L+DE+IID+L+++L AGHESS H  +W  ++L  HP  F+RAK EQEEI+ 
Sbjct  277  EVKDEEGRMLEDEDIIDLLLVFLLAGHESSAHGILWTIIYLIDHPHVFQRAKKEQEEIME  336

Query  602  NMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIPEGWKVLV  423
              P  QKGL L+EI+QM+YLSKVIDE LR+ T S   FR AK DVN++GYTIP+GWKVLV
Sbjct  337  TRPSTQKGLNLKEIKQMQYLSKVIDEMLRITTISFANFRRAKVDVNINGYTIPKGWKVLV  396

Query  422  WFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEISIFLHYF  243
            W RGVH+D EIY +P  ++PSRW+N+  +AG+F PFG GSRLCPG+DLAKLEI+I+LH+F
Sbjct  397  WNRGVHMDPEIYTNPKEYDPSRWENYKAKAGSFNPFGLGSRLCPGSDLAKLEITIYLHHF  456

Query  242  LLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LL Y +ER NPDCP+ YLP  RPKDNCL 
Sbjct  457  LLNYRMERINPDCPVTYLPVPRPKDNCLA  485



>gb|AHW42467.1| KAO2 [Pinus tabuliformis]
Length=482

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DM+D L++VKDENGR L DEEIID+LVMYLNAGHESS HITMW  +FL  HPE + +AKA
Sbjct  262  DMLDSLLQVKDENGRFLTDEEIIDLLVMYLNAGHESSAHITMWTIIFLLKHPEIYAKAKA  321

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE IV+     Q  +   E+R+M YL KV+DE+LRLV  S  VFREA  DV  +G+TIP
Sbjct  322  EQENIVKRRIDRQTHMRFSELREMHYLRKVLDESLRLVNISPMVFREAVDDVEFNGFTIP  381

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWK  VW R VHLD  +Y DPL FNP RW++F P+AG F+PFG GSR CPGN+LAK+EI
Sbjct  382  KGWKTQVWLRNVHLDPHVYHDPLKFNPERWNSFVPKAGMFIPFGGGSRECPGNELAKMEI  441

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNC  162
            ++FLHY LL YE+ER  PDC L YLPH RP DNC
Sbjct  442  TVFLHYMLLHYEVERLTPDCQLRYLPHPRPIDNC  475



>ref|XP_004512204.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=493

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 169/216 (78%), Gaps = 0/216 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMD LMEVKDE G+ L+DE+IID+L+++L AGHESS H  +W  ++L  HP  F+RAK 
Sbjct  272  DMMDLLMEVKDEEGKILEDEDIIDLLLLFLLAGHESSAHGILWTIIYLMDHPHVFQRAKK  331

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+   P  QKGL LREI+QMEYLSKVIDE LR  + S   FR AK DVN++GYTIP
Sbjct  332  EQEEIMETRPSTQKGLNLREIKQMEYLSKVIDEMLRRTSISFANFRLAKVDVNINGYTIP  391

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKVLVW RGVH+D E Y +P  F+PSRW+N+  RAG+FLPFG GSRLCPG+DLAKLEI
Sbjct  392  KGWKVLVWNRGVHMDPETYFNPKEFDPSRWENYKARAGSFLPFGLGSRLCPGSDLAKLEI  451

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             IFLH+FLL Y +ER NP+CP+ YLP  RP DNCL 
Sbjct  452  IIFLHHFLLNYRMERINPECPVTYLPVPRPTDNCLA  487



>ref|XP_004510262.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=492

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 167/219 (76%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D+MD L+EVKDENGR+L+DE+I D+L+  L AGHES+    MW+ + L  HP   K+
Sbjct  266  EKKDLMDILLEVKDENGRKLEDEDISDLLIGLLFAGHESTATSLMWSVIHLTQHPHILKK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI+R  P  QK L+L E++QM YLS VI+ETLR    + ++FREA  DVN++GY
Sbjct  326  AKEEQEEILRTRPDSQKRLSLNEVKQMTYLSHVINETLRCANIAFSIFREATSDVNLNGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GW+VL+W R +H+ +E Y +P  FNPSRWDN+TP+AG F+PFGAGSRLCPG DL K
Sbjct  386  LIPKGWRVLIWARAIHMSDEYYPNPQEFNPSRWDNYTPKAGTFIPFGAGSRLCPGADLVK  445

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL Y LER NP CP+  LP ++P DNCL 
Sbjct  446  LEISIFLHYFLLNYRLERINPQCPITSLPVSKPTDNCLA  484



>gb|ABY49056.1| ent-kaurenoic acid oxidase [Oryza eichingeri]
Length=351

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL++ +DE GR L D+EIIDVL+MYLNAGHESSGHITM ATVFLQ +P+ F RAKA
Sbjct  155  DMMDRLIDAEDERGRRLADDEIIDVLIMYLNAGHESSGHITMLATVFLQENPDIFARAKA  214

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQEEI+R++P  QKGLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY IP
Sbjct  215  EQEEIMRSIPATQKGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIFVNGYLIP  274

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKLEI
Sbjct  275  KGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKLEI  334

Query  263  SIFLHYFLLGYELERKN  213
            S+FLH+FLLGY+L R N
Sbjct  335  SVFLHHFLLGYKLTRTN  351



>gb|KEH37117.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=455

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 167/195 (86%), Gaps = 1/195 (1%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD L++V+D+NGR+L DE+IID+++MYLNAGHESSGHITMWAT FLQ HPE  ++
Sbjct  262  KAKDMMDSLIDVEDDNGRKLGDEDIIDIMLMYLNAGHESSGHITMWATYFLQKHPEYLQK  321

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QKGLTL+EIR M++L KVIDET+R++TFSL VFREAK DV ++GY
Sbjct  322  AKEEQEEIIKRRPPTQKGLTLKEIRGMDFLYKVIDETMRVITFSLVVFREAKSDVMINGY  381

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKVL WFR VHLD EIY +P  FNP+RW N   +AG FLPFGAG+RLCPGNDLAK
Sbjct  382  TIPKGWKVLTWFRSVHLDPEIYPNPKEFNPNRW-NKEHKAGEFLPFGAGTRLCPGNDLAK  440

Query  272  LEISIFLHYFLLGYE  228
            +EI++FLH+F+L Y+
Sbjct  441  MEIAVFLHHFILNYQ  455



>ref|XP_009797769.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Nicotiana 
sylvestris]
Length=176

 Score =   284 bits (726),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  RAKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            + +AEQE IV+N P DQKG+TL+EIRQM+YLSKVIDETLR+VTFS  VFREAKKD  ++G
Sbjct  6    QKQAEQEAIVKNRPSDQKGVTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAKKDFMING  65

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            YTIP+GWKVLVWFR VHLD E Y+DPL FNPSRWD+FTP+AG FLPFGAGSRLCPGNDLA
Sbjct  66   YTIPKGWKVLVWFRSVHLDPETYDDPLEFNPSRWDDFTPKAGTFLPFGAGSRLCPGNDLA  125

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLEISIFLHYFLL YELER+NP CPLMYLPH RPKDNCLG
Sbjct  126  KLEISIFLHYFLLDYELERENPSCPLMYLPHCRPKDNCLG  165



>ref|XP_006436761.1| hypothetical protein CICLE_v10031341mg [Citrus clementina]
 ref|XP_006485428.1| PREDICTED: beta-amyrin 11-oxidase-like [Citrus sinensis]
 gb|ESR50001.1| hypothetical protein CICLE_v10031341mg [Citrus clementina]
Length=491

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 169/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++ ++D LMEV+DENG +LDD +IID+L+ +L+AGHESS HI  WA + L  HP+  ++A
Sbjct  268  RKGLIDLLMEVEDENGTKLDDLDIIDMLISFLSAGHESSAHIATWALIHLHKHPQTLRKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE+I++  P  QKGLT+ EI+QMEYL+KVIDETLR+   S + FREA+ DVN+ GY 
Sbjct  328  KEEQEDIIKKRPSTQKGLTIEEIKQMEYLAKVIDETLRMTNLSPSSFREAEADVNIQGYF  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLV+ RGVH + E Y +P  F+PSRWDN T R G+F+PFG GSR+CPG DLAKL
Sbjct  388  IPKGWKVLVYNRGVHYNPENYPEPKQFDPSRWDNHTTRPGSFIPFGGGSRICPGADLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIF+HYFLL Y+LE +NP+CP  YLP  RP D CL 
Sbjct  448  EISIFIHYFLLNYKLELQNPECPAEYLPVPRPSDQCLA  485



>ref|XP_010053585.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Eucalyptus grandis]
Length=494

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 171/217 (79%), Gaps = 0/217 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            +++M+D LMEV+DE+ R+L++E+IID+L+MYL AGHE+S H TMWA ++L  HP+  ++A
Sbjct  268  RKNMLDMLMEVEDEDKRKLEEEDIIDILLMYLLAGHETSAHGTMWAALYLHEHPDILQKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+   P  Q GLTL+EIRQ +YL++V+DETLR ++ S  VFREAK DVNV+GY 
Sbjct  328  KEEQEEIISRRPATQSGLTLKEIRQSQYLTRVVDETLRRISLSFAVFREAKADVNVNGYL  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKV+V  R VH+D E Y DP  F+PSRW+N   +AGAFLPFGAGSR CPG+DLAKL
Sbjct  388  IPKGWKVMVSSRAVHMDPENYLDPKKFDPSRWENINAKAGAFLPFGAGSRFCPGSDLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCL  159
            EISIFLH FLL Y+LER NP  P+ +LP   P DNCL
Sbjct  448  EISIFLHQFLLHYKLERVNPKSPVSHLPLPHPSDNCL  484



>gb|KDO44740.1| hypothetical protein CISIN_1g011210mg [Citrus sinensis]
Length=491

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 168/218 (77%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++ ++D LMEV+DENG +LDD +IID+L+ +L+AGHESS HI  WA + L  HP+  ++A
Sbjct  268  RKGLIDLLMEVEDENGTKLDDLDIIDMLISFLSAGHESSAHIATWALIHLHKHPQTLRKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE+I++  P  QKGLT+ EI+QMEYL+KVI ETLR+   S + FREA+ DVN+ GY 
Sbjct  328  KEEQEDIIKKRPSTQKGLTIEEIKQMEYLAKVIAETLRMTNLSPSSFREAEADVNIQGYF  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLV+ RGVH + E Y DP  F+PSRWDN T R G+F+PFG GSR+CPG DLAKL
Sbjct  388  IPKGWKVLVYNRGVHYNPENYPDPKQFDPSRWDNHTTRPGSFIPFGGGSRICPGADLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIF+HYFLL Y+LE +NP+CP  YLP  RP D CL 
Sbjct  448  EISIFIHYFLLNYKLELQNPECPAEYLPVPRPSDQCLA  485



>gb|KJB25351.1| hypothetical protein B456_004G187300 [Gossypium raimondii]
Length=484

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 173/218 (79%), Gaps = 3/218 (1%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+ M+D LME++DENG++L DE+IID+L+M+L AGHESS H+ MWA ++L ++PE  K+A
Sbjct  264  KKGMIDLLMEIEDENGQKLPDEDIIDLLLMFLLAGHESSAHVAMWAILYLHNNPEILKKA  323

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K   EEI++N    +KGLTL++IR+M YL KVIDETLR  + S   FREAK DVN++GY 
Sbjct  324  K---EEILKNRQSTEKGLTLKDIREMYYLQKVIDETLRRASVSFCNFREAKVDVNINGYL  380

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RGVH+D ++Y +P  F P RW+N  PRAG+FLPFGAGSR+CPG DLAKL
Sbjct  381  IPKGWKVLVWNRGVHMDPQVYSNPKEFLPQRWENHQPRAGSFLPFGAGSRICPGADLAKL  440

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLHYFLL Y+LE+ NP  P++YLP  RP DNCL 
Sbjct  441  EISIFLHYFLLNYKLEQINPGGPIVYLPLPRPVDNCLA  478



>ref|XP_010053588.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Eucalyptus 
grandis]
Length=477

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 170/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            +++M+D LMEV+DE+ R+L++E+IID+L+MYL AGHE+S H TMWA ++L  HP+  ++ 
Sbjct  254  RKNMLDMLMEVEDEDKRKLEEEDIIDILLMYLLAGHETSAHGTMWAALYLHEHPDILQKT  313

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+   P  Q GLTL+EIRQ +YL++V+DETLR ++ S  VFREAK DVNV+GY 
Sbjct  314  KEEQEEIISRRPATQSGLTLKEIRQSQYLTRVVDETLRRISLSFAVFREAKADVNVNGYL  373

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKV+V  R VH+D E Y DP  F+PSRW+N   +AGAFLPFGAGSR CPG+DLAKL
Sbjct  374  IPKGWKVMVSSRAVHMDPENYLDPKKFDPSRWENIKAKAGAFLPFGAGSRFCPGSDLAKL  433

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH FLL Y+LER NP  P+ +LP   P DNCL 
Sbjct  434  EISIFLHQFLLHYKLERVNPKSPVSHLPLPHPSDNCLA  471



>ref|XP_010053587.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Eucalyptus 
grandis]
Length=491

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 170/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            +++M+D LMEV+DE+ R+L++E+IID+L+MYL AGHE+S H TMWA ++L  HP+  ++ 
Sbjct  268  RKNMLDMLMEVEDEDKRKLEEEDIIDILLMYLLAGHETSAHGTMWAALYLHEHPDILQKT  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+   P  Q GLTL+EIRQ +YL++V+DETLR ++ S  VFREAK DVNV+GY 
Sbjct  328  KEEQEEIISRRPATQSGLTLKEIRQSQYLTRVVDETLRRISLSFAVFREAKADVNVNGYL  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKV+V  R VH+D E Y DP  F+PSRW+N   +AGAFLPFGAGSR CPG+DLAKL
Sbjct  388  IPKGWKVMVSSRAVHMDPENYLDPKKFDPSRWENIKAKAGAFLPFGAGSRFCPGSDLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EISIFLH FLL Y+LER NP  P+ +LP   P DNCL 
Sbjct  448  EISIFLHQFLLHYKLERVNPKSPVSHLPLPHPSDNCLA  485



>ref|XP_010053586.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Eucalyptus grandis]
Length=494

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 171/217 (79%), Gaps = 0/217 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            +++M+D LMEV+DE+ R+L++E+IID+L+MYL AGHE+S H TMWA ++L  HP+  ++A
Sbjct  268  RKNMLDMLMEVEDEDKRKLEEEDIIDILLMYLLAGHETSAHGTMWAALYLHEHPDILQKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+R  P  Q GLTL+EIRQ +YL++V+DETLR ++ S  VFREAK DVNV+GY 
Sbjct  328  KEEQEEIIRRRPATQSGLTLKEIRQSQYLTRVVDETLRRISLSFAVFREAKADVNVNGYL  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKV+V  R VH+D E Y +P  F+PSRW+N   +AGAFLPFGAGSR CPG+DLAKL
Sbjct  388  IPKGWKVMVSSRAVHMDPENYLNPKKFDPSRWENIKAKAGAFLPFGAGSRFCPGSDLAKL  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCL  159
            EISIFLH FLL Y+LER NP   + +LP   P DNCL
Sbjct  448  EISIFLHQFLLHYKLERVNPTSSVSHLPLPHPSDNCL  484



>gb|KGN46277.1| hypothetical protein Csa_6G079220 [Cucumis sativus]
Length=462

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 167/218 (77%), Gaps = 22/218 (10%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            KRDM+D L+E +DE+GR L DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HP   ++A
Sbjct  261  KRDMLDALLEAEDEDGRRLSDEEIIDVLIMYLNAGHESSGHTMMWATIFLQQHPHFLQKA  320

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            KAEQEE+++  P  QKGLTL+E+RQM YLSKVIDETLR+VTFSLTVFREAK DV +S Y 
Sbjct  321  KAEQEEMIKKRPVGQKGLTLKEVRQMPYLSKVIDETLRVVTFSLTVFREAKHDVKISAYK  380

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            +                       L+F    +++F P+AG+FLPFGAGSRLCPGNDLAKL
Sbjct  381  LSNSL-------------------LSF---LFNDFIPKAGSFLPFGAGSRLCPGNDLAKL  418

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EIS+FLHYFLL Y+LER NP+ P+ YLPH++P+DNCLG
Sbjct  419  EISVFLHYFLLNYKLERVNPESPIRYLPHSKPEDNCLG  456



>ref|XP_004510263.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=492

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 165/219 (75%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D+MD L+EVKDENGR+L+DE+I D+L+  L AGHES+    MW+  +L  HP   K+
Sbjct  266  EKKDLMDILLEVKDENGRKLEDEDISDLLLGLLFAGHESTATGLMWSVTYLTQHPHILKK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI+R  P   K L+L E++QM YLS VI+E LR    + + FREA  DVN++GY
Sbjct  326  AKEEQEEILRTRPTSLKRLSLNEVKQMVYLSHVINEMLRCANIAFSTFREAICDVNINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVL+W R +H+ +E Y +P  FNPSRWDN+TP+AG FLPFGAGSR CPG DLAK
Sbjct  386  LIPKGWKVLIWARAIHMSDEYYPNPQEFNPSRWDNYTPKAGTFLPFGAGSRRCPGGDLAK  445

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL Y LER NP+CP+  LP ++P DNCL 
Sbjct  446  LEISIFLHYFLLNYRLERINPECPITNLPVSKPIDNCLA  484



>gb|KEH20767.1| cytochrome P450 family 88 protein [Medicago truncatula]
Length=492

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 163/219 (74%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D+MD L+E+KDENGR+L+D++I D+L+  L AGHES+    MW+   L  HP   ++
Sbjct  266  EKKDLMDILLEIKDENGRKLEDQDISDLLIGLLFAGHESTATGIMWSVAHLTQHPHILQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  P  QK L+L E++QM YLS VIDE LR    + ++FREA  DVN++GY
Sbjct  326  AKEEQEEILKIRPASQKRLSLNEVKQMIYLSYVIDEMLRFANIAFSIFREATSDVNINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GW+VL+W R +H+D E Y +P  FNPSRW ++  +AG FLPFGAGSRLCPG DLAK
Sbjct  386  LIPKGWRVLIWARAIHMDSEYYPNPKEFNPSRWKDYNAKAGTFLPFGAGSRLCPGADLAK  445

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL Y LER NPDCP+  LP  +P DNCL 
Sbjct  446  LEISIFLHYFLLNYRLERINPDCPVTTLPQCKPTDNCLA  484



>dbj|BAG68926.1| cytochrome P450 88D3 [Medicago truncatula]
Length=492

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 163/219 (74%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D+MD L+E+KDENGR+L+D++I D+L+  L AGHES+    MW+   L  HP   ++
Sbjct  266  EKKDLMDILLEIKDENGRKLEDQDISDLLIGLLFAGHESTATGIMWSVAHLTQHPHILQK  325

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  P  QK L+L E++QM YLS VIDE LR    + ++FREA  DVN++GY
Sbjct  326  AKEEQEEILKIRPASQKRLSLNEVKQMIYLSYVIDEMLRFANIAFSIFREATSDVNINGY  385

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GW+VL+W R +H+D E Y +P  FNPSRW ++  +AG FLPFGAGSRLCPG DLAK
Sbjct  386  LIPKGWRVLIWARAIHMDSEYYPNPKEFNPSRWKDYNAKAGTFLPFGAGSRLCPGADLAK  445

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFLL Y LER NPDCP+  LP  +P DNCL 
Sbjct  446  LEISIFLHYFLLNYRLERINPDCPVTTLPQCKPTDNCLA  484



>gb|EEE64964.1| hypothetical protein OsJ_19857 [Oryza sativa Japonica Group]
Length=813

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 167/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK-  627
            DMMDRL+E +DE GR L D+EI+DVL+MYLNAGHESSGHITMWATVFLQ +P+ F RAK 
Sbjct  275  DMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDIFARAKV  334

Query  626  -AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
             AEQEEI+R++P  Q GLTLR+ ++M +LS+V+DETLR V  S   FR+A +D+ V+GY 
Sbjct  335  QAEQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRDIFVNGYL  394

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKV +W+R VH+D+++Y DP  FNPSRW+   P+AG FLPFG G+RLCPGNDLAKL
Sbjct  395  IPKGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARLCPGNDLAKL  454

Query  269  EISIFLHYFLLGYELERKNPDC  204
            EIS+FLH+FLLGY+L+R NP C
Sbjct  455  EISVFLHHFLLGYKLKRANPKC  476



>gb|KJB78703.1| hypothetical protein B456_013G013700 [Gossypium raimondii]
Length=368

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 159/219 (73%), Gaps = 30/219 (14%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K DM+D LMEVKDE G  L+DEEIID+++MYLNAGHESS H TMWAT+FLQ HP   ++
Sbjct  167  KKEDMLDALMEVKDEKGETLEDEEIIDIMLMYLNAGHESSAHTTMWATIFLQQHPHFLQK  226

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            A                              KVIDETLRLVTFSLTVFREA  DV+++GY
Sbjct  227  A------------------------------KVIDETLRLVTFSLTVFREALIDVSINGY  256

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWK+LVWFR +HLD +IY +P  FN SRWD++  +A  FLPFGAGSRLCPGNDLAK
Sbjct  257  VIPKGWKILVWFRSIHLDPQIYPNPKEFNLSRWDDYAAKASTFLPFGAGSRLCPGNDLAK  316

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI+IFLH+FLL YEL+R NP+  ++YLPHTRP DNCL 
Sbjct  317  LEIAIFLHHFLLNYELDRVNPESRVLYLPHTRPADNCLA  355



>ref|XP_006436762.1| hypothetical protein CICLE_v10032478mg [Citrus clementina]
 gb|ESR50002.1| hypothetical protein CICLE_v10032478mg [Citrus clementina]
Length=261

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 169/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++ M+D L+E +DENG++L+D  IID+L++ L AGHESS H +MWA ++L  HPE  ++A
Sbjct  38   QKGMIDLLLEAEDENGKKLEDVHIIDLLIINLLAGHESSAHASMWAVLYLNQHPEMLQKA  97

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++  P  QKGLTL EI+QM+YL+KVIDET+R  +  + +FREAK D N+ GYT
Sbjct  98   KQEQEEIIKRRPSTQKGLTLEEIKQMDYLAKVIDETMRRSSLFIPIFREAKVDANIQGYT  157

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            +P+GW+VLVW RGVH+D E+Y +P  F+PSRWDN T + G+++PFG G  +CPG DL KL
Sbjct  158  VPKGWQVLVWTRGVHMDPEVYTNPKEFDPSRWDNHTTKPGSYIPFGGGPWICPGADLTKL  217

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI IFLHYFLL Y+LE +NP+CP+ YLP  RP DNCL 
Sbjct  218  EIYIFLHYFLLNYKLELQNPECPVAYLPVPRPSDNCLA  255



>ref|XP_007039557.1| Ent-kaurenoic acid hydroxylase 2 [Theobroma cacao]
 gb|EOY24058.1| Ent-kaurenoic acid hydroxylase 2 [Theobroma cacao]
Length=516

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 169/220 (77%), Gaps = 4/220 (2%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
            +EKR M+D LM+++DE+G++L DE+IID+L+M+L AGHESS H  MWA ++L  HPE  +
Sbjct  264  NEKRGMVDLLMDIEDEHGQKLQDEDIIDLLLMFLLAGHESSAHAAMWAIIYLHDHPEILQ  323

Query  635  RAKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            +AK EQ++I++  P  QKGLTL++IR+M YL KVIDETLR  + S   FR+        G
Sbjct  324  KAKEEQDQILKKRPSTQKGLTLKDIREMNYLQKVIDETLRRTSLSFANFRQGFS----PG  379

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            Y IP+GWKVLVW RGVH+D E+Y +P  F P+RW+N TP+AG+FLPFGAGSR+CPG DLA
Sbjct  380  YLIPKGWKVLVWNRGVHMDPEVYSNPKEFIPARWENHTPKAGSFLPFGAGSRICPGADLA  439

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLEISIFLHYFLL Y+LE+  P  P++YLP  RP DNCL 
Sbjct  440  KLEISIFLHYFLLNYKLEQIKPGGPMVYLPLPRPVDNCLA  479



>ref|XP_003611462.1| Cytochrome P450 ent-kaurenoic acid oxidase [Medicago truncatula]
 gb|AES94420.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=490

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 168/218 (77%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+D+M+ LME +D+ G +L+DE+IID+L+++L AGHESS +  +W  + L +HP  F+RA
Sbjct  267  KKDLMELLMEARDDEGEKLEDEDIIDLLLLFLLAGHESSAYGVLWTVINLTNHPHVFERA  326

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+   P DQKGLT  EIRQM+YLS+VIDE LR  + S   FR+AK D N++GYT
Sbjct  327  KKEQEEIMARRPSDQKGLTHTEIRQMKYLSQVIDEMLRKTSISFANFRQAKVDFNLNGYT  386

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVLVW RGVH+D E Y +P  F+PSRW+NF  R G FLPFG GSR CPG+DLAKL
Sbjct  387  IPKGWKVLVWNRGVHMDPENYPNPKEFDPSRWENFKARVGQFLPFGYGSRYCPGSDLAKL  446

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI+I+LH+FLL Y +ER NPDCP+ YLP  RP DNCL 
Sbjct  447  EITIYLHHFLLNYRMERINPDCPITYLPIARPTDNCLA  484



>sp|B5BSX1.1|BAMO_GLYUR RecName: Full=Beta-amyrin 11-oxidase; AltName: Full=Cytochrome 
P450 88D6 [Glycyrrhiza uralensis]
 dbj|BAG68929.1| cytochrome P450 88D6 [Glycyrrhiza uralensis]
Length=493

 Score =   284 bits (727),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 163/219 (74%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +++D++D L+EVKDENGR+L+DE+I D+L+  L AGHES+    MW+  +L  HP   K+
Sbjct  267  QRKDLIDILLEVKDENGRKLEDEDISDLLIGLLFAGHESTATSLMWSITYLTQHPHILKK  326

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI R     QK L+L+EI+QM YLS+VIDETLR    +   FREA  DVN++GY
Sbjct  327  AKEEQEEITRTRFSSQKQLSLKEIKQMVYLSQVIDETLRCANIAFATFREATADVNINGY  386

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GW+VL+W R +H+D E Y +P  FNPSRWD++  +AG FLPFGAGSRLCPG DLAK
Sbjct  387  IIPKGWRVLIWARAIHMDSEYYPNPEEFNPSRWDDYNAKAGTFLPFGAGSRLCPGADLAK  446

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEISIFLHYFL  Y LER NP+C +  LP ++P DNCL 
Sbjct  447  LEISIFLHYFLRNYRLERINPECHVTSLPVSKPTDNCLA  485



>ref|XP_010042023.1| PREDICTED: beta-amyrin 11-oxidase-like [Eucalyptus grandis]
Length=505

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 166/218 (76%), Gaps = 3/218 (1%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E++DM+D LMEV+DE+G +LD+E IIDV +M+L AGHE+S H TMWA +FL+ HPE  ++
Sbjct  142  EEKDMLDLLMEVEDEDGEKLDEETIIDVSLMFLLAGHETSAHATMWAAIFLKEHPEILQK  201

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
             K EQEEI+R  PP QKGLTL+EIRQM YLS V+DETLR    S  VFREA  DV++ GY
Sbjct  202  LKKEQEEIIRRRPPTQKGLTLKEIRQMNYLSMVVDETLRRGNLSFAVFREATADVDIDGY  261

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             +P GW+V+V+ R +H+D E Y  P  FNPSRW+    +AG FLPFG GS+LCPG DLAK
Sbjct  262  LVPRGWRVVVYLRAIHVDPENYSKPEEFNPSRWE---AKAGTFLPFGGGSKLCPGMDLAK  318

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCL  159
            LE+SIFLH+F+L Y++ER NP+ P++YLP     D+CL
Sbjct  319  LEMSIFLHHFVLHYDMERLNPNSPMVYLPLASTYDHCL  356



>ref|XP_011652889.1| PREDICTED: beta-amyrin 11-oxidase-like [Cucumis sativus]
Length=491

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
            + K+DM D L+EVKDE+G+ LDD  IID+L+ +  AGHE+S H  M A +FL  +PE  +
Sbjct  263  NRKKDMTDLLLEVKDEDGQGLDDACIIDLLIGFFFAGHETSAHSIMRAIMFLSENPETLQ  322

Query  635  RAKAEQEEIVRNMPPD--QKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNV  462
            +AKAEQE+IV+  P D   KGLT++EI+QMEYL KVIDETLR  + + T+ RE K DVN+
Sbjct  323  KAKAEQEQIVKARPADAQHKGLTMKEIKQMEYLYKVIDETLRKTSLAFTLSRETKVDVNL  382

Query  461  SGYTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGND  282
            +GYTIP+GWK+LVW R VH+D EIYE+P  F+PSRWDN   RAG+F+PFGAG RLCPG D
Sbjct  383  NGYTIPKGWKILVWTRAVHMDPEIYENPQKFDPSRWDNPKRRAGSFIPFGAGMRLCPGID  442

Query  281  LAKLEISIFLHYFLL-GYELERKNPDCPLMYLPHTRPKDNCLG  156
            L+KLEI+IFLHYF+  G+ LER NP+CP  +LP  RP DNCL 
Sbjct  443  LSKLEIAIFLHYFIHGGFRLERVNPNCPENHLPLPRPTDNCLA  485



>emb|CDP12987.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 162/218 (74%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K+D++  +ME++D+ G +L+DE+I+D+++++L AGHESSGH   WA + L  HP+  ++A
Sbjct  269  KKDLLTLMMEIQDDAGNKLNDEQIVDLVIIFLLAGHESSGHAVTWAIILLHEHPQTLQKA  328

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE+IV+       GL  REIRQM+YL KVIDETLR+V  S  +FREAK DV+++GYT
Sbjct  329  KEEQEDIVKRRAFSDTGLNFREIRQMKYLQKVIDETLRVVNLSFALFREAKSDVDINGYT  388

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GW+VL W R VH D + Y+ P  FNPSRW++ T + G  +PFGAGSRLCPG DLAKL
Sbjct  389  IPKGWRVLPWIRNVHFDPQNYKSPKDFNPSRWEDPTIKIGTLVPFGAGSRLCPGADLAKL  448

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EIS+FLHYFLL Y LER NP   + YLP TRP D CL 
Sbjct  449  EISVFLHYFLLNYRLERINPGSRVQYLPITRPADKCLA  486



>gb|ABY49061.1| ent-kaurenoic acid oxidase [Ehrharta erecta]
Length=342

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 154/197 (78%), Gaps = 9/197 (5%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+EV+DE+GR L D+EIID+L MY+NAGHESS HITMWAT FLQ +P+   RAKA
Sbjct  155  DMMDRLIEVEDEHGRRLRDDEIIDILNMYINAGHESSIHITMWATFFLQENPDVLARAKA  214

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
             QEEI+R         +LR+ R+MEYLS VIDETLR V  S   FR+A KDV V+GY IP
Sbjct  215  GQEEIMR---------SLRDFRKMEYLSHVIDETLRFVNMSFLSFRQATKDVFVNGYLIP  265

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +WFR VH+D ++Y DP  F PSRWD  +PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  266  KGWKVQLWFRNVHMDPQVYSDPSKFKPSRWDGSSPRAGTFLPFGLGARLCPGNDLAKLEI  325

Query  263  SIFLHYFLLGYELERKN  213
            S+FLH+F+LGY+L R N
Sbjct  326  SVFLHHFILGYKLTRTN  342



>gb|KCW77910.1| hypothetical protein EUGRSUZ_D02168 [Eucalyptus grandis]
Length=488

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 6/217 (3%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            +++M+D LMEV+DE+ R+L++E+IID+L+MYL AGHE+S H TMWA ++L  HP+  ++A
Sbjct  268  RKNMLDMLMEVEDEDKRKLEEEDIIDILLMYLLAGHETSAHGTMWAALYLHEHPDILQKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+   P  Q GLTL+EIRQ +YL++V+DETLR ++ S  VFREAK DVNV+   
Sbjct  328  KEEQEEIISRRPATQSGLTLKEIRQSQYLTRVVDETLRRISLSFAVFREAKADVNVN---  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
               GWKV+V  R VH+D E Y DP  F+PSRW+N   +AGAFLPFGAGSR CPG+DLAKL
Sbjct  385  ---GWKVMVSSRAVHMDPENYLDPKKFDPSRWENINAKAGAFLPFGAGSRFCPGSDLAKL  441

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCL  159
            EISIFLH FLL Y+LER NP  P+ +LP   P DNCL
Sbjct  442  EISIFLHQFLLHYKLERVNPKSPVSHLPLPHPSDNCL  478



>gb|KDO44741.1| hypothetical protein CISIN_1g011343mg [Citrus sinensis]
Length=488

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 169/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++ M+D L+E +DENG++L+D  IID+L++ L AGHESS H +MWA ++L  HPE  ++A
Sbjct  265  QKGMIDLLLEAEDENGKKLEDVHIIDLLIINLLAGHESSAHASMWAVLYLNQHPEMLQKA  324

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++  P  QKGLTL EI+QM+YL+KVIDET+R  +  + +FREAK D N+ GYT
Sbjct  325  KQEQEEIIKRRPSTQKGLTLEEIKQMDYLAKVIDETMRRSSLFIPIFREAKVDANIQGYT  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            +P+GW+VLVW RGVH+D E+Y +P  F+PSRWDN T + G+++PFG G  +CPG DL KL
Sbjct  385  VPKGWQVLVWTRGVHMDPEVYTNPKEFDPSRWDNHTTKPGSYIPFGGGPWICPGADLTKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI IFLHYFLL Y+LE +NP+CP+ YLP  RP DNCL 
Sbjct  445  EIYIFLHYFLLNYKLELQNPECPVAYLPVPRPSDNCLA  482



>ref|XP_006485427.1| PREDICTED: beta-amyrin 11-oxidase-like [Citrus sinensis]
Length=488

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 169/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            ++ M+D L+E +DENG++L+D  IID+L++ L AGHESS H +MWA ++L  HPE  ++A
Sbjct  265  QKGMIDLLLEAEDENGKKLEDVHIIDLLIINLLAGHESSAHASMWAVLYLNQHPEMLQKA  324

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++  P  QKGLTL EI+QM+YL+KVIDET+R  +  + +FREAK D N+ GYT
Sbjct  325  KQEQEEIIKRRPSTQKGLTLEEIKQMDYLAKVIDETMRRSSLFIPIFREAKVDANIQGYT  384

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            +P+GW+VLVW RGVH+D E+Y +P  F+PSRWDN T + G+++PFG G  +CPG DL KL
Sbjct  385  VPKGWQVLVWTRGVHMDPEVYTNPKEFDPSRWDNHTTKPGSYIPFGGGPWICPGADLTKL  444

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            EI IFLHYFLL Y+LE +NP+CP+ YLP  RP DNCL 
Sbjct  445  EIYIFLHYFLLNYKLELQNPECPVAYLPVPRPSDNCLA  482



>ref|XP_008465946.1| PREDICTED: beta-amyrin 11-oxidase-like [Cucumis melo]
Length=491

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 170/223 (76%), Gaps = 3/223 (1%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
            + K+DM D L+EV+DE+G+ LDD  IID+L+ +  AGHE+S H  M A +FL  +PE  +
Sbjct  263  NRKKDMTDLLLEVRDEDGQGLDDGCIIDLLIGFFFAGHETSAHSIMRAIMFLSENPETLQ  322

Query  635  RAKAEQEEIVRNMPPD--QKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNV  462
            +AKAEQE+IV+  P D   KGLT++EI+QMEYL KVIDETLR  + + T+ RE K DVN+
Sbjct  323  KAKAEQEQIVKARPADAQHKGLTMKEIKQMEYLFKVIDETLRKTSLAFTLSRETKVDVNL  382

Query  461  SGYTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGND  282
            +GYTIP+GWK+LVW R VH+D EIYE+P  F+PSRW+N   R G+F+PFGAG RLCPG D
Sbjct  383  NGYTIPKGWKILVWTRAVHMDPEIYENPQKFDPSRWENPKRRGGSFIPFGAGMRLCPGID  442

Query  281  LAKLEISIFLHYFLL-GYELERKNPDCPLMYLPHTRPKDNCLG  156
            L+KLEI+IFLHYF+  G+ LER NP+CP  +LP  RP DNCL 
Sbjct  443  LSKLEIAIFLHYFIHGGFRLERVNPNCPENHLPLPRPTDNCLA  485



>dbj|BAG68927.1| cytochrome P450 88D4 [Lotus japonicus]
Length=484

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = -3

Query  797  MDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKAEQ  618
            +D L+E KDENGR+ DDE I+DVL+  L AGHE+S    MW  ++L  HP   ++AK EQ
Sbjct  265  LDNLLEAKDENGRKRDDEYIVDVLIAQLFAGHETSATALMWTILYLTQHPHILEKAKKEQ  324

Query  617  EEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIPEG  438
            EEI++     Q  L L+EI+QM YLS+VIDETLR      T FREA  DVN++GY IP G
Sbjct  325  EEIMKARVSSQGRLNLQEIKQMVYLSQVIDETLRCANIVFTTFREAISDVNINGYVIPNG  384

Query  437  WKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEISI  258
            W+VLVW R VH++ + Y +P  FNPSRWD++  +AG FLPFGAGSRLCPG DLAKLEIS+
Sbjct  385  WRVLVWARAVHMNPKYYPNPEEFNPSRWDDYHGKAGTFLPFGAGSRLCPGKDLAKLEISV  444

Query  257  FLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            FLHYFLL Y+LER N +CP+ +LP  +P DNCL 
Sbjct  445  FLHYFLLNYKLERINAECPITFLPILKPVDNCLA  478



>dbj|BAG68928.1| cytochrome P450 88D5 [Lotus japonicus]
Length=489

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +  +D ++EV DENGR+L+D  IID+L+  L AGHE+S    MW  V+L  HP    +AK
Sbjct  265  KAFIDSVLEVNDENGRKLEDGYIIDLLIAILFAGHETSATTMMWTIVYLTQHPHILNKAK  324

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
             EQE+I++     Q  L L+EI+QM YLS+VIDETLR      ++FREA  DVN+SGY I
Sbjct  325  EEQEKIMKVRVSSQTRLNLQEIKQMVYLSQVIDETLRCANIVFSMFREATSDVNMSGYVI  384

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GW+VL+W R VH+D E Y +P  FNPSRWD++  +AG  LPFG GSRLCPG DLAKLE
Sbjct  385  PKGWRVLIWGRAVHMDPENYPNPEEFNPSRWDDYHGKAGTSLPFGVGSRLCPGKDLAKLE  444

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            ISIFLHYFLL Y+LER NPDCP+ +LP  +P DNCL 
Sbjct  445  ISIFLHYFLLNYKLERINPDCPITFLPIPKPVDNCLA  481



>gb|EMT30414.1| Ent-kaurenoic acid oxidase 1 [Aegilops tauschii]
Length=414

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 151/216 (70%), Gaps = 30/216 (14%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+  +DE GR L D+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+   +A  
Sbjct  220  DMMDRLIAAEDEGGRRLQDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDILAKA--  277

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
                                        KV+DETLR V  S   FR+A +DV V+GY IP
Sbjct  278  ----------------------------KVVDETLRFVNISFVSFRQATRDVFVNGYLIP  309

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GWKV +W+R VH+D ++Y DP  F+PSRW+   PRAG FLPFG G+RLCPGNDLAKLEI
Sbjct  310  KGWKVQLWYRSVHMDPQVYPDPKKFDPSRWEGPPPRAGTFLPFGLGTRLCPGNDLAKLEI  369

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            S+FLH+FLLGY+L RKNP+C + YLPH RP DNCL 
Sbjct  370  SVFLHHFLLGYKLTRKNPNCRVRYLPHPRPVDNCLA  405



>gb|KGN56650.1| hypothetical protein Csa_3G127130 [Cucumis sativus]
Length=466

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 156/219 (71%), Gaps = 32/219 (15%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +++DMMD L++V+DENGR+L DEEIID+LVMYLNAGHESSGH  MWAT+ L  HPE  K+
Sbjct  270  KRKDMMDALIDVEDENGRKLTDEEIIDILVMYLNAGHESSGHTMMWATILLNQHPEVLKK  329

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEIVR  P  QKGLTL+E R MEYLSKV+DETLR V+FSL VFREA+ DVN++  
Sbjct  330  AKEEQEEIVRRRPAGQKGLTLKECRDMEYLSKVVDETLRYVSFSLVVFREAQMDVNLNEI  389

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
                        RG                     F P+AG FLPFGAGSRLCPGNDLAK
Sbjct  390  A-----------RG---------------------FIPKAGEFLPFGAGSRLCPGNDLAK  417

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LEI IF+HYFLL Y+LE   PDC ++YLPH+RPKDNCL 
Sbjct  418  LEICIFIHYFLLNYKLEWLTPDCQILYLPHSRPKDNCLA  456



>ref|XP_008448719.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X3 [Cucumis melo]
Length=376

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  806  RDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAK  627
            +DMMD LMEV+DE+G   DDE I +++   L  G E+S   TMWA +FL  +P  F++AK
Sbjct  150  KDMMDLLMEVRDEDGEGFDDETITEMIFSMLFGGQETSAFTTMWAVLFLTDNPHIFQKAK  209

Query  626  AEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTI  447
             EQE+IVR     QKG++L EI+QM+YLS+VIDETLRL + +   FREA  DV ++G  I
Sbjct  210  EEQEDIVRRRASTQKGVSLSEIKQMKYLSQVIDETLRLGSIAFATFREATTDVEINGKII  269

Query  446  PEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLE  267
            P+GWKV++W R +++DE+++  P  FNPSRWDNFT  +GAF PFG G R+CPG DLA++E
Sbjct  270  PKGWKVILWLRELYMDEKLHPSPQQFNPSRWDNFTGSSGAFTPFGLGVRMCPGRDLARIE  329

Query  266  ISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            ISIFLHYF+L Y++ER N +C L YLP   PKD CL 
Sbjct  330  ISIFLHYFVLNYKVERLNAECELNYLPIAYPKDKCLA  366



>ref|XP_008448718.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X2 [Cucumis melo]
Length=418

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 159/219 (73%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD LMEV+DE+G   DDE I +++   L  G E+S   TMWA +FL  +P  F++
Sbjct  190  KAKDMMDLLMEVRDEDGEGFDDETITEMIFSMLFGGQETSAFTTMWAVLFLTDNPHIFQK  249

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE+IVR     QKG++L EI+QM+YLS+VIDETLRL + +   FREA  DV ++G 
Sbjct  250  AKEEQEDIVRRRASTQKGVSLSEIKQMKYLSQVIDETLRLGSIAFATFREATTDVEINGK  309

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKV++W R +++DE+++  P  FNPSRWDNFT  +GAF PFG G R+CPG DLA+
Sbjct  310  IIPKGWKVILWLRELYMDEKLHPSPQQFNPSRWDNFTGSSGAFTPFGLGVRMCPGRDLAR  369

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EISIFLHYF+L Y++ER N +C L YLP   PKD CL 
Sbjct  370  IEISIFLHYFVLNYKVERLNAECELNYLPIAYPKDKCLA  408



>ref|XP_006485429.1| PREDICTED: beta-amyrin 11-oxidase-like [Citrus sinensis]
Length=491

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 164/216 (76%), Gaps = 0/216 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            KR M+D +ME++DE+G++L DE+I+D+L++ L   H+   H  MWAT++L  HP+  ++A
Sbjct  268  KRGMIDLMMEIEDESGKKLQDEDIVDLLIVLLLGAHDGPTHTIMWATIYLYGHPQILQKA  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI++  P  QKGL+L+EI+QMEYLSKVIDETLRL+      FREAK D N+ GYT
Sbjct  328  KEEQEEIIKTRPSSQKGLSLQEIKQMEYLSKVIDETLRLMNLPFLDFREAKTDANIKGYT  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKVL+W R VH+D + +  P  F+PSRWDN     G+F+PFG GSR C G D+AK+
Sbjct  388  IPKGWKVLIWNRAVHMDPDNFSAPKEFDPSRWDNNAAEPGSFIPFGGGSRRCLGIDVAKI  447

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNC  162
            E+SIFLHYFLL Y+LE+ NP+ P++YLP TRP DNC
Sbjct  448  EVSIFLHYFLLNYKLEQLNPESPIVYLPTTRPSDNC  483



>ref|XP_007039555.1| Cytochrome P450 88D6, putative [Theobroma cacao]
 gb|EOY24056.1| Cytochrome P450 88D6, putative [Theobroma cacao]
Length=597

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 163/220 (74%), Gaps = 0/220 (0%)
 Frame = -3

Query  815  HEKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFK  636
            + K+ MMD LMEVK+ENG +L+DE IID+L++ L AGHE++ H  MWA + L  HPE  +
Sbjct  372  NRKKGMMDLLMEVKNENGEKLEDEHIIDLLLLILFAGHETTAHTAMWAIIHLHDHPEMLQ  431

Query  635  RAKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSG  456
            +AK EQE I++     QKGLTL EI+QMEYL KVIDE+LR   F+ ++FR+ + DVN++G
Sbjct  432  KAKEEQEAIIKRRSSSQKGLTLTEIKQMEYLPKVIDESLRRSNFAFSIFRKVEADVNING  491

Query  455  YTIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLA  276
            YTIP GWKVLVW R +H+D  IY +P  F PSRW+N   +A +F+PFGAGSR CPG DL 
Sbjct  492  YTIPNGWKVLVWHRAIHMDPNIYSNPKEFLPSRWENHRFKARSFIPFGAGSRTCPGADLG  551

Query  275  KLEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            KLEISIFLHYFLL Y+LE  NP  P+ YLP  RP DNCL 
Sbjct  552  KLEISIFLHYFLLNYKLEEVNPRGPINYLPLPRPADNCLA  591


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 10/67 (15%)
 Frame = -3

Query  422  WFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEISIFLHYF  243
            ++RG++L  +I E+P         +  P A +F PF  GS  CPG DLAKLEISIFL+YF
Sbjct  63   FYRGMNLFSKI-EEP---------DLKPIAWSFQPFEEGSMNCPGADLAKLEISIFLYYF  112

Query  242  LLGYELE  222
             L Y ++
Sbjct  113  PLNYNVQ  119



>ref|XP_008448717.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X1 [Cucumis melo]
Length=497

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 159/219 (73%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            + +DMMD LMEV+DE+G   DDE I +++   L  G E+S   TMWA +FL  +P  F++
Sbjct  269  KAKDMMDLLMEVRDEDGEGFDDETITEMIFSMLFGGQETSAFTTMWAVLFLTDNPHIFQK  328

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE+IVR     QKG++L EI+QM+YLS+VIDETLRL + +   FREA  DV ++G 
Sbjct  329  AKEEQEDIVRRRASTQKGVSLSEIKQMKYLSQVIDETLRLGSIAFATFREATTDVEINGK  388

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKV++W R +++DE+++  P  FNPSRWDNFT  +GAF PFG G R+CPG DLA+
Sbjct  389  IIPKGWKVILWLRELYMDEKLHPSPQQFNPSRWDNFTGSSGAFTPFGLGVRMCPGRDLAR  448

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EISIFLHYF+L Y++ER N +C L YLP   PKD CL 
Sbjct  449  IEISIFLHYFVLNYKVERLNAECELNYLPIAYPKDKCLA  487



>gb|KCW77919.1| hypothetical protein EUGRSUZ_D021732, partial [Eucalyptus grandis]
Length=460

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 154/193 (80%), Gaps = 0/193 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            +++M+D LMEV+DE+ R+L++E+IID+L+MYL AGHE+S H TMWA ++L  HP+  ++ 
Sbjct  268  RKNMLDMLMEVEDEDKRKLEEEDIIDILLMYLLAGHETSAHGTMWAALYLHEHPDILQKT  327

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQEEI+   P  Q GLTL+EIRQ +YL++V+DETLR ++ S  VFREAK DVNV+GY 
Sbjct  328  KEEQEEIISRRPATQSGLTLKEIRQSQYLTRVVDETLRRISLSFAVFREAKADVNVNGYL  387

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GWKV+V  R VH+D E Y DP  F+PSRW+N   +AGAFLPFGAGSR CPG+DLAKL
Sbjct  388  IPKGWKVMVSSRAVHMDPENYLDPKKFDPSRWENIKAKAGAFLPFGAGSRFCPGSDLAKL  447

Query  269  EISIFLHYFLLGY  231
            EISIFLH FLL Y
Sbjct  448  EISIFLHQFLLHY  460



>ref|XP_008448720.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X1 [Cucumis melo]
Length=496

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 159/219 (73%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E +DMMD LMEV+DE+G   DDE I +++   L  G E+S   TMWA +FL  +P  F++
Sbjct  268  EAKDMMDLLMEVRDEDGEGFDDETITEMIFGMLFGGQETSAFTTMWAILFLTDNPHIFQK  327

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE+I+R     QKG++L EI+QM++LS+VIDETLRL + +   FREA  DV ++G 
Sbjct  328  AKEEQEDIIRRRVSTQKGISLSEIKQMKFLSQVIDETLRLSSIAFVTFREATVDVEINGK  387

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
            TIP+GWKV++W R +++DE+++  P  FNPSRWDNF    GAF PFG G R+CPG DLA+
Sbjct  388  TIPKGWKVILWLRELNMDEKLHPSPQHFNPSRWDNFIGSPGAFTPFGLGVRMCPGRDLAR  447

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            +EISIFLH+F+L Y++ER NP C L YLP + PKD CL 
Sbjct  448  IEISIFLHHFVLNYKIERLNPQCQLKYLPISHPKDKCLA  486



>gb|KJB25349.1| hypothetical protein B456_004G187200 [Gossypium raimondii]
Length=486

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 163/216 (75%), Gaps = 0/216 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K++M+D LME + +NG +LDDE + D+L+++L AGHE++ H  MWAT++L  HPE  ++A
Sbjct  263  KKEMIDFLMEAEYDNGEKLDDEHLFDLLLIFLFAGHETAAHTAMWATIYLHHHPEMLQKA  322

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQE +++  P  QKGLTL EI+QMEYL KVIDE++R   F+ T+FR  + DVN++GYT
Sbjct  323  KEEQEAVLKRRPSSQKGLTLAEIKQMEYLPKVIDESMRRANFAFTLFRRVETDVNLNGYT  382

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GW VLVW R VH+D++IY +P  F PSRW+N   +   F+PFG GSR+CPG+DL KL
Sbjct  383  IPKGWNVLVWSRAVHMDQDIYPNPKEFLPSRWENPGLKGKNFIPFGGGSRICPGSDLGKL  442

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNC  162
            E+SIFLH+FLL Y+LE  NP  P + LP TRP DNC
Sbjct  443  EVSIFLHHFLLNYKLEELNPKAPTITLPLTRPADNC  478



>ref|XP_009624147.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=449

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 158/219 (72%), Gaps = 1/219 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K +M+D +M ++DE G+ L DEEIID+L++Y  AGHE++ H T WA ++L+ HPE  ++A
Sbjct  221  KCNMVDLIMCIEDEEGKRLSDEEIIDLLIVYAFAGHETTAHTTAWAIMYLEQHPEFLQKA  280

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQ+EIV+N     K L+  EIRQM+YL+KVIDETLR    +L ++R AK+ +N++GYT
Sbjct  281  KEEQQEIVKNRLHSDKNLSYDEIRQMKYLTKVIDETLRCSNITLAIYRNAKRTINMNGYT  340

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNF-TPRAGAFLPFGAGSRLCPGNDLAK  273
            IP+GWKVL W R VHLD   Y +P  FNP RWD   T    AFLPFGAG RLCPG +LA+
Sbjct  341  IPKGWKVLTWIRQVHLDPNNYVNPKEFNPLRWDAHETKPFSAFLPFGAGPRLCPGAELAR  400

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
            LE+S+FLHYFLL Y LER NP+  + YLP   P DNC+ 
Sbjct  401  LEVSVFLHYFLLYYRLERLNPEIRVAYLPIPSPTDNCIA  439



>ref|XP_004510261.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=488

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+  +D L+E+ D+ G++L+D  IID LVM L  GHE+S    M +  +L  +P   K+
Sbjct  263  EKKYFVDILLEMDDDMGQKLEDGVIIDSLVMLLFGGHETSATTMMLSITYLTQNPLCLKK  322

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  P  QKGL++ EI++M YLS++IDETLRL +   ++FR+  KDVN++GY
Sbjct  323  AKEEQEEIIKARPSSQKGLSITEIKKMVYLSQIIDETLRLGSNLFSIFRQTIKDVNINGY  382

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKV+VW R + +D + Y +P  FNPSRWD++ P  G F+PFGAG RLCPGNDLA+
Sbjct  383  CIPKGWKVMVWTRAISMDPQYYSNPELFNPSRWDDYNPTTGTFIPFGAGPRLCPGNDLAR  442

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
              I+IFLHYF+L Y+LER N +CP   LP  +P DNCL 
Sbjct  443  FTITIFLHYFVLNYKLERINSECPFTNLPIPKPIDNCLA  481



>ref|XP_003604124.1| Ent-kaurenoic acid oxidase [Medicago truncatula]
 gb|AES86321.1| cytochrome P450 family 88 protein [Medicago truncatula]
Length=487

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 159/219 (73%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            E  +++D ++E KDE G +L+D++IID+L+ +L   H+S    +MW+ ++L  +P   K+
Sbjct  262  ENNNLLDIILETKDERGEKLEDKDIIDLLIAFLFGAHDSIATASMWSVMYLAQNPLCLKK  321

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE I++     QK L++ EI++M YLS+V+DET+R +T   + FREA  DVN++GY
Sbjct  322  AKEEQEGILKARSTSQKRLSIEEIKKMIYLSQVVDETIRHITI-FSAFREAAIDVNINGY  380

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVW   +H+D E Y +P  FNP+RWD++ P +G F+PFG G RLCPG DLAK
Sbjct  381  FIPKGWKVLVWLSALHMDPEYYSNPKEFNPTRWDDYNPGSGTFIPFGVGRRLCPGRDLAK  440

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             EISIFLHYF+L Y+LER NP+CP+   P+++P DNCL 
Sbjct  441  YEISIFLHYFVLNYKLERINPECPITSFPYSKPIDNCLA  479



>gb|KDO85363.1| hypothetical protein CISIN_1g010697mg [Citrus sinensis]
Length=454

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            +K+DMMD L+ V+DENGR+L+DEEIIDVL+MYLNAGHESSGH  MWAT+FLQ HPE  ++
Sbjct  275  KKKDMMDALLSVEDENGRKLEDEEIIDVLLMYLNAGHESSGHTMMWATIFLQEHPEFLQK  334

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+  PP QKGLTL+EIR+M+YLSKV+DETLR++TFSLTVFREAK DVN+SGY
Sbjct  335  AKAEQEMIVKKRPPTQKGLTLKEIREMDYLSKVVDETLRIITFSLTVFREAKTDVNISGY  394

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD  351
            TIP+GWKVLVWFR VHLD EIY +P  FNPSRWD
Sbjct  395  TIPKGWKVLVWFRSVHLDPEIYPNPKEFNPSRWD  428



>gb|AFK35039.1| unknown [Medicago truncatula]
Length=335

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 154/219 (70%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D+++ L+E+ DE G +L+D++IID+L+  L  GH+S     M   ++L  HP   K+
Sbjct  110  EKKDLINILLEMNDEAGEKLEDKDIIDLLITLLFGGHDSIAAGMMLTIMYLTEHPLCLKK  169

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QK L++ EI++M YLS+V DETLR +T     FREA  D N++GY
Sbjct  170  AKEEQEEILKARPPSQKRLSIEEIQKMTYLSQVFDETLR-ITSVFATFREATTDANINGY  228

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVW   +H+  E + +P  FNPSRW++  P  G FLPFG G RLCPG DL+K
Sbjct  229  LIPKGWKVLVWLNAMHMAPEHHSNPDEFNPSRWNDHNPTTGTFLPFGIGRRLCPGRDLSK  288

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             E+ IFLHYF+L Y+LER NP+CPL  LP+ +P DNCL 
Sbjct  289  YEMLIFLHYFVLNYKLERINPECPLTGLPYIKPTDNCLA  327



>gb|KCW77922.1| hypothetical protein EUGRSUZ_D02177 [Eucalyptus grandis]
Length=496

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 152/213 (71%), Gaps = 0/213 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
             M+D L+E +DE+G+ +  + I D+L MYL AG +S    T+W  ++   +P+  +RAK 
Sbjct  269  SMLDLLVEAEDEDGQAISKDSISDILNMYLLAGFDSVALATLWMVLYFYENPDTLQRAKE  328

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQ +I++   P QKGLT  EI+QMEYL+K IDE LR V    ++FREAK+D  ++GY IP
Sbjct  329  EQIQILKRREPTQKGLTYLEIKQMEYLAKAIDEMLRRVNIGFSLFREAKEDTTINGYLIP  388

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKLEI  264
            +GW VL+  RGVH+D   Y +P  FNPSRWDN+  + GAF+PFGAGSR CPG+DLAK+E+
Sbjct  389  KGWNVLICLRGVHMDPANYLEPEEFNPSRWDNYRKKGGAFIPFGAGSRFCPGSDLAKVEV  448

Query  263  SIFLHYFLLGYELERKNPDCPLMYLPHTRPKDN  165
            SIFLHYFLL YE+ER NP CP+ + P  +P DN
Sbjct  449  SIFLHYFLLNYEVERTNPKCPINHFPSPKPSDN  481



>ref|XP_004510260.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=488

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 152/219 (69%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+ ++D LMEV D  G+ L+DE II+ L++YL AGHES+  + M +  +L  +P   K+
Sbjct  262  EKKYLVDILMEVDDNMGKNLEDEIIINYLILYLFAGHESTATLMMLSITYLTQNPLCLKK  321

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEIV+  P  QKGL++ EI++M YLS++I+ETLRL   +  +FREA  D+N  GY
Sbjct  322  AKEEQEEIVKARPSTQKGLSIMEIKKMVYLSQIINETLRLANNAFAIFREATTDINFDGY  381

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKV+VW R +H++ E + D   FNP RW+++    G F+PFG G RLCPGNDL  
Sbjct  382  CIPKGWKVIVWPRAIHMNPEFHSDSGAFNPDRWNDYNSATGTFIPFGVGPRLCPGNDLTI  441

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             E SIFLH+FLL Y+LER NP+C    LP  +P DNCL 
Sbjct  442  FETSIFLHHFLLNYKLERINPECAFTNLPTNKPIDNCLA  480



>dbj|BAN15044.1| putative cytochrome P450 monooxygenase CYP88D8 [Astragalus sinicus]
Length=489

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D++D L+E+KD+N  ++ DE+IID L++ L  GHES     MW+ ++L  +P+  KR
Sbjct  263  EKKDIVDILLEIKDDNDEKMKDEDIIDFLIVLLFGGHESVATAMMWSVIYLTQNPQCLKR  322

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQE I++     +K L L+EI++M YLS+VI+E+LRL + +  VFREA  D+N++GY
Sbjct  323  AKEEQEVIIKARSSSEKRLCLKEIKEMVYLSQVINESLRLTSNAALVFREAASDLNINGY  382

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVW R +H++ E + +   FNPSRWD++    G FLPFG G RLCPG DL +
Sbjct  383  LIPKGWKVLVWLRALHMEPEYHSNAEDFNPSRWDDYNLTEGTFLPFGIGKRLCPGLDLTR  442

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             E SIFLHYFLL Y+LE+ NP+C +  +P +RP DNCL 
Sbjct  443  FEFSIFLHYFLLNYKLEQINPECRINCIPISRPIDNCLA  481



>dbj|BAN15043.1| putative cytochrome P450 monooxygenase CYP88D7 [Astragalus sinicus]
Length=488

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 154/219 (70%), Gaps = 0/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+ ++D L+E+  ENG+ ++DE+I +  +  L AGHES+    MW+ ++L  +P    +
Sbjct  262  EKKYLLDILLEIDYENGKGVEDEDITNFFINILLAGHESTATGMMWSIIYLTQNPHLLNK  321

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  P  Q  L++ EI+QM YLSKVI+E LR    +   FREA  D+N++GY
Sbjct  322  AKEEQEEIMKARPSTQNRLSIMEIKQMGYLSKVINEMLRRTNIAFAGFREAMSDMNINGY  381

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVW R +H+D   + +P  FNPSRWD++   AG FLPFG+GS LCPGNDLAK
Sbjct  382  FIPKGWKVLVWLRAIHMDPNNHANPNDFNPSRWDDYNATAGTFLPFGSGSWLCPGNDLAK  441

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             E++IFLHYFLL Y+LE+ NPDCP+  LP  +P D CL 
Sbjct  442  FEMTIFLHYFLLNYKLEQINPDCPITNLPGVKPVDECLA  480



>gb|KEH18187.1| cytochrome P450 family 88 protein [Medicago truncatula]
Length=489

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 154/219 (70%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D+++ L+E+ DE G +L+D++IID+L+  L  GH+S     M   ++L  HP   K+
Sbjct  264  EKKDLINILLEMNDEAGEKLEDKDIIDLLITLLFGGHDSIAAGMMLTIMYLTEHPLCLKK  323

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QK L++ EI++M YLS+V DETLR +T     FREA  D N++GY
Sbjct  324  AKEEQEEILKARPPSQKRLSIEEIQKMTYLSQVFDETLR-ITSVFATFREATTDANINGY  382

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVW   +H+  E + +P  FNPSRW++  P  G FLPFG G RLCPG DL+K
Sbjct  383  LIPKGWKVLVWLNAMHMAPEHHSNPDEFNPSRWNDHNPTTGTFLPFGIGRRLCPGRDLSK  442

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             E+ IFLHYF+L Y+LER NP+CPL  LP+ +P DNCL 
Sbjct  443  YEMLIFLHYFVLNYKLERINPECPLTSLPYIKPTDNCLA  481



>dbj|BAQ20602.1| ent-kaurenoic acid oxidase 1 [Lygodium japonicum]
Length=524

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 154/214 (72%), Gaps = 1/214 (0%)
 Frame = -3

Query  809  KRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRA  630
            K DM++ LM  +DE+G  L DEE+ID+L+MYLNAGHESS H  MW  + L++HP+   + 
Sbjct  296  KEDMLETLMLTQDEDGSRLTDEEVIDLLLMYLNAGHESSAHTIMWILILLRAHPQYLAKV  355

Query  629  KAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYT  450
            K EQ EI +N  P++  L   + R+M YLS+V+DETLRL+  S  VFR++ +DV  +GYT
Sbjct  356  KEEQLEIRKNKKPNEI-LNWEDYRKMTYLSQVVDETLRLINISPMVFRKSLEDVEFNGYT  414

Query  449  IPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAKL  270
            IP+GW V  W R VHLD ++Y DPL F+P RW+   P+AGAF+PFGAG+ +CPGND AKL
Sbjct  415  IPKGWHVQTWMRQVHLDPQVYPDPLKFDPDRWEREIPKAGAFIPFGAGAHMCPGNDFAKL  474

Query  269  EISIFLHYFLLGYELERKNPDCPLMYLPHTRPKD  168
            EI++F+HY  L YE    +P+  ++YLPH RPKD
Sbjct  475  EIALFIHYAALFYEFTPVSPNATVIYLPHPRPKD  508



>dbj|BAG68925.1| cytochrome P450 88D2 [Medicago truncatula]
Length=489

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 154/219 (70%), Gaps = 1/219 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EK+D+++ L+E+ DE G +L+D++IID+L+  L  GH+S     M   ++L  HP   K+
Sbjct  264  EKKDLINILLEMNDEAGEKLEDKDIIDLLIALLFGGHDSIAAGMMLTIMYLTEHPLCLKK  323

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AK EQEEI++  PP QK L++ EI++M YLS+V DETLR +T     FREA  D N++GY
Sbjct  324  AKEEQEEILKARPPSQKRLSIEEIQKMTYLSQVFDETLR-ITSVFATFREATTDANINGY  382

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFLPFGAGSRLCPGNDLAK  273
             IP+GWKVLVW   +H+  E + +P  FNPSRW++  P  G FLPFG G RLCPG DL+K
Sbjct  383  LIPKGWKVLVWLNAMHMAPEHHSNPEEFNPSRWNDHNPTTGTFLPFGMGRRLCPGRDLSK  442

Query  272  LEISIFLHYFLLGYELERKNPDCPLMYLPHTRPKDNCLG  156
             E+ IFLHYF+L Y+L+R NP+CPL  LP+ +P DNCL 
Sbjct  443  YEMLIFLHYFVLNYKLKRINPECPLTSLPYIKPTDNCLA  481



>emb|CDP21969.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  812  EKRDMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKR  633
            EKRDMMD LM+  D+ GR+LDDEEIIDVLVMYLNAGHESSGH++MWAT+FLQ +PE  ++
Sbjct  265  EKRDMMDALMDAVDDKGRKLDDEEIIDVLVMYLNAGHESSGHVSMWATLFLQKNPEVLQK  324

Query  632  AKAEQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGY  453
            AKAEQE IV+N PP Q GLTL+EIRQM+YLSKVIDETLR+VTFS  VFREA+KD+N+SG+
Sbjct  325  AKAEQEAIVKNRPPGQVGLTLKEIRQMDYLSKVIDETLRVVTFSFVVFREAQKDINISGF  384

Query  452  TIPEGWKVLVWFRGVHLDEEIYEDPLTFNPSRWD  351
            TIP+GWK LVWFR VH D E+Y +P  F+P RWD
Sbjct  385  TIPKGWKALVWFRNVHFDPELYPEPKKFDPDRWD  418



>gb|AAL50601.1| DWARF3 [Zea mays]
 gb|AAL50613.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50595.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50620.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50591.1| DWARF3 [Zea mays]
 gb|AAL50598.1| DWARF3 [Zea mays]
 gb|AAL50618.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50583.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRHLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50574.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50586.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50615.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50597.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50593.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50589.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50596.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50579.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50580.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50608.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50585.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50594.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50619.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQRGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50592.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRHLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50604.1| DWARF3 [Zea mays]
Length=394

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50616.1| DWARF3 [Zea mays]
Length=394

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D  +Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPHVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50612.1| DWARF3 [Zea mays]
Length=394

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRHLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D  +Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPHVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50611.1| DWARF3 [Zea mays]
Length=394

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GL+LR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLSLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D ++Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPQVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50577.1| DWARF3 [Zea mays]
Length=394

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D  +Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPHVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50576.1| DWARF3 [Zea mays]
Length=394

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRHLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D  +Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPHVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50575.1| DWARF3 [Zea mays]
 gb|AAL50588.1| DWARF3 [Zea mays]
Length=394

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D  +Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPHVYPDPTKFDPSRWEGHSPRAGTFL  394



>gb|AAL50602.1| DWARF3 [Zea mays]
 gb|AAL50603.1| DWARF3 [Zea mays]
Length=394

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -3

Query  803  DMMDRLMEVKDENGRELDDEEIIDVLVMYLNAGHESSGHITMWATVFLQSHPEAFKRAKA  624
            DMMDRL+E +DE GR LDD+EIIDVLVMYLNAGHESSGHITMWATVFLQ +P+ F RAKA
Sbjct  234  DMMDRLIEAQDERGRRLDDDEIIDVLVMYLNAGHESSGHITMWATVFLQENPDMFARAKA  293

Query  623  EQEEIVRNMPPDQKGLTLREIRQMEYLSKVIDETLRLVTFSLTVFREAKKDVNVSGYTIP  444
            EQE I+R++P  Q+GLTLR+ R+MEYLS+VIDETLRLV  S   FR+A +DV V+GY IP
Sbjct  294  EQEAIMRSIPSSQQGLTLRDFRKMEYLSQVIDETLRLVNISFVSFRQATRDVFVNGYLIP  353

Query  443  EGWKVLVWFRGVHLDEEIYEDPLTFNPSRWDNFTPRAGAFL  321
            +GWKV +W+R VH+D  +Y DP  F+PSRW+  +PRAG FL
Sbjct  354  KGWKVQLWYRSVHMDPHVYPDPTKFDPSRWEGHSPRAGTFL  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500