BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11899

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083993.1|  PREDICTED: CBL-interacting serine/threonine-...    209   3e-61   Sesamum indicum [beniseed]
ref|XP_011079428.1|  PREDICTED: CBL-interacting serine/threonine-...    209   4e-61   Sesamum indicum [beniseed]
emb|CDP10216.1|  unnamed protein product                                204   2e-59   Coffea canephora [robusta coffee]
ref|XP_009790292.1|  PREDICTED: CBL-interacting serine/threonine-...    204   6e-59   Nicotiana sylvestris
ref|XP_009596060.1|  PREDICTED: CBL-interacting serine/threonine-...    203   8e-59   Nicotiana tomentosiformis
ref|XP_006343663.1|  PREDICTED: CBL-interacting serine/threonine-...    201   5e-58   Solanum tuberosum [potatoes]
gb|EYU31774.1|  hypothetical protein MIMGU_mgv1a006747mg                201   8e-58   Erythranthe guttata [common monkey flower]
emb|CDY13400.1|  BnaA03g51180D                                          198   3e-57   Brassica napus [oilseed rape]
ref|XP_009108957.1|  PREDICTED: CBL-interacting serine/threonine-...    199   4e-57   Brassica rapa
ref|XP_009137980.1|  PREDICTED: CBL-interacting serine/threonine-...    199   4e-57   Brassica rapa
ref|XP_004242581.1|  PREDICTED: CBL-interacting serine/threonine-...    198   5e-57   Solanum lycopersicum
ref|XP_010275776.1|  PREDICTED: CBL-interacting serine/threonine-...    199   5e-57   Nelumbo nucifera [Indian lotus]
emb|CBI41032.3|  unnamed protein product                                197   5e-57   Vitis vinifera
ref|XP_008443868.1|  PREDICTED: CBL-interacting serine/threonine-...    198   7e-57   Cucumis melo [Oriental melon]
ref|XP_009127378.1|  PREDICTED: CBL-interacting serine/threonine-...    198   9e-57   Brassica rapa
ref|NP_001268212.1|  uncharacterized protein LOC100241657               197   1e-56   Vitis vinifera
gb|KHN45276.1|  CBL-interacting serine/threonine-protein kinase 6       191   2e-56   Glycine soja [wild soybean]
ref|XP_004146689.1|  PREDICTED: CBL-interacting serine/threonine-...    197   2e-56   Cucumis sativus [cucumbers]
ref|XP_010438101.1|  PREDICTED: CBL-interacting serine/threonine-...    197   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009598784.1|  PREDICTED: CBL-interacting serine/threonine-...    196   3e-56   Nicotiana tomentosiformis
ref|XP_010432919.1|  PREDICTED: CBL-interacting serine/threonine-...    197   3e-56   Camelina sativa [gold-of-pleasure]
gb|AGH08169.1|  CBL-interacting protein kinase                          196   5e-56   Gossypium hirsutum [American cotton]
gb|KJB65761.1|  hypothetical protein B456_010G112400                    196   5e-56   Gossypium raimondii
emb|CDY23269.1|  BnaA08g12770D                                          195   5e-56   Brassica napus [oilseed rape]
gb|KFK27027.1|  hypothetical protein AALP_AA8G324700                    196   6e-56   Arabis alpina [alpine rockcress]
ref|XP_006350095.1|  PREDICTED: CBL-interacting serine/threonine-...    195   8e-56   Solanum tuberosum [potatoes]
emb|CDY36461.1|  BnaC03g67810D                                          195   8e-56   Brassica napus [oilseed rape]
emb|CDY28231.1|  BnaA01g06180D                                          195   8e-56   Brassica napus [oilseed rape]
ref|XP_010447637.1|  PREDICTED: CBL-interacting serine/threonine-...    196   9e-56   Camelina sativa [gold-of-pleasure]
emb|CDX68708.1|  BnaC01g07450D                                          195   1e-55   
ref|XP_011018017.1|  PREDICTED: CBL-interacting serine/threonine-...    195   1e-55   Populus euphratica
ref|XP_002324548.1|  CBL-interacting protein kinase 6                   195   1e-55   Populus trichocarpa [western balsam poplar]
gb|AAL37170.1|AF319169_1  CBL-interacting protein kinase                195   1e-55   Brassica napus [oilseed rape]
ref|XP_010110371.1|  CBL-interacting serine/threonine-protein kin...    194   2e-55   Morus notabilis
gb|AFD97324.1|  kinase CIPK6                                            195   2e-55   Brassica napus [oilseed rape]
ref|NP_001265891.1|  CBL-interacting protein kinase 6                   194   2e-55   
ref|XP_006412646.1|  hypothetical protein EUTSA_v10025230mg             194   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_009795102.1|  PREDICTED: CBL-interacting serine/threonine-...    194   2e-55   Nicotiana sylvestris
ref|XP_006857201.1|  PREDICTED: CBL-interacting serine/threonine-...    194   3e-55   Amborella trichopoda
ref|XP_006285443.1|  hypothetical protein CARUB_v10006862mg             194   3e-55   Capsella rubella
ref|XP_007204894.1|  hypothetical protein PRUPE_ppa006023mg             194   3e-55   Prunus persica
ref|XP_008242969.1|  PREDICTED: CBL-interacting serine/threonine-...    193   4e-55   Prunus mume [ume]
ref|NP_194825.1|  CBL-interacting serine/threonine-protein kinase 6     194   4e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72282.1|  BnaC07g43040D                                          193   4e-55   
gb|EPS71159.1|  hypothetical protein M569_03590                         193   5e-55   Genlisea aurea
ref|XP_003519143.1|  PREDICTED: CBL-interacting serine/threonine-...    193   6e-55   Glycine max [soybeans]
gb|KHN42812.1|  CBL-interacting serine/threonine-protein kinase 6       193   6e-55   Glycine soja [wild soybean]
ref|XP_004287123.1|  PREDICTED: CBL-interacting serine/threonine-...    193   6e-55   Fragaria vesca subsp. vesca
ref|XP_010048823.1|  PREDICTED: CBL-interacting serine/threonine-...    193   7e-55   Eucalyptus grandis [rose gum]
gb|KJB82849.1|  hypothetical protein B456_013G216700                    193   7e-55   Gossypium raimondii
gb|KJB54939.1|  hypothetical protein B456_009G055400                    193   1e-54   Gossypium raimondii
ref|XP_002533977.1|  CBL-interacting serine/threonine-protein kin...    192   1e-54   Ricinus communis
ref|XP_008456483.1|  PREDICTED: CBL-interacting serine/threonine-...    192   1e-54   
ref|XP_012071492.1|  PREDICTED: CBL-interacting serine/threonine-...    192   1e-54   Jatropha curcas
ref|XP_008354330.1|  PREDICTED: CBL-interacting serine/threonine-...    192   2e-54   
ref|XP_008362871.1|  PREDICTED: CBL-interacting serine/threonine-...    192   2e-54   
ref|XP_004139258.1|  PREDICTED: CBL-interacting serine/threonine-...    192   2e-54   Cucumis sativus [cucumbers]
ref|XP_007011954.1|  SOS3-interacting protein 3                         191   2e-54   
ref|XP_010265622.1|  PREDICTED: CBL-interacting serine/threonine-...    191   3e-54   
gb|ADZ99349.1|  CBL interacting protein kinase 6                        191   3e-54   Gossypium hirsutum [American cotton]
gb|EYU25351.1|  hypothetical protein MIMGU_mgv1a007012mg                191   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_007154893.1|  hypothetical protein PHAVU_003G156900g             191   5e-54   Phaseolus vulgaris [French bean]
ref|XP_008352090.1|  PREDICTED: CBL-interacting serine/threonine-...    190   8e-54   
gb|ABJ91216.1|  CBL-interacting protein kinase 9                        190   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009366288.1|  PREDICTED: CBL-interacting serine/threonine-...    181   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_006473970.1|  PREDICTED: CBL-interacting serine/threonine-...    189   2e-53   Citrus sinensis [apfelsine]
ref|XP_006453669.1|  hypothetical protein CICLE_v10008315mg             189   2e-53   Citrus clementina [clementine]
ref|XP_010047118.1|  PREDICTED: CBL-interacting serine/threonine-...    189   2e-53   Eucalyptus grandis [rose gum]
gb|KJB07595.1|  hypothetical protein B456_001G032000                    189   3e-53   Gossypium raimondii
ref|XP_009358459.1|  PREDICTED: CBL-interacting serine/threonine-...    188   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_002309336.2|  CBL-interacting protein kinase 6                   188   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011033439.1|  PREDICTED: CBL-interacting serine/threonine-...    188   5e-53   Populus euphratica
ref|XP_010526294.1|  PREDICTED: CBL-interacting serine/threonine-...    187   1e-52   Tarenaya hassleriana [spider flower]
gb|AGL07710.1|  CBL-interacting protein kinase                          187   1e-52   Ziziphus jujuba [Chinese jujube]
ref|NP_001235809.1|  SOS2-like protein kinase                           187   2e-52   Glycine max [soybeans]
ref|XP_006600550.1|  PREDICTED: CBL-interacting serine/threonine-...    186   3e-52   Glycine max [soybeans]
gb|KHN18322.1|  CBL-interacting serine/threonine-protein kinase 6       186   3e-52   Glycine soja [wild soybean]
gb|ABK25436.1|  unknown                                                 184   4e-52   Picea sitchensis
gb|ACC96114.1|  CBL-interacting protein kinase 6                        185   6e-52   Cicer arietinum [garbanzo]
ref|XP_004507724.1|  PREDICTED: CBL-interacting serine/threonine-...    185   7e-52   
ref|XP_007138415.1|  hypothetical protein PHAVU_009G206900g             184   1e-51   Phaseolus vulgaris [French bean]
dbj|BAG06678.1|  protein kinase                                         184   2e-51   Phaseolus vulgaris [French bean]
ref|XP_010525811.1|  PREDICTED: CBL-interacting serine/threonine-...    184   2e-51   Tarenaya hassleriana [spider flower]
gb|ABI14664.1|  CBL-interacting protein kinase                          177   2e-51   Aegiceras corniculatum
ref|XP_003610339.1|  CBL-interacting protein kinase                     184   2e-51   Medicago truncatula
ref|XP_003533886.1|  PREDICTED: CBL-interacting serine/threonine-...    184   3e-51   Glycine max [soybeans]
gb|ACJ84672.1|  unknown                                                 182   6e-51   Medicago truncatula
ref|XP_008799653.1|  PREDICTED: CBL-interacting protein kinase 6        182   2e-50   Phoenix dactylifera
ref|XP_008782631.1|  PREDICTED: CBL-interacting protein kinase 18...    181   2e-50   Phoenix dactylifera
ref|XP_010655007.1|  PREDICTED: CBL-interacting protein kinase 02...    180   2e-50   
ref|NP_001268174.1|  CBL-interacting protein kinase 02                  180   3e-50   Vitis vinifera
emb|CAN67244.1|  hypothetical protein VITISV_015398                     180   4e-50   Vitis vinifera
ref|XP_010921114.1|  PREDICTED: CBL-interacting protein kinase 18...    181   5e-50   Elaeis guineensis
emb|CDO96812.1|  unnamed protein product                                181   6e-50   Coffea canephora [robusta coffee]
ref|XP_006449516.1|  hypothetical protein CICLE_v10015231mg             180   9e-50   Citrus clementina [clementine]
ref|XP_006468199.1|  PREDICTED: CBL-interacting serine/threonine-...    180   1e-49   Citrus sinensis [apfelsine]
ref|XP_004302573.1|  PREDICTED: CBL-interacting protein kinase 2-...    180   1e-49   Fragaria vesca subsp. vesca
gb|KDO77875.1|  hypothetical protein CISIN_1g037702mg                   179   1e-49   Citrus sinensis [apfelsine]
ref|XP_009800912.1|  PREDICTED: CBL-interacting protein kinase 5        180   1e-49   Nicotiana sylvestris
ref|XP_010912157.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    178   3e-49   
ref|XP_008808322.1|  PREDICTED: CBL-interacting protein kinase 18...    178   4e-49   Phoenix dactylifera
ref|XP_009616687.1|  PREDICTED: CBL-interacting protein kinase 5        178   4e-49   Nicotiana tomentosiformis
ref|XP_010937988.1|  PREDICTED: CBL-interacting protein kinase 18...    178   4e-49   Elaeis guineensis
gb|AFW90522.1|  CBL-interacting serine/threonine-protein kinase 6...    177   5e-49   Phaseolus vulgaris [French bean]
ref|XP_006830261.1|  PREDICTED: CBL-interacting protein kinase 5        178   5e-49   Amborella trichopoda
ref|XP_010942099.1|  PREDICTED: CBL-interacting protein kinase 6        177   5e-49   
ref|NP_001147901.1|  CBL-interacting serine/threonine-protein kin...    178   6e-49   Zea mays [maize]
ref|XP_004962439.1|  PREDICTED: CBL-interacting protein kinase 18...    176   1e-48   
gb|AEW07563.1|  hypothetical protein 0_5117_01                          168   1e-48   Pinus radiata
ref|XP_004295578.2|  PREDICTED: CBL-interacting serine/threonine-...    177   1e-48   Fragaria vesca subsp. vesca
gb|EMT16422.1|  CBL-interacting protein kinase 2                        177   1e-48   
gb|EMS54742.1|  CBL-interacting protein kinase 2                        177   1e-48   Triticum urartu
ref|XP_006643890.1|  PREDICTED: CBL-interacting protein kinase 5-...    177   1e-48   Oryza brachyantha
gb|AJR22379.1|  CBL-interacting protein kinase 2                        177   1e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011623073.1|  PREDICTED: CBL-interacting protein kinase 5        177   2e-48   Amborella trichopoda
gb|AJR22385.1|  CBL-interacting protein kinase 27                       176   2e-48   Triticum aestivum [Canadian hard winter wheat]
gb|AFG53106.1|  hypothetical protein 0_5117_01                          167   2e-48   Pinus taeda
ref|XP_002522223.1|  CBL-interacting serine/threonine-protein kin...    176   3e-48   Ricinus communis
ref|XP_010042675.1|  PREDICTED: CBL-interacting serine/threonine-...    171   3e-48   Eucalyptus grandis [rose gum]
ref|NP_001042345.1|  Os01g0206700                                       176   3e-48   
ref|XP_004962438.1|  PREDICTED: CBL-interacting protein kinase 18...    176   3e-48   Setaria italica
gb|KJB60217.1|  hypothetical protein B456_009G294400                    176   3e-48   Gossypium raimondii
gb|AJR22390.1|  CBL-interacting protein kinase 5                        176   3e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010683541.1|  PREDICTED: CBL-interacting protein kinase 18...    176   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002439570.1|  hypothetical protein SORBIDRAFT_09g013580          175   3e-48   
ref|XP_004234086.1|  PREDICTED: CBL-interacting protein kinase 5-...    176   3e-48   Solanum lycopersicum
ref|XP_004150214.1|  PREDICTED: CBL-interacting protein kinase 5        176   4e-48   Cucumis sativus [cucumbers]
gb|EMT28985.1|  CBL-interacting protein kinase 5                        176   4e-48   
gb|ABK24914.1|  unknown                                                 175   4e-48   Picea sitchensis
ref|XP_009415683.1|  PREDICTED: uncharacterized protein LOC103996486    181   4e-48   
gb|AAD31900.1|AF145482_1  putative serine/threonine protein kinase      176   4e-48   Mesembryanthemum crystallinum
ref|XP_006358155.1|  PREDICTED: CBL-interacting protein kinase 5-...    176   5e-48   Solanum tuberosum [potatoes]
ref|XP_008225305.1|  PREDICTED: CBL-interacting protein kinase 5        176   5e-48   Prunus mume [ume]
ref|XP_007211421.1|  hypothetical protein PRUPE_ppa005365mg             175   5e-48   Prunus persica
ref|XP_009373129.1|  PREDICTED: CBL-interacting protein kinase 2-...    176   6e-48   Pyrus x bretschneideri [bai li]
ref|XP_010252111.1|  PREDICTED: CBL-interacting protein kinase 18...    175   7e-48   Nelumbo nucifera [Indian lotus]
gb|AFG53121.1|  hypothetical protein 0_5117_01                          166   7e-48   Pinus taeda
ref|XP_004958693.1|  PREDICTED: CBL-interacting protein kinase 2-...    173   7e-48   
ref|XP_008783865.1|  PREDICTED: CBL-interacting protein kinase 6-...    174   7e-48   Phoenix dactylifera
gb|EYU41998.1|  hypothetical protein MIMGU_mgv1a006238mg                175   8e-48   Erythranthe guttata [common monkey flower]
ref|XP_003590281.1|  CBL-interacting protein kinase                     171   8e-48   
ref|XP_008803093.1|  PREDICTED: CBL-interacting protein kinase 5 ...    174   9e-48   
dbj|BAJ86283.1|  predicted protein                                      174   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009386828.1|  PREDICTED: CBL-interacting protein kinase 6-...    174   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562454.1|  PREDICTED: CBL-interacting protein kinase 2        174   1e-47   Brachypodium distachyon [annual false brome]
gb|AIZ68214.1|  CBL-interacting protein kinase 18-like protein          175   1e-47   Ornithogalum longebracteatum [sea-onion]
ref|XP_004233056.1|  PREDICTED: CBL-interacting serine/threonine-...    174   1e-47   Solanum lycopersicum
emb|CDM82235.1|  unnamed protein product                                174   2e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008801610.1|  PREDICTED: CBL-interacting protein kinase 5 ...    174   2e-47   
ref|XP_008443358.1|  PREDICTED: CBL-interacting serine/threonine-...    174   2e-47   Cucumis melo [Oriental melon]
ref|XP_008802343.1|  PREDICTED: CBL-interacting protein kinase 5 ...    174   2e-47   
ref|NP_001268154.1|  CBL-interacting protein kinase 07                  174   2e-47   Vitis vinifera
ref|XP_011095114.1|  PREDICTED: CBL-interacting protein kinase 2        174   2e-47   Sesamum indicum [beniseed]
dbj|BAK07613.1|  predicted protein                                      174   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008374611.1|  PREDICTED: CBL-interacting protein kinase 2-...    173   2e-47   
ref|XP_008789399.1|  PREDICTED: CBL-interacting protein kinase 5-...    175   2e-47   
ref|XP_011085980.1|  PREDICTED: CBL-interacting serine/threonine-...    174   2e-47   Sesamum indicum [beniseed]
ref|XP_004958692.1|  PREDICTED: CBL-interacting protein kinase 2-...    173   3e-47   Setaria italica
gb|AFK39318.1|  unknown                                                 173   3e-47   Lotus japonicus
ref|XP_010092195.1|  CBL-interacting serine/threonine-protein kin...    173   3e-47   Morus notabilis
gb|AGK91199.1|  CIPK2                                                   173   3e-47   Brachypodium distachyon [annual false brome]
ref|XP_012078353.1|  PREDICTED: CBL-interacting serine/threonine-...    173   3e-47   Jatropha curcas
gb|AET80728.1|  calcineurin B-like-interacting protein kinase           173   3e-47   Hordeum brevisubulatum
ref|XP_008233852.1|  PREDICTED: CBL-interacting protein kinase 18...    173   4e-47   Prunus mume [ume]
gb|ADE76223.1|  unknown                                                 172   4e-47   Picea sitchensis
ref|XP_007218015.1|  hypothetical protein PRUPE_ppa005839mg             172   4e-47   Prunus persica
ref|XP_007205114.1|  hypothetical protein PRUPE_ppa004815mg             173   5e-47   Prunus persica
ref|XP_008245119.1|  PREDICTED: CBL-interacting protein kinase 2        174   5e-47   Prunus mume [ume]
ref|XP_006658129.1|  PREDICTED: CBL-interacting protein kinase 2-...    172   5e-47   Oryza brachyantha
ref|XP_010686216.1|  PREDICTED: CBL-interacting protein kinase 5        173   5e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001060636.1|  Os07g0678600                                       172   6e-47   
gb|KHN07024.1|  CBL-interacting serine/threonine-protein kinase 25      167   6e-47   Glycine soja [wild soybean]
ref|XP_007011240.1|  CBL-interacting protein kinase 10                  172   7e-47   
ref|XP_010276975.1|  PREDICTED: CBL-interacting protein kinase 5-...    172   7e-47   Nelumbo nucifera [Indian lotus]
ref|NP_001267894.1|  CBL-interacting protein kinase 16                  172   8e-47   Vitis vinifera
ref|XP_009371993.1|  PREDICTED: CBL-interacting protein kinase 2        172   8e-47   Pyrus x bretschneideri [bai li]
ref|XP_002454972.1|  hypothetical protein SORBIDRAFT_03g002340          172   8e-47   Sorghum bicolor [broomcorn]
ref|XP_003636793.1|  CBL-interacting protein kinase                     172   9e-47   
ref|XP_008383618.1|  PREDICTED: CBL-interacting serine/threonine-...    172   9e-47   
gb|EYU43341.1|  hypothetical protein MIMGU_mgv1a006048mg                172   9e-47   Erythranthe guttata [common monkey flower]
ref|XP_009350943.1|  PREDICTED: CBL-interacting protein kinase 5-...    172   9e-47   Pyrus x bretschneideri [bai li]
ref|XP_009403856.1|  PREDICTED: CBL-interacting protein kinase 18...    172   9e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387685.1|  PREDICTED: CBL-interacting protein kinase 18...    172   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012091789.1|  PREDICTED: CBL-interacting serine/threonine-...    172   1e-46   Jatropha curcas
gb|KDP33521.1|  hypothetical protein JCGZ_07092                         165   1e-46   Jatropha curcas
ref|XP_008370241.1|  PREDICTED: CBL-interacting protein kinase 2        172   1e-46   
ref|XP_009352756.1|  PREDICTED: CBL-interacting serine/threonine-...    172   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_008371484.1|  PREDICTED: LOW QUALITY PROTEIN: CBL-interact...    172   1e-46   
ref|XP_010922709.1|  PREDICTED: CBL-interacting protein kinase 18...    171   1e-46   Elaeis guineensis
ref|XP_010231608.1|  PREDICTED: CBL-interacting protein kinase 5-...    172   1e-46   Brachypodium distachyon [annual false brome]
ref|XP_009414263.1|  PREDICTED: CBL-interacting protein kinase 18       171   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO41575.1|  hypothetical protein CISIN_1g015005mg                   171   1e-46   Citrus sinensis [apfelsine]
ref|XP_010253153.1|  PREDICTED: CBL-interacting protein kinase 18       171   2e-46   
gb|AGW15605.1|  CBL-interacting protein kinase                          171   2e-46   Populus tomentosa [Chinese white poplar]
ref|XP_010089697.1|  CBL-interacting protein kinase 5                   171   2e-46   
ref|XP_003565293.1|  PREDICTED: CBL-interacting protein kinase 5        171   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_008383619.1|  PREDICTED: CBL-interacting serine/threonine-...    171   2e-46   
ref|XP_006427620.1|  hypothetical protein CICLE_v10025649mg             171   2e-46   Citrus clementina [clementine]
ref|XP_009784196.1|  PREDICTED: CBL-interacting protein kinase 2-...    171   2e-46   Nicotiana sylvestris
ref|XP_008388328.1|  PREDICTED: CBL-interacting protein kinase 2-...    171   2e-46   
gb|AFW98257.1|  calcineurin B-like-interacting protein kinase           171   2e-46   Hordeum brevisubulatum
ref|XP_008810573.1|  PREDICTED: CBL-interacting protein kinase 18       171   3e-46   Phoenix dactylifera
ref|XP_009352757.1|  PREDICTED: CBL-interacting serine/threonine-...    171   3e-46   Pyrus x bretschneideri [bai li]
ref|NP_001055223.1|  Os05g0332300                                       171   3e-46   
gb|ACQ83494.1|  CBL-interacting protein kinase 25                       171   3e-46   Sorghum bicolor [broomcorn]
gb|EAY97566.1|  hypothetical protein OsI_19494                          171   3e-46   Oryza sativa Indica Group [Indian rice]
emb|CDP04063.1|  unnamed protein product                                171   3e-46   Coffea canephora [robusta coffee]
ref|XP_002863452.1|  cbl-interacting protein kinase 20                  170   3e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_003526181.1|  PREDICTED: CBL-interacting serine/threonine-...    170   3e-46   Glycine max [soybeans]
ref|XP_004485907.1|  PREDICTED: CBL-interacting serine/threonine-...    170   3e-46   
gb|AGQ43462.1|  CBL-interacting protein kinase 2                        170   4e-46   Nitraria tangutorum
ref|XP_007148034.1|  hypothetical protein PHAVU_006G174900g             170   4e-46   Phaseolus vulgaris [French bean]
ref|XP_008653467.1|  PREDICTED: CBL-interacting protein kinase 2        170   4e-46   Zea mays [maize]
ref|XP_007136949.1|  hypothetical protein PHAVU_009G087500g             170   4e-46   Phaseolus vulgaris [French bean]
gb|AHA84184.1|  CBL-interacting serine/threonine-protein kinase 25      170   4e-46   Phaseolus vulgaris [French bean]
ref|XP_006429548.1|  hypothetical protein CICLE_v10011650mg             170   5e-46   Citrus clementina [clementine]
ref|XP_006654265.1|  PREDICTED: CBL-interacting protein kinase 18...    170   5e-46   Oryza brachyantha
gb|KDO49657.1|  hypothetical protein CISIN_1g012046mg                   170   5e-46   Citrus sinensis [apfelsine]
ref|XP_009126755.1|  PREDICTED: CBL-interacting serine/threonine-...    170   5e-46   Brassica rapa
gb|KHN14263.1|  CBL-interacting protein kinase 18                       168   5e-46   Glycine soja [wild soybean]
gb|EMS57676.1|  CBL-interacting protein kinase 5                        170   5e-46   Triticum urartu
ref|XP_002323059.2|  calcineurin B-like-interacting protein kinase      170   7e-46   Populus trichocarpa [western balsam poplar]
gb|KFK31507.1|  hypothetical protein AALP_AA6G121600                    169   7e-46   Arabis alpina [alpine rockcress]
ref|XP_008345915.1|  PREDICTED: CBL-interacting protein kinase 5-...    170   7e-46   
ref|XP_010441665.1|  PREDICTED: CBL-interacting serine/threonine-...    169   7e-46   Camelina sativa [gold-of-pleasure]
ref|NP_001149741.1|  LOC100283368                                       169   8e-46   
ref|XP_007025354.1|  CBL-interacting protein kinase 20                  170   8e-46   
gb|ACF78341.1|  unknown                                                 169   8e-46   Zea mays [maize]
ref|NP_001105966.1|  putative protein kinase                            169   8e-46   
gb|ABC67804.1|  protein kinase SRK                                      170   9e-46   Nicotiana tabacum [American tobacco]
ref|XP_008350054.1|  PREDICTED: CBL-interacting serine/threonine-...    169   9e-46   
gb|KEH23254.1|  CBL-interacting kinase                                  169   1e-45   Medicago truncatula
emb|CDY32704.1|  BnaA02g07660D                                          169   1e-45   Brassica napus [oilseed rape]
ref|XP_011658253.1|  PREDICTED: CBL-interacting serine/threonine-...    169   1e-45   Cucumis sativus [cucumbers]
ref|XP_008439731.1|  PREDICTED: CBL-interacting serine/threonine-...    169   1e-45   Cucumis melo [Oriental melon]
ref|XP_010481526.1|  PREDICTED: CBL-interacting serine/threonine-...    169   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006650055.1|  PREDICTED: CBL-interacting protein kinase 10...    169   1e-45   Oryza brachyantha
ref|XP_009347309.1|  PREDICTED: CBL-interacting serine/threonine-...    168   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_003517006.1|  PREDICTED: CBL-interacting protein kinase 2-...    169   2e-45   Glycine max [soybeans]
ref|XP_009629516.1|  PREDICTED: CBL-interacting protein kinase 2-...    169   2e-45   Nicotiana tomentosiformis
ref|XP_003557957.1|  PREDICTED: CBL-interacting protein kinase 10...    168   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_007033570.1|  SOS3-interacting protein 1 isoform 1               169   2e-45   
ref|XP_009128822.1|  PREDICTED: CBL-interacting serine/threonine-...    168   2e-45   Brassica rapa
ref|XP_009616688.1|  PREDICTED: CBL-interacting serine/threonine-...    169   2e-45   Nicotiana tomentosiformis
ref|XP_009602782.1|  PREDICTED: CBL-interacting protein kinase 2-...    169   2e-45   Nicotiana tomentosiformis
gb|AGT16994.1|  CBL-interacting protein kinase                          168   2e-45   Saccharum hybrid cultivar R570
ref|XP_004984448.1|  PREDICTED: CBL-interacting protein kinase 10...    167   2e-45   
gb|KJB73033.1|  hypothetical protein B456_011G210500                    168   2e-45   Gossypium raimondii
ref|XP_003590290.1|  CBL-interacting protein kinase                     162   2e-45   
ref|XP_006279541.1|  hypothetical protein CARUB_v10028407mg             168   2e-45   Capsella rubella
ref|XP_004492544.1|  PREDICTED: CBL-interacting protein kinase 18...    168   2e-45   Cicer arietinum [garbanzo]
emb|CDY26359.1|  BnaA02g24110D                                          168   2e-45   Brassica napus [oilseed rape]
ref|XP_004240423.1|  PREDICTED: CBL-interacting protein kinase 2-...    169   2e-45   Solanum lycopersicum
ref|XP_004233044.1|  PREDICTED: CBL-interacting serine/threonine-...    168   3e-45   Solanum lycopersicum
ref|XP_012091176.1|  PREDICTED: CBL-interacting protein kinase 18...    168   3e-45   Jatropha curcas
ref|XP_010529202.1|  PREDICTED: CBL-interacting serine/threonine-...    168   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_008792201.1|  PREDICTED: CBL-interacting protein kinase 18...    168   3e-45   Phoenix dactylifera
emb|CBI38936.3|  unnamed protein product                                167   3e-45   Vitis vinifera
ref|XP_002520844.1|  CBL-interacting serine/threonine-protein kin...    168   3e-45   Ricinus communis
gb|EPS69417.1|  serine-threonine kinase                                 168   3e-45   Genlisea aurea
ref|XP_002317414.1|  CBL-interacting protein kinase 20                  168   3e-45   
ref|XP_009409392.1|  PREDICTED: CBL-interacting protein kinase 5-...    168   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009800911.1|  PREDICTED: CBL-interacting serine/threonine-...    168   3e-45   Nicotiana sylvestris
gb|KJB66823.1|  hypothetical protein B456_010G159800                    167   3e-45   Gossypium raimondii
ref|XP_002517716.1|  CBL-interacting serine/threonine-protein kin...    168   3e-45   Ricinus communis
gb|ACA65278.1|  serine-threonine kinase                                 167   4e-45   Persea americana
ref|XP_010931340.1|  PREDICTED: CBL-interacting protein kinase 18...    167   4e-45   Elaeis guineensis
ref|XP_006450294.1|  hypothetical protein CICLE_v10008225mg             167   4e-45   Citrus clementina [clementine]
gb|ABY58263.1|  serine-threonine kinase                                 167   4e-45   Persea americana
ref|XP_009781174.1|  PREDICTED: CBL-interacting protein kinase 2-...    167   4e-45   Nicotiana sylvestris
ref|XP_006358129.1|  PREDICTED: CBL-interacting serine/threonine-...    168   4e-45   Solanum tuberosum [potatoes]
ref|XP_002273178.1|  PREDICTED: CBL-interacting serine/threonine-...    167   4e-45   Vitis vinifera
ref|XP_010265621.1|  PREDICTED: CBL-interacting serine/threonine-...    167   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_009120348.1|  PREDICTED: CBL-interacting serine/threonine-...    167   4e-45   Brassica rapa
gb|AGA37199.1|  CBL-interacting protein kinase 10.1                     167   4e-45   Brassica napus [oilseed rape]
ref|XP_012076439.1|  PREDICTED: CBL-interacting serine/threonine-...    167   5e-45   Jatropha curcas
ref|XP_011016483.1|  PREDICTED: CBL-interacting serine/threonine-...    163   5e-45   Populus euphratica
ref|XP_002319966.2|  calcineurin B-like-interacting protein kinase      167   5e-45   
gb|ACA65274.1|  serine-threonine kinase                                 167   5e-45   Persea americana
ref|XP_009380788.1|  PREDICTED: CBL-interacting protein kinase 6-...    167   5e-45   
gb|EMS48892.1|  CBL-interacting protein kinase 10                       167   5e-45   
ref|XP_004149923.1|  PREDICTED: CBL-interacting protein kinase 2        167   5e-45   
ref|XP_008464264.1|  PREDICTED: CBL-interacting protein kinase 2        167   5e-45   
emb|CDY43857.1|  BnaC09g33860D                                          167   5e-45   
ref|NP_199394.1|  CBL-interacting serine/threonine-protein kinase 20    167   5e-45   
gb|KJB34898.1|  hypothetical protein B456_006G089200                    168   5e-45   
emb|CDY70046.1|  BnaA10g29660D                                          167   5e-45   
emb|CDO98225.1|  unnamed protein product                                167   5e-45   
ref|XP_010920246.1|  PREDICTED: CBL-interacting protein kinase 5        167   5e-45   
ref|XP_002527299.1|  CBL-interacting serine/threonine-protein kin...    167   5e-45   
gb|ABJ91229.1|  CBL-interacting protein kinase 23                       167   6e-45   
ref|XP_007223290.1|  hypothetical protein PRUPE_ppa005575mg             167   6e-45   
ref|XP_012089703.1|  PREDICTED: CBL-interacting protein kinase 2        167   6e-45   
gb|KJB67924.1|  hypothetical protein B456_010G218000                    167   6e-45   
ref|XP_002304724.2|  hypothetical protein POPTR_0003s18030g             167   6e-45   
ref|XP_004984447.1|  PREDICTED: CBL-interacting protein kinase 10...    167   6e-45   
emb|CDY02816.1|  BnaC02g10730D                                          167   6e-45   
ref|XP_007011728.1|  CBL-interacting protein kinase 25                  167   6e-45   
ref|XP_010108499.1|  CBL-interacting serine/threonine-protein kin...    167   6e-45   
ref|XP_008220684.1|  PREDICTED: CBL-interacting serine/threonine-...    167   6e-45   
ref|XP_002515434.1|  CBL-interacting serine/threonine-protein kin...    167   6e-45   
ref|XP_010925625.1|  PREDICTED: CBL-interacting protein kinase 5-...    167   6e-45   
ref|XP_010494733.1|  PREDICTED: CBL-interacting serine/threonine-...    167   6e-45   
gb|KHG28276.1|  CBL-interacting protein kinase 2                        166   7e-45   
ref|XP_007134686.1|  hypothetical protein PHAVU_010G067600g             167   7e-45   
ref|XP_002308703.2|  CBL-interacting protein kinase 25                  167   7e-45   
gb|ABJ91234.1|  CBL-interacting protein kinase 6                        167   7e-45   
emb|CBI18060.3|  unnamed protein product                                166   7e-45   
ref|XP_011039423.1|  PREDICTED: CBL-interacting serine/threonine-...    167   7e-45   
gb|KHN06402.1|  CBL-interacting serine/threonine-protein kinase 12      168   7e-45   
ref|XP_010087068.1|  CBL-interacting protein kinase 2                   167   8e-45   
gb|KJB68375.1|  hypothetical protein B456_010G241700                    167   8e-45   
ref|XP_009151037.1|  PREDICTED: CBL-interacting serine/threonine-...    167   8e-45   
gb|KHG11871.1|  CBL-interacting protein kinase 2                        167   8e-45   
ref|XP_011003598.1|  PREDICTED: CBL-interacting protein kinase 2-...    167   8e-45   
ref|XP_011008766.1|  PREDICTED: CBL-interacting protein kinase 2-...    167   8e-45   
ref|NP_001267932.1|  CBL-interacting protein kinase 01                  167   9e-45   
gb|KDO59402.1|  hypothetical protein CISIN_1g013522mg                   166   9e-45   
gb|ACN28948.1|  unknown                                                 167   9e-45   
gb|AGG35952.1|  CBL-interacting protein kinase 25                       167   9e-45   
emb|CDY69661.1|  BnaA06g39390D                                          167   9e-45   
gb|ACG42973.1|  CBL-interacting serine/threonine-protein kinase 11      167   9e-45   
gb|ABY58264.1|  serine-threonine kinase                                 166   9e-45   
ref|XP_006399186.1|  hypothetical protein EUTSA_v10013492mg             166   1e-44   
ref|NP_001104940.1|  protein kinase4                                    167   1e-44   
ref|XP_006344078.1|  PREDICTED: CBL-interacting serine/threonine-...    167   1e-44   
gb|ABY58262.1|  serine-threonine kinase                                 166   1e-44   
gb|ABY58274.1|  serine-threonine kinase                                 166   1e-44   
ref|XP_006483468.1|  PREDICTED: CBL-interacting serine/threonine-...    166   1e-44   
gb|ABY58257.1|  serine-threonine kinase                                 166   1e-44   
ref|NP_001268196.1|  CBL-interacting protein kinase 11                  166   1e-44   
gb|ABY58284.1|  serine-threonine kinase                                 166   1e-44   
gb|ABY58256.1|  serine-threonine kinase                                 166   1e-44   
gb|ACA65275.1|  serine-threonine kinase                                 166   1e-44   
gb|ABK25045.1|  unknown                                                 166   1e-44   
gb|KJB27704.1|  hypothetical protein B456_005G005600                    166   1e-44   
ref|NP_001050062.1|  Os03g0339900                                       166   1e-44   
ref|XP_006449517.1|  hypothetical protein CICLE_v10015080mg             167   1e-44   
ref|XP_002441260.1|  hypothetical protein SORBIDRAFT_09g023365          166   1e-44   
gb|EEC75223.1|  hypothetical protein OsI_11492                          166   1e-44   
ref|XP_010091068.1|  CBL-interacting protein kinase 2                   166   1e-44   
gb|KJB65906.1|  hypothetical protein B456_010G118500                    166   1e-44   
gb|ABY58272.1|  serine-threonine kinase                                 166   1e-44   
gb|KJB69725.1|  hypothetical protein B456_011G038800                    166   1e-44   
gb|AFW78701.1|  putative CBL-interacting protein kinase family pr...    164   1e-44   
gb|EYU28098.1|  hypothetical protein MIMGU_mgv1a005690mg                166   1e-44   
gb|AAT64036.1|  putative serine-threonine kinase                        166   1e-44   
emb|CDX78885.1|  BnaA01g09520D                                          166   1e-44   
gb|ACN76472.1|  CBL-interacting protein kinase 22                       166   1e-44   
ref|XP_004485906.1|  PREDICTED: CBL-interacting serine/threonine-...    166   2e-44   
gb|ACD56654.1|  putative serine-threonine kinase                        166   2e-44   
ref|XP_011073327.1|  PREDICTED: CBL-interacting serine/threonine-...    166   2e-44   
gb|ACN76470.1|  CBL-interacting protein kinase 19                       167   2e-44   
ref|XP_010650780.1|  PREDICTED: CBL-interacting protein kinase 11...    166   2e-44   
ref|XP_009408033.1|  PREDICTED: CBL-interacting protein kinase 6-...    166   2e-44   
ref|XP_010655436.1|  PREDICTED: CBL-interacting protein kinase 01...    167   2e-44   
ref|XP_011039422.1|  PREDICTED: CBL-interacting serine/threonine-...    167   2e-44   
gb|KHN29521.1|  CBL-interacting protein kinase 18                       166   2e-44   
ref|XP_006594550.1|  PREDICTED: CBL-interacting protein kinase 5-...    166   2e-44   
ref|XP_002326078.2|  CBL-interacting protein kinase 2                   166   2e-44   
gb|EPS74551.1|  hypothetical protein M569_00198                         165   2e-44   
ref|XP_009132122.1|  PREDICTED: CBL-interacting serine/threonine-...    166   2e-44   
gb|EMT15390.1|  CBL-interacting protein kinase 10                       165   2e-44   
gb|ABJ91210.1|  CBL-interacting protein kinase 2                        166   2e-44   
ref|XP_007017047.1|  SOS3-interacting protein 1                         166   2e-44   
ref|XP_006467637.1|  PREDICTED: CBL-interacting serine/threonine-...    166   2e-44   
ref|NP_001267860.1|  CBL-interacting protein kinase 13                  166   3e-44   
ref|XP_003534649.1|  PREDICTED: CBL-interacting protein kinase 18...    166   3e-44   
ref|XP_010685966.1|  PREDICTED: CBL-interacting protein kinase 2        166   3e-44   
gb|ABY58267.1|  serine-threonine kinase                                 165   3e-44   
ref|XP_004498818.1|  PREDICTED: CBL-interacting serine/threonine-...    164   3e-44   
ref|XP_002324326.2|  hypothetical protein POPTR_0018s02460g             165   3e-44   
ref|XP_006435875.1|  hypothetical protein CICLE_v10031522mg             165   3e-44   
ref|NP_001130654.1|  LOC100191755                                       165   3e-44   
ref|XP_003524205.1|  PREDICTED: CBL-interacting serine/threonine-...    166   3e-44   
ref|XP_003552306.1|  PREDICTED: CBL-interacting protein kinase 2-...    165   3e-44   
gb|EYU45678.1|  hypothetical protein MIMGU_mgv1a006057mg                165   3e-44   
gb|KHN40647.1|  CBL-interacting protein kinase 2                        165   3e-44   
ref|XP_006377548.1|  hypothetical protein POPTR_0011s07230g             165   3e-44   
gb|ABY58261.1|  serine-threonine kinase                                 165   3e-44   
gb|ABJ91225.1|  CBL-interacting protein kinase 18                       165   3e-44   
gb|ABY58260.1|  serine-threonine kinase                                 165   3e-44   
gb|ABJ91235.1|  CBL-interacting protein kinase 20                       165   4e-44   
gb|ABY58259.1|  serine-threonine kinase                                 165   4e-44   
ref|XP_011021034.1|  PREDICTED: CBL-interacting serine/threonine-...    165   4e-44   
gb|KHN47998.1|  CBL-interacting serine/threonine-protein kinase 12      166   4e-44   
ref|XP_006585169.1|  PREDICTED: CBL-interacting serine/threonine-...    166   4e-44   
ref|XP_008243460.1|  PREDICTED: CBL-interacting serine/threonine-...    165   4e-44   
ref|XP_002467894.1|  hypothetical protein SORBIDRAFT_01g036020          164   4e-44   
ref|XP_002872993.1|  cbl-interacting protein kinase 15                  164   4e-44   
ref|XP_007207447.1|  hypothetical protein PRUPE_ppa005370mg             165   4e-44   
ref|NP_001146886.1|  LOC100280494                                       164   4e-44   
ref|XP_006287816.1|  hypothetical protein CARUB_v10001030mg             164   4e-44   
gb|AAL23677.1|  Serine/threonine Kinase                                 165   4e-44   
ref|XP_010925623.1|  PREDICTED: CBL-interacting serine/threonine-...    165   4e-44   
ref|NP_001190203.1|  CBL-interacting serine/threonine-protein kin...    163   4e-44   
gb|EEE59029.1|  hypothetical protein OsJ_10776                          166   5e-44   
gb|KDO49766.1|  hypothetical protein CISIN_1g011694mg                   165   5e-44   
ref|XP_002285264.1|  PREDICTED: CBL-interacting serine/threonine-...    164   5e-44   
ref|XP_009406059.1|  PREDICTED: CBL-interacting protein kinase 18...    164   5e-44   
gb|ABY58275.1|  serine-threonine kinase                                 164   5e-44   
gb|KFK25099.1|  hypothetical protein AALP_AA8G066200                    164   5e-44   
ref|XP_004145504.1|  PREDICTED: CBL-interacting serine/threonine-...    164   6e-44   
ref|XP_008243885.1|  PREDICTED: CBL-interacting serine/threonine-...    164   6e-44   
ref|XP_008452858.1|  PREDICTED: CBL-interacting serine/threonine-...    164   6e-44   
ref|XP_011031462.1|  PREDICTED: CBL-interacting serine/threonine-...    164   6e-44   
ref|XP_010034032.1|  PREDICTED: CBL-interacting serine/threonine-...    164   6e-44   
gb|AEN70845.1|  calcineurin B-like protein-interacting protein ki...    164   7e-44   
gb|KJB55077.1|  hypothetical protein B456_009G062200                    164   7e-44   
ref|XP_010669820.1|  PREDICTED: CBL-interacting serine/threonine-...    165   7e-44   
gb|ACQ83531.1|  CBL-interacting protein kinase 15                       164   7e-44   
ref|XP_010048323.1|  PREDICTED: CBL-interacting serine/threonine-...    164   7e-44   
emb|CDP13925.1|  unnamed protein product                                164   7e-44   
ref|XP_008804961.1|  PREDICTED: CBL-interacting serine/threonine-...    164   7e-44   
ref|XP_006431989.1|  hypothetical protein CICLE_v10001000mg             164   8e-44   
gb|ACN76473.1|  CBL-interacting protein kinase 23                       164   8e-44   
ref|XP_009381758.1|  PREDICTED: CBL-interacting protein kinase 5-...    164   8e-44   
ref|XP_009771513.1|  PREDICTED: CBL-interacting protein kinase 2-...    164   8e-44   
ref|XP_011036671.1|  PREDICTED: CBL-interacting serine/threonine-...    164   9e-44   
ref|XP_008378910.1|  PREDICTED: CBL-interacting serine/threonine-...    164   9e-44   
ref|XP_011020610.1|  PREDICTED: CBL-interacting serine/threonine-...    164   9e-44   
ref|XP_008793043.1|  PREDICTED: CBL-interacting protein kinase 19...    164   9e-44   
gb|ACU17637.1|  unknown                                                 161   1e-43   
emb|CDX99438.1|  BnaC01g11140D                                          164   1e-43   
ref|XP_007140104.1|  hypothetical protein PHAVU_008G084600g             164   1e-43   
ref|XP_007159452.1|  hypothetical protein PHAVU_002G238800g             164   1e-43   
ref|NP_001147043.1|  CBL-interacting serine/threonine-protein kin...    164   1e-43   
gb|AGA37201.1|  CBL-interacting protein kinase 12.1                     164   1e-43   
ref|XP_006857200.1|  PREDICTED: CBL-interacting serine/threonine-...    163   1e-43   
ref|XP_006401087.1|  hypothetical protein EUTSA_v10013486mg             164   1e-43   
ref|XP_004149375.1|  PREDICTED: CBL-interacting serine/threonine-...    164   1e-43   
ref|NP_195801.1|  CBL-interacting serine/threonine-protein kinase 15    163   1e-43   
emb|CDY34052.1|  BnaC03g62800D                                          164   1e-43   
ref|XP_009363770.1|  PREDICTED: CBL-interacting serine/threonine-...    163   1e-43   
dbj|BAF00779.1|  serine/threonine protein kinase ATPK10                 163   1e-43   
gb|AEN70844.1|  calcineurin B-like protein-interacting protein ki...    163   1e-43   
ref|XP_006398267.1|  hypothetical protein EUTSA_v10000893mg             163   1e-43   
gb|AEN70863.1|  calcineurin B-like protein-interacting protein ki...    163   1e-43   
ref|XP_003547175.1|  PREDICTED: CBL-interacting serine/threonine-...    164   1e-43   
gb|AAK16692.1|AF302111_1  CBL-interacting protein kinase 15             162   1e-43   
dbj|BAG41961.1|  CBL-interacting protein kinase 1                       163   2e-43   
gb|AEN70846.1|  calcineurin B-like protein-interacting protein ki...    163   2e-43   
ref|XP_002873295.1|  cbl-interacting protein kinase 2                   163   2e-43   
ref|XP_012067501.1|  PREDICTED: CBL-interacting serine/threonine-...    163   2e-43   
ref|XP_012078312.1|  PREDICTED: CBL-interacting serine/threonine-...    162   2e-43   
ref|XP_006394759.1|  hypothetical protein EUTSA_v10004116mg             164   2e-43   
ref|XP_006282326.1|  hypothetical protein CARUB_v10028618mg             164   2e-43   
gb|KCW88301.1|  hypothetical protein EUGRSUZ_A00690                     163   2e-43   
gb|ACJ48972.2|  cold-induced CIPK                                       162   2e-43   
gb|AJR22375.1|  CBL-interacting protein kinase 10                       163   2e-43   
ref|XP_010924598.1|  PREDICTED: CBL-interacting protein kinase 19...    163   2e-43   
ref|XP_008349525.1|  PREDICTED: CBL-interacting serine/threonine-...    163   2e-43   
ref|XP_009608924.1|  PREDICTED: CBL-interacting protein kinase 2-...    164   2e-43   
ref|XP_002522224.1|  CBL-interacting serine/threonine-protein kin...    164   2e-43   
ref|XP_003542982.1|  PREDICTED: CBL-interacting serine/threonine-...    164   2e-43   
ref|XP_006398576.1|  hypothetical protein EUTSA_v10013601mg             162   2e-43   
ref|XP_010549409.1|  PREDICTED: CBL-interacting serine/threonine-...    164   2e-43   
ref|XP_010999751.1|  PREDICTED: CBL-interacting serine/threonine-...    164   2e-43   
ref|XP_002305064.2|  hypothetical protein POPTR_0004s05700g             164   2e-43   
ref|XP_008465300.1|  PREDICTED: CBL-interacting serine/threonine-...    163   2e-43   
ref|XP_010481527.1|  PREDICTED: CBL-interacting serine/threonine-...    163   3e-43   
ref|XP_007205151.1|  hypothetical protein PRUPE_ppa005344mg             163   3e-43   
ref|XP_012091790.1|  PREDICTED: CBL-interacting serine/threonine-...    163   3e-43   
emb|CDY69878.1|  BnaAnng31880D                                          162   3e-43   
gb|KFK25373.1|  hypothetical protein AALP_AA8G104900                    162   3e-43   
ref|XP_007023426.1|  CBL-interacting protein kinase 25                  162   3e-43   
ref|XP_010494732.1|  PREDICTED: CBL-interacting serine/threonine-...    163   3e-43   
ref|XP_011085979.1|  PREDICTED: CBL-interacting serine/threonine-...    162   3e-43   
ref|XP_010441666.1|  PREDICTED: CBL-interacting serine/threonine-...    163   3e-43   
ref|XP_010491305.1|  PREDICTED: CBL-interacting serine/threonine-...    162   3e-43   
gb|AEN70843.1|  calcineurin B-like protein-interacting protein ki...    162   3e-43   
ref|XP_011041811.1|  PREDICTED: CBL-interacting serine/threonine-...    162   3e-43   
ref|XP_010452654.1|  PREDICTED: CBL-interacting serine/threonine-...    162   3e-43   
ref|NP_001148053.1|  CBL-interacting serine/threonine-protein kin...    162   3e-43   
ref|XP_002440068.1|  hypothetical protein SORBIDRAFT_09g025420          163   3e-43   
ref|XP_003588823.1|  CBL-interacting protein kinase                     162   4e-43   
gb|ADY68805.1|  CBL-interacting protein kinase                          162   4e-43   
emb|CDO96813.1|  unnamed protein product                                162   4e-43   
ref|XP_008385004.1|  PREDICTED: CBL-interacting serine/threonine-...    162   4e-43   
ref|XP_006289352.1|  hypothetical protein CARUB_v10002839mg             162   4e-43   
gb|AEN70859.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|AEN70858.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|AEN70857.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|AEN70854.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|AEN70866.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|AEN70852.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|AEN70848.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|AEN70861.1|  calcineurin B-like protein-interacting protein ki...    162   4e-43   
gb|ADY68803.1|  CBL-interacting protein kinase                          162   4e-43   
gb|ADY68802.1|  CBL-interacting protein kinase                          162   4e-43   
ref|XP_009793885.1|  PREDICTED: CBL-interacting serine/threonine-...    162   4e-43   
ref|XP_002444418.1|  hypothetical protein SORBIDRAFT_07g021660          162   4e-43   
ref|XP_010419646.1|  PREDICTED: CBL-interacting serine/threonine-...    162   4e-43   
ref|XP_011076604.1|  PREDICTED: CBL-interacting protein kinase 2-...    162   4e-43   
gb|ADY68807.1|  CBL-interacting protein kinase                          162   4e-43   
gb|ADY68804.1|  CBL-interacting protein kinase                          162   4e-43   
gb|AEN70853.1|  calcineurin B-like protein-interacting protein ki...    162   5e-43   
ref|XP_004241680.1|  PREDICTED: CBL-interacting serine/threonine-...    162   5e-43   
gb|AEN70864.1|  calcineurin B-like protein-interacting protein ki...    162   5e-43   
gb|ABP35583.1|  CBL-interacting protein kinase                          162   5e-43   



>ref|XP_011083993.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Sesamum indicum]
Length=423

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M +EEKC VLHGKYELGR LGHGTFAKVYHARN+ T KS AMKVVGK KV++ GMMEQ+K
Sbjct  1    MGSEEKCGVLHGKYELGRILGHGTFAKVYHARNLQTNKSVAMKVVGKEKVIRVGMMEQVK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MV H NIVEL+EVMASKTKIYFAME VRGGELFAKI+KGRLREE ARNYFQQL
Sbjct  61   REISVMKMVHHPNIVELHEVMASKTKIYFAMEFVRGGELFAKIAKGRLREEPARNYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  121  ISAIDFCHSRGVYHRD  136



>ref|XP_011079428.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Sesamum indicum]
Length=433

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MAAEEKC VLHGKYELGR LGHGTFAKVYHARN+ TGKS AMK+VGK KV++ GMMEQ+K
Sbjct  3    MAAEEKCGVLHGKYELGRILGHGTFAKVYHARNLQTGKSVAMKIVGKEKVIRVGMMEQVK  62

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM M+ H NIVEL+EVMASKTKIYFAME VRGGELFAKI+KGRLRE+ ARNYFQQL
Sbjct  63   REISVMKMMHHPNIVELHEVMASKTKIYFAMEFVRGGELFAKIAKGRLREDAARNYFQQL  122

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  123  ISAIDFCHSRGVYHRD  138



>emb|CDP10216.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M +EEKC VL GKYELGR LGHGTFAKVY +RN+ TGKS AMKVVGK KV+K GMMEQIK
Sbjct  1    MGSEEKCGVLRGKYELGRLLGHGTFAKVYMSRNLQTGKSVAMKVVGKEKVIKVGMMEQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVKH NIV+L+EV+ASKTKIYFAMEL+RGGELFAKI+KGRLREE+ARNYFQQL
Sbjct  61   REISVMKMVKHPNIVDLHEVLASKTKIYFAMELIRGGELFAKIAKGRLREEVARNYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            +SA+DFCHSRGVYHRD
Sbjct  121  MSAIDFCHSRGVYHRD  136



>ref|XP_009790292.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Nicotiana sylvestris]
Length=432

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA EEKC  L+GKYELGR LGHGTFAKVYHARNV  GKS AMKVVGK KV+K GMM+QIK
Sbjct  1    MAPEEKCMALYGKYELGRLLGHGTFAKVYHARNVQNGKSVAMKVVGKEKVIKVGMMDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVKH NIVEL EVMASKTKIYFAME V+GGELFAKI+KGRLRE++AR YFQQL
Sbjct  61   REISVMKMVKHPNIVELNEVMASKTKIYFAMEFVKGGELFAKIAKGRLREDVARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  121  ISAIDFCHSRGVYHRD  136



>ref|XP_009596060.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Nicotiana tomentosiformis]
Length=432

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA EEKC  L+GKYELGR LGHGTFAKVYHARNV  GKS AMKVVGK KV+K GMM+QIK
Sbjct  1    MAPEEKCMALYGKYELGRLLGHGTFAKVYHARNVQNGKSVAMKVVGKEKVIKVGMMDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REIS+M MVKH NIVEL EVMASKTKIYFAME V+GGELFAKI+KGRLRE++AR YFQQL
Sbjct  61   REISIMKMVKHPNIVELNEVMASKTKIYFAMEFVKGGELFAKIAKGRLREDVARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  121  ISAIDFCHSRGVYHRD  136



>ref|XP_006343663.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Solanum tuberosum]
Length=424

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA EEKC  L+GKYELGR LGHGTFAKVYHARNV  GK+ AMKVVGK KV+K GMM+QIK
Sbjct  1    MAPEEKCGALNGKYELGRLLGHGTFAKVYHARNVQNGKNVAMKVVGKEKVIKVGMMDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVK+ NIVEL+EVMASKTKIYFAME VRGGELFAKI+KG+LRE++AR YFQQL
Sbjct  61   REISVMKMVKNPNIVELHEVMASKTKIYFAMEFVRGGELFAKIAKGKLREDVARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGV+HRD
Sbjct  121  ISAIDFCHSRGVFHRD  136



>gb|EYU31774.1| hypothetical protein MIMGU_mgv1a006747mg [Erythranthe guttata]
Length=433

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA++EK   LHGKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV++ GMMEQ+K
Sbjct  3    MASDEKSGALHGKYELGRVLGHGTFAKVYHARNLQTGKSVAMKVVGKEKVIQVGMMEQVK  62

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM M+ H NIVEL+EVMASK+KIYFAME VRGGELFAKI+KGRLREE ARNYFQQL
Sbjct  63   REISVMKMMHHPNIVELHEVMASKSKIYFAMEYVRGGELFAKIAKGRLREEPARNYFQQL  122

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  123  ISAIDFCHSRGVYHRD  138



>emb|CDY13400.1| BnaA03g51180D [Brassica napus]
Length=405

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            S+  A     +LHG+YELGR LGHGTFAKVYHARNV TGKS A+KVV K KV+K GM EQ
Sbjct  8    SDGGANTSTGLLHGRYELGRLLGHGTFAKVYHARNVTTGKSVALKVVAKEKVIKGGMEEQ  67

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE+ AR YFQ
Sbjct  68   IKREISVMKMVKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDAARVYFQ  127

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCHSRGVYHRD
Sbjct  128  QLISAVDFCHSRGVYHRD  145



>ref|XP_009108957.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Brassica rapa]
Length=432

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVV K KV+K GM+EQIKREISVMSM
Sbjct  19   LLHGRYELGRLLGHGTFAKVYHARNVTTGKSMAMKVVAKEKVIKVGMVEQIKREISVMSM  78

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELFAKISKGRLRE++AR YFQQLISAVDFCH
Sbjct  79   VKHPNIVELHEVMASKSKIYFAMELVRGGELFAKISKGRLREDVARVYFQQLISAVDFCH  138

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  139  SRGVYHRD  146



>ref|XP_009137980.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Brassica rapa]
 gb|AGA37209.1| CBL-interacting protein kinase 6.1 [Brassica napus]
Length=437

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            S+  A     +LHG+YELGR LGHGTFAKVYHARNV TGKS A+KVV K KV+K GM EQ
Sbjct  15   SDGGANTSTGLLHGRYELGRLLGHGTFAKVYHARNVTTGKSVALKVVAKEKVIKGGMEEQ  74

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE+ AR YFQ
Sbjct  75   IKREISVMKMVKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDAARVYFQ  134

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCHSRGVYHRD
Sbjct  135  QLISAVDFCHSRGVYHRD  152



>ref|XP_004242581.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Solanum lycopersicum]
Length=424

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA EEKC  L+GKYELGR LGHGTFAKVYHARNV  GK+ AMKVVGK KV+K GMM+QIK
Sbjct  1    MAPEEKCGALNGKYELGRLLGHGTFAKVYHARNVKNGKNVAMKVVGKEKVIKVGMMDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVK+ NIVEL+EVMASKTKIYFAME V+GGELFAKI+KG++RE++AR YFQQL
Sbjct  61   REISVMKMVKNPNIVELHEVMASKTKIYFAMEFVKGGELFAKIAKGKVREDVARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGV+HRD
Sbjct  121  ISAIDFCHSRGVFHRD  136



>ref|XP_010275776.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Nelumbo nucifera]
Length=435

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            ++ SVLHGKYELGRFLGHGTFAKVYHARN+ TGKS AMKVVGK KV+K GMMEQ+KREI+
Sbjct  8    DQTSVLHGKYELGRFLGHGTFAKVYHARNLQTGKSVAMKVVGKEKVIKVGMMEQVKREIA  67

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+K++KGRL+E++AR YFQQLISAV
Sbjct  68   VMKMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKVAKGRLKEDVARAYFQQLISAV  127

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  128  DFCHSRGVYHRD  139



>emb|CBI41032.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +2

Query  311  AAEEKC-SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            + ++ C S+LHGKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV+K GM EQ+K
Sbjct  4    SGKDSCPSLLHGKYELGRLLGHGTFAKVYHARNLQTGKSVAMKVVGKDKVIKVGMTEQVK  63

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MV+H NIVEL+EVMASK+KIYFAMELVRGGELF+KISKGRLRE++AR YFQQL
Sbjct  64   REISVMKMVQHPNIVELHEVMASKSKIYFAMELVRGGELFSKISKGRLREDVARVYFQQL  123

Query  668  ISAVDFCHSRGVYHRD  715
            ISAVDFCHSRGVYHRD
Sbjct  124  ISAVDFCHSRGVYHRD  139



>ref|XP_008443868.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Cucumis melo]
Length=430

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            VLHGKYELGR LGHGTFAKVYHARN+ TG S AMKVVGK KV+K GMMEQIKREISVM M
Sbjct  12   VLHGKYELGRLLGHGTFAKVYHARNLQTGTSMAMKVVGKEKVIKVGMMEQIKREISVMKM  71

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELF+KISKGRLRE++AR YFQQLISA+DFCH
Sbjct  72   VKHPNIVELHEVMASKSKIYFAMELVRGGELFSKISKGRLREDVARVYFQQLISAIDFCH  131

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  132  SRGVYHRD  139



>ref|XP_009127378.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Brassica rapa]
Length=441

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +2

Query  293  KLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagm  472
             +E+E        +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM
Sbjct  6    PIENESDGGASTGLLHGRYELGRLLGHGTFAKVYHARNVTTGKSVAMKVVGKEKVVKVGM  65

Query  473  mEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARN  652
            ++QIKREISVM MVKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE++AR 
Sbjct  66   VDQIKREISVMRMVKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDVARV  125

Query  653  YFQQLISAVDFCHSRGVYHRD  715
            YFQQLISAVDFCHSRGVYHRD
Sbjct  126  YFQQLISAVDFCHSRGVYHRD  146



>ref|NP_001268212.1| uncharacterized protein LOC100241657 [Vitis vinifera]
 emb|CAN68670.1| hypothetical protein VITISV_026919 [Vitis vinifera]
 gb|ACQ83519.1| CBL-interacting protein kinase 03 [Vitis vinifera]
Length=426

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +2

Query  311  AAEEKC-SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            + ++ C S+LHGKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV+K GM EQ+K
Sbjct  4    SGKDSCPSLLHGKYELGRLLGHGTFAKVYHARNLQTGKSVAMKVVGKDKVIKVGMTEQVK  63

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MV+H NIVEL+EVMASK+KIYFAMELVRGGELF+KISKGRLRE++AR YFQQL
Sbjct  64   REISVMKMVQHPNIVELHEVMASKSKIYFAMELVRGGELFSKISKGRLREDVARVYFQQL  123

Query  668  ISAVDFCHSRGVYHRD  715
            ISAVDFCHSRGVYHRD
Sbjct  124  ISAVDFCHSRGVYHRD  139



>gb|KHN45276.1| CBL-interacting serine/threonine-protein kinase 6 [Glycine soja]
Length=232

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 6/147 (4%)
 Frame = +2

Query  275  EKEKNSKLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxk  454
            EKEK +       +E + ++LHGKYELGR LGHGTFAKVYHARN++TG+  AMKVVGK K
Sbjct  3    EKEKGNN------SEGQSTLLHGKYELGRVLGHGTFAKVYHARNLNTGQHVAMKVVGKEK  56

Query  455  vvkagmmEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLR  634
            V+K GMMEQ+KREISVM MVKH NIVEL+EVMASK+KIY AMELVRGGELF K+SKGRL+
Sbjct  57   VIKVGMMEQVKREISVMKMVKHQNIVELHEVMASKSKIYIAMELVRGGELFNKVSKGRLK  116

Query  635  EELARNYFQQLISAVDFCHSRGVYHRD  715
            E++AR YFQQLISAVDFCHSRGVYHRD
Sbjct  117  EDVARLYFQQLISAVDFCHSRGVYHRD  143



>ref|XP_004146689.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Cucumis sativus]
 gb|KGN65246.1| hypothetical protein Csa_1G269880 [Cucumis sativus]
Length=430

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            VLHGKYELGR LGHGTFAKVYHARN+ +G S AMKVVGK KV+K GMMEQIKREISVM M
Sbjct  12   VLHGKYELGRLLGHGTFAKVYHARNLQSGTSMAMKVVGKEKVIKVGMMEQIKREISVMKM  71

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELF+KISKGRLRE++AR YFQQLISA+DFCH
Sbjct  72   VKHPNIVELHEVMASKSKIYFAMELVRGGELFSKISKGRLREDVARVYFQQLISAIDFCH  131

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  132  SRGVYHRD  139



>ref|XP_010438101.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Camelina sativa]
Length=450

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  326  CSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVM  505
             ++LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM+EQIKREISVM
Sbjct  21   TALLHGRYELGRLLGHGTFAKVYHARNVQTGKSVAMKVVGKEKVVKVGMVEQIKREISVM  80

Query  506  SMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDF  685
             MVKH NIVEL+EVMASK+KIYFAMELVRGGELFAK+SKGRLRE++AR YFQQLISAVDF
Sbjct  81   RMVKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVSKGRLREDVARVYFQQLISAVDF  140

Query  686  CHSRGVYHRD  715
            CHSRGVYHRD
Sbjct  141  CHSRGVYHRD  150



>ref|XP_009598784.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Nicotiana tomentosiformis]
Length=425

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  EEK  VL+GKYELGR LG GTFAKVYH+RNV TG + AMKVVGK KV+K GMMEQIK
Sbjct  1    MGPEEKNGVLYGKYELGRILGQGTFAKVYHSRNVVTGGNIAMKVVGKEKVIKVGMMEQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVKH NIVEL+EVMASK+KIYFAME V+GGELFAK++KGRLRE++AR YFQQL
Sbjct  61   REISVMKMVKHPNIVELHEVMASKSKIYFAMEFVKGGELFAKVAKGRLREDIARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  121  ISAIDFCHSRGVYHRD  136



>ref|XP_010432919.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Camelina sativa]
Length=447

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM+EQIKREISVM 
Sbjct  22   ALLHGRYELGRLLGHGTFAKVYHARNVQTGKSVAMKVVGKEKVVKVGMVEQIKREISVMR  81

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIYFAMELVRGGELFAK+SKGRLRE++AR YFQQLISAVDFC
Sbjct  82   MVKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVSKGRLREDVARVYFQQLISAVDFC  141

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  142  HSRGVYHRD  150



>gb|AGH08169.1| CBL-interacting protein kinase [Gossypium hirsutum]
Length=431

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            ++ A  E  S+LHGKYELGR LGHGTFAKVYHA+N+ TGK+ AMKVVGK KV++ GMMEQ
Sbjct  2    ADKAKTENPSLLHGKYELGRMLGHGTFAKVYHAKNLQTGKNVAMKVVGKEKVIQVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRL+E+ AR YFQ
Sbjct  62   IKREISVMKMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLKEDAARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QL+SAVDFCHSRGVYHRD
Sbjct  122  QLVSAVDFCHSRGVYHRD  139



>gb|KJB65761.1| hypothetical protein B456_010G112400 [Gossypium raimondii]
Length=431

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            ++ A  E  S+LHGKYELGR LGHGTFAKVYHA+N+ TGKS AMKVVGK KV++ GMMEQ
Sbjct  2    ADKAKTENPSLLHGKYELGRMLGHGTFAKVYHAKNLQTGKSVAMKVVGKEKVIQVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRL+E+ AR YFQ
Sbjct  62   IKREISVMKMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLKEDAARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QL+SAVDFCHSRGVYHRD
Sbjct  122  QLVSAVDFCHSRGVYHRD  139



>emb|CDY23269.1| BnaA08g12770D [Brassica napus]
Length=398

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVV K KV+K GM+EQIKREISVMSM
Sbjct  10   LLHGRYELGRLLGHGTFAKVYHARNVTTGKSMAMKVVAKEKVIKVGMVEQIKREISVMSM  69

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRG ELFAKISKGRLRE++AR YFQQLISAVDFCH
Sbjct  70   VKHPNIVELHEVMASKSKIYFAMELVRGCELFAKISKGRLREDVARVYFQQLISAVDFCH  129

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  130  SRGVYHRD  137



>gb|KFK27027.1| hypothetical protein AALP_AA8G324700 [Arabis alpina]
Length=445

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            S+  +    S+LHG+YELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KVVK GM+EQ
Sbjct  12   SDGGSGSTTSLLHGRYELGRLLGHGTFAKVYHARNIQSGKSVAMKVVGKEKVVKVGMVEQ  71

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAMELVRGGELFAK++KGRLRE++AR YFQ
Sbjct  72   IKREISVMRMVKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDVARVYFQ  131

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCHSRGVYHRD
Sbjct  132  QLISAVDFCHSRGVYHRD  149



>ref|XP_006350095.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Solanum tuberosum]
Length=432

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  EEKC+VL+GKYELGR LG G+FAKVYHARNV TG++ AMKVVGK KV+K GMMEQIK
Sbjct  1    MGPEEKCAVLYGKYELGRVLGQGSFAKVYHARNVVTGENIAMKVVGKEKVIKVGMMEQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVKH NIVEL+EVMASKTKIYFAME V+GGELF K++KG+LRE+ AR YFQQL
Sbjct  61   REISVMKMVKHPNIVELHEVMASKTKIYFAMEYVKGGELFEKVAKGKLREDNARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  121  ISAIDFCHSRGVYHRD  136



>emb|CDY36461.1| BnaC03g67810D [Brassica napus]
Length=410

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHA NV TGKS AMKVV K KV+K GM+EQIKREISVMSM
Sbjct  19   LLHGRYELGRLLGHGTFAKVYHACNVTTGKSMAMKVVAKEKVIKVGMVEQIKREISVMSM  78

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELFAK+SKGRLRE++AR YFQQLISAVDFCH
Sbjct  79   VKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVSKGRLREDVARVYFQQLISAVDFCH  138

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  139  SRGVYHRD  146



>emb|CDY28231.1| BnaA01g06180D [Brassica napus]
Length=416

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM++QIKREISVM M
Sbjct  19   LLHGRYELGRLLGHGTFAKVYHARNVTTGKSVAMKVVGKEKVVKVGMVDQIKREISVMRM  78

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFCH
Sbjct  79   VKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFCH  138

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  139  SRGVYHRD  146



>ref|XP_010447637.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Camelina sativa]
Length=450

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM+EQIKREISVM 
Sbjct  22   ALLHGRYELGRLLGHGTFAKVYHARNVQTGKSVAMKVVGKEKVVKVGMVEQIKREISVMR  81

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFC
Sbjct  82   MVKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFC  141

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  142  HSRGVYHRD  150



>emb|CDX68708.1| BnaC01g07450D [Brassica napus]
Length=416

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM++QIKREISVM M
Sbjct  19   LLHGRYELGRLLGHGTFAKVYHARNVTTGKSVAMKVVGKEKVVKVGMVDQIKREISVMRM  78

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFCH
Sbjct  79   VKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFCH  138

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  139  SRGVYHRD  146



>ref|XP_011018017.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Populus euphratica]
Length=437

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            +E  ++   ++LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQ
Sbjct  2    AETTSDGHPTLLHGKYELGRLLGHGTFAKVYHARNLQSGKSVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI KGRLRE++AR YFQ
Sbjct  62   IKREISVMKMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIEKGRLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|XP_002324548.1| CBL-interacting protein kinase 6 [Populus trichocarpa]
 gb|ABJ91214.1| CBL-interacting protein kinase 7 [Populus trichocarpa]
 gb|ABJ91215.1| CBL-interacting protein kinase 8 [Populus trichocarpa]
 gb|EEF03113.1| CBL-interacting protein kinase 6 [Populus trichocarpa]
Length=439

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            +E  ++   ++LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQ
Sbjct  2    AETTSDGHPTLLHGKYELGRLLGHGTFAKVYHARNLQSGKSVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI KGRLRE++AR YFQ
Sbjct  62   IKREISVMKMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIEKGRLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>gb|AAL37170.1|AF319169_1 CBL-interacting protein kinase [Brassica napus]
Length=441

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM++QIKREISVM M
Sbjct  19   LLHGRYELGRLLGHGTFAKVYHARNVTTGKSVAMKVVGKEKVVKVGMVDQIKREISVMRM  78

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFCH
Sbjct  79   VKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFCH  138

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  139  SRGVYHRD  146



>ref|XP_010110371.1| CBL-interacting serine/threonine-protein kinase 6 [Morus notabilis]
 gb|EXC26157.1| CBL-interacting serine/threonine-protein kinase 6 [Morus notabilis]
Length=433

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHGKYELGRFLGHGTFAKVYH+RN+ TGK  AMKVVGK KV+K GM EQ+KREISVM 
Sbjct  13   TLLHGKYELGRFLGHGTFAKVYHSRNLQTGKRVAMKVVGKEKVIKVGMTEQVKREISVMK  72

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRL+E+ AR YFQQLISAVDFC
Sbjct  73   MVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLKEDTARVYFQQLISAVDFC  132

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  133  HSRGVYHRD  141



>gb|AFD97324.1| kinase CIPK6 [Brassica napus]
Length=440

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM++QIKREISVM M
Sbjct  19   LLHGRYELGRLLGHGTFAKVYHARNVTTGKSVAMKVVGKEKVVKVGMVDQIKREISVMRM  78

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFCH
Sbjct  79   VKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFCH  138

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  139  SRGVYHRD  146



>ref|NP_001265891.1| CBL-interacting protein kinase 6 [Solanum lycopersicum]
 gb|AEP33595.1| CBL-interacting protein kinase 6 [Solanum lycopersicum]
Length=432

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  EEKC+VL+GKYELGR LG G+FAKVYHARNV TG++ AMKVVGK KV+K GMMEQIK
Sbjct  1    MGTEEKCAVLYGKYELGRVLGQGSFAKVYHARNVVTGENIAMKVVGKEKVIKVGMMEQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVKH N+VEL+EVMASKTKIYFAME V+GGELF K++KG+LRE+ AR YFQQL
Sbjct  61   REISVMKMVKHPNVVELHEVMASKTKIYFAMEYVKGGELFEKVAKGKLREDNARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  121  ISAIDFCHSRGVYHRD  136



>ref|XP_006412646.1| hypothetical protein EUTSA_v10025230mg [Eutrema salsugineum]
 gb|ESQ54099.1| hypothetical protein EUTSA_v10025230mg [Eutrema salsugineum]
Length=437

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM+EQIKREISVM M
Sbjct  14   LLHGRYELGRLLGHGTFAKVYHARNVTTGKSVAMKVVGKEKVVKVGMVEQIKREISVMRM  73

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFCH
Sbjct  74   VKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFCH  133

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  134  SRGVYHRD  141



>ref|XP_009795102.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Nicotiana sylvestris]
Length=425

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  EEK  VL+GKYELGR LG GTFAKVYH+RNV TG++ AMKVVGK KV+K GMMEQIK
Sbjct  1    MGPEEKNGVLYGKYELGRILGQGTFAKVYHSRNVVTGENIAMKVVGKEKVIKVGMMEQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MVKH NIVEL+EVMASK+KIYFAME V+GGELF K++KGRLRE++AR YFQQL
Sbjct  61   REISVMKMVKHPNIVELHEVMASKSKIYFAMEFVKGGELFEKVAKGRLREDIARGYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  121  ISAIDFCHSRGVYHRD  136



>ref|XP_006857201.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Amborella trichopoda]
 gb|ERN18668.1| hypothetical protein AMTR_s00065p00197200 [Amborella trichopoda]
Length=434

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +2

Query  284  KNSKLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvk  463
            K  K++S  +  E C  LHGKYELGR LGHGTFAKVYHA+N+ +GK  AMKVVGK KV+K
Sbjct  3    KPLKMDSTESKPESCGALHGKYELGRLLGHGTFAKVYHAKNLQSGKCVAMKVVGKEKVLK  62

Query  464  agmmEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREEL  643
             GMMEQ+KREISVM MVKH NIVEL+EV+ASKTKIYFAME V+GGELFA+++KGRL+EE+
Sbjct  63   VGMMEQVKREISVMKMVKHPNIVELHEVLASKTKIYFAMEYVKGGELFARVAKGRLKEEV  122

Query  644  ARNYFQQLISAVDFCHSRGVYHRD  715
            A+ YF+QLISAVDFCHSRGVYHRD
Sbjct  123  AKAYFRQLISAVDFCHSRGVYHRD  146



>ref|XP_006285443.1| hypothetical protein CARUB_v10006862mg [Capsella rubella]
 gb|EOA18341.1| hypothetical protein CARUB_v10006862mg [Capsella rubella]
Length=448

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARNV TGKS AMKVVGK KVVK GM++QIKREISVM M
Sbjct  21   LLHGRYELGRLLGHGTFAKVYHARNVQTGKSVAMKVVGKEKVVKVGMVDQIKREISVMRM  80

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFCH
Sbjct  81   VKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFCH  140

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  141  SRGVYHRD  148



>ref|XP_007204894.1| hypothetical protein PRUPE_ppa006023mg [Prunus persica]
 gb|EMJ06093.1| hypothetical protein PRUPE_ppa006023mg [Prunus persica]
Length=432

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +2

Query  314  AEEK----CSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            A+EK     S+LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQ
Sbjct  2    ADEKGRDGSSLLHGKYELGRLLGHGTFAKVYHARNLKSGKSVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAM+LVRGGELFAKI+KGRL+E++AR YFQ
Sbjct  62   IKREISVMRMVKHPNIVELHEVMASKSKIYFAMDLVRGGELFAKIAKGRLKEDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|XP_008242969.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Prunus mume]
Length=432

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +2

Query  314  AEEK----CSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            A+EK     S+LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQ
Sbjct  2    ADEKGRDGSSLLHGKYELGRLLGHGTFAKVYHARNLKSGKSVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAM+LVRGGELFAKI+KGRL+E++AR YFQ
Sbjct  62   IKREISVMRMVKHPNIVELHEVMASKSKIYFAMDLVRGGELFAKIAKGRLKEDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|NP_194825.1| CBL-interacting serine/threonine-protein kinase 6 [Arabidopsis 
thaliana]
 sp|O65554.1|CIPK6_ARATH RecName: Full=CBL-interacting serine/threonine-protein kinase 
6; AltName: Full=SNF1-related kinase 3.14; AltName: Full=SOS2-like 
protein kinase PKS4; AltName: Full=SOS3-interacting 
protein 3 [Arabidopsis thaliana]
 gb|AAF86505.1|AF285106_1 CBL-interacting protein kinase 6 [Arabidopsis thaliana]
 gb|AAK26843.1|AF339145_1 SOS2-like protein kinase PKS4 [Arabidopsis thaliana]
 gb|AAL32013.1|AF436831_1 AT4g30960/F6I18_130 [Arabidopsis thaliana]
 emb|CAA18197.1| putative protein kinase [Arabidopsis thaliana]
 emb|CAB79814.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAK59551.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAK93728.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE85835.1| CBL-interacting serine/threonine-protein kinase 6 [Arabidopsis 
thaliana]
Length=441

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KVVK GM++QIKREISVM M
Sbjct  19   LLHGRYELGRLLGHGTFAKVYHARNIQTGKSVAMKVVGKEKVVKVGMVDQIKREISVMRM  78

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELFAK++KGRLRE++AR YFQQLISAVDFCH
Sbjct  79   VKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDVARVYFQQLISAVDFCH  138

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  139  SRGVYHRD  146



>emb|CDX72282.1| BnaC07g43040D [Brassica napus]
Length=406

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +  S+L+G+YE+GR LGHGTFAKVYHARNV TGKS A+KVV K KV KAGM EQIKREIS
Sbjct  15   DGTSLLNGRYEIGRLLGHGTFAKVYHARNVTTGKSVALKVVAKEKVAKAGMEEQIKREIS  74

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM MVKH NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRLRE+ AR YF+QLISAV
Sbjct  75   VMKMVKHPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLREDAARVYFKQLISAV  134

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  135  DFCHSRGVYHRD  146



>gb|EPS71159.1| hypothetical protein M569_03590, partial [Genlisea aurea]
Length=414

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M+ EEKCSVL G+YE+GR LGHGTFAKVYHARN+ TGK+ A+KVVGK KV++AGMMEQ+K
Sbjct  3    MSVEEKCSVLQGQYEIGRLLGHGTFAKVYHARNLQTGKNVAIKVVGKEKVIRAGMMEQVK  62

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM MV H NIVEL+EV+ASK+KIY+AME VRGGELFA+I+KGRLRE+ AR YF QL
Sbjct  63   REISVMKMVHHPNIVELHEVLASKSKIYYAMEYVRGGELFARIAKGRLREDTARRYFHQL  122

Query  668  ISAVDFCHSRGVYHRD  715
            ISA+DFCHSRGVYHRD
Sbjct  123  ISAIDFCHSRGVYHRD  138



>ref|XP_003519143.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Glycine max]
Length=430

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 6/147 (4%)
 Frame = +2

Query  275  EKEKNSKLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxk  454
            EKEK +       +E + ++LHGKYELGR LGHGTFAKVYHARN++TG+  AMKVVGK K
Sbjct  3    EKEKGNN------SEGQSTLLHGKYELGRVLGHGTFAKVYHARNLNTGQHVAMKVVGKEK  56

Query  455  vvkagmmEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLR  634
            V+K GMMEQ+KREISVM MVKH NIVEL+EVMASK+KIY AMELVRGGELF K+SKGRL+
Sbjct  57   VIKVGMMEQVKREISVMKMVKHQNIVELHEVMASKSKIYIAMELVRGGELFNKVSKGRLK  116

Query  635  EELARNYFQQLISAVDFCHSRGVYHRD  715
            E++AR YFQQLISAVDFCHSRGVYHRD
Sbjct  117  EDVARLYFQQLISAVDFCHSRGVYHRD  143



>gb|KHN42812.1| CBL-interacting serine/threonine-protein kinase 6 [Glycine soja]
Length=430

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 6/147 (4%)
 Frame = +2

Query  275  EKEKNSKLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxk  454
            EKEK +       +E + ++LHGKYELGR LGHGTFAKVYHARN++TG+  AMKVVGK K
Sbjct  3    EKEKGNN------SEGQSTLLHGKYELGRVLGHGTFAKVYHARNLNTGQHVAMKVVGKEK  56

Query  455  vvkagmmEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLR  634
            V+K GMMEQ+KREISVM MVKH NIVEL+EVMASK+KIY AMELVRGGELF K+SKGRL+
Sbjct  57   VIKVGMMEQVKREISVMKMVKHQNIVELHEVMASKSKIYIAMELVRGGELFNKVSKGRLK  116

Query  635  EELARNYFQQLISAVDFCHSRGVYHRD  715
            E++AR YFQQLISAVDFCHSRGVYHRD
Sbjct  117  EDVARLYFQQLISAVDFCHSRGVYHRD  143



>ref|XP_004287123.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Fragaria vesca subsp. vesca]
Length=427

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 2/138 (1%)
 Frame = +2

Query  308  MAAEEKC--SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            MA E+    ++LHGKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV+K GMMEQ
Sbjct  1    MANEKSAGSALLHGKYELGRMLGHGTFAKVYHARNLKTGKSMAMKVVGKEKVIKVGMMEQ  60

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MV+H NIVEL+EVMASK+KIYFAM+LVRGGELFAKI+KGRL+E++AR YFQ
Sbjct  61   IKREISVMRMVRHPNIVELHEVMASKSKIYFAMDLVRGGELFAKIAKGRLKEDVARVYFQ  120

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCHSRGVYHRD
Sbjct  121  QLISAVDFCHSRGVYHRD  138



>ref|XP_010048823.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Eucalyptus grandis]
 gb|KCW81216.1| hypothetical protein EUGRSUZ_C02590 [Eucalyptus grandis]
Length=433

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            S+LHGKYELGR LGHGTFAKVYHAR + +G S AMKVVGK KVVK GM EQIKREI+VM 
Sbjct  11   SILHGKYELGRLLGHGTFAKVYHARELQSGGSVAMKVVGKEKVVKVGMTEQIKREIAVMK  70

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH +IVEL+EVMASK+KIYFAMELVRGGELFAKISKGRLRE++AR YFQQLISAVDFC
Sbjct  71   MVKHPHIVELHEVMASKSKIYFAMELVRGGELFAKISKGRLREDVARAYFQQLISAVDFC  130

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  131  HSRGVYHRD  139



>gb|KJB82849.1| hypothetical protein B456_013G216700 [Gossypium raimondii]
Length=444

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 140/198 (71%), Gaps = 43/198 (22%)
 Frame = +2

Query  122  IGGRNCHRKHVEDG*IPTIYFASYIS*SSVL*PFIVPKIKHSN*L*KE*RIEKEKNSKLE  301
            IGGRNCHRKH+E                      ++ K+                     
Sbjct  19   IGGRNCHRKHLE----------------------LMKKM---------------------  35

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            +E    +  ++LHGKYELGR LGHGTFAKVYHAR+V TGKS AMKVVGK KV++ GMMEQ
Sbjct  36   AEKGKTDHPALLHGKYELGRMLGHGTFAKVYHARHVTTGKSVAMKVVGKEKVIRVGMMEQ  95

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            I+REISVM+MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+K+ +GRL+E+LAR YFQ
Sbjct  96   IQREISVMNMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKVVQGRLKEDLARVYFQ  155

Query  662  QLISAVDFCHSRGVYHRD  715
            QL+SAVDFCHSRGVYHRD
Sbjct  156  QLVSAVDFCHSRGVYHRD  173



>gb|KJB54939.1| hypothetical protein B456_009G055400 [Gossypium raimondii]
Length=454

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E  ++LHGKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV++ GMMEQIKREIS
Sbjct  31   ENPALLHGKYELGRMLGHGTFAKVYHARNLQTGKSVAMKVVGKEKVIRVGMMEQIKREIS  90

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRL+E+LAR YFQQL+S +
Sbjct  91   VMKMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLKEDLARVYFQQLVSVI  150

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  151  DFCHSRGVYHRD  162



>ref|XP_002533977.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF28408.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=432

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHGKYELGR LGHGTFAKVYH RN+ TGKS AMKVVGK KV+K GMMEQ+KREI+VM M
Sbjct  13   LLHGKYELGRLLGHGTFAKVYHGRNLQTGKSVAMKVVGKEKVIKVGMMEQVKREIAVMKM  72

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRLRE++AR YFQQLISAVDFCH
Sbjct  73   VKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLREDVARVYFQQLISAVDFCH  132

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  133  SRGVYHRD  140



>ref|XP_008456483.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Cucumis melo]
Length=433

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            S+L GKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK K++K GM EQIKREISVM 
Sbjct  12   SLLDGKYELGRLLGHGTFAKVYHARNLRTGKSVAMKVVGKEKIIKVGMTEQIKREISVMK  71

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIYFAME VRGGELF+KI+KGRLRE++AR YFQQLISA+DFC
Sbjct  72   MVKHPNIVELHEVMASKSKIYFAMEFVRGGELFSKIAKGRLREDVARVYFQQLISAIDFC  131

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  132  HSRGVYHRD  140



>ref|XP_012071492.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Jatropha curcas]
 gb|KDP38667.1| hypothetical protein JCGZ_04020 [Jatropha curcas]
Length=435

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHG+YELGR LGHGTFAKVYHARN+ TG S AMKVVGK KV+K GMMEQ+KREI+VM 
Sbjct  12   TLLHGRYELGRMLGHGTFAKVYHARNLQTGNSVAMKVVGKEKVIKVGMMEQVKREIAVMK  71

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRLRE++AR YFQQLISA+DFC
Sbjct  72   MVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLREDVARVYFQQLISAIDFC  131

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  132  HSRGVYHRD  140



>ref|XP_008354330.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Malus domestica]
Length=432

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +2

Query  314  AEEK----CSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            AE+K     S+LHGKYELGR LGHGTFAKVYHAR++ +GK+ AMKVVGK KV+K GMMEQ
Sbjct  2    AEQKESGGSSLLHGKYELGRLLGHGTFAKVYHARHLQSGKNVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAM+LVRGGELFAKI+KGRLRE++AR YFQ
Sbjct  62   IKREISVMRMVKHPNIVELHEVMASKSKIYFAMDLVRGGELFAKIAKGRLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|XP_008362871.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Malus domestica]
Length=432

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 124/138 (90%), Gaps = 4/138 (3%)
 Frame = +2

Query  314  AEEK----CSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            AE+K     S+LHGKYELGR LGHGTFAKVYHAR++ +G + AMKVVGK KV+K GMMEQ
Sbjct  2    AEQKESGGSSLLHGKYELGRLLGHGTFAKVYHARHLQSGXNVAMKVVGKEKVIKXGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAM+LVRGGELFAKI+KGRLRE++AR YFQ
Sbjct  62   IKREISVMRMVKHPNIVELHEVMASKSKIYFAMDLVRGGELFAKIAKGRLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|XP_004139258.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Cucumis sativus]
 gb|KGN60761.1| hypothetical protein Csa_2G009490 [Cucumis sativus]
Length=433

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            S+L GKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK K++K GMMEQIKREISVM 
Sbjct  12   SLLDGKYELGRLLGHGTFAKVYHARNLRTGKSVAMKVVGKEKIIKVGMMEQIKREISVMK  71

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIYFAME VRGGELF+KI+KGRLRE++AR YFQQLISA+DFC
Sbjct  72   MVKHPNIVELHEVMASKSKIYFAMEFVRGGELFSKIAKGRLREDVARVYFQQLISAIDFC  131

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  132  HSRGVYHRD  140



>ref|XP_007011954.1| SOS3-interacting protein 3 [Theobroma cacao]
 gb|EOY29573.1| SOS3-interacting protein 3 [Theobroma cacao]
Length=431

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            +E    +  ++LHGKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV+K GMM+Q
Sbjct  2    AEKTKSDHSALLHGKYELGRMLGHGTFAKVYHARNLQTGKSVAMKVVGKEKVIKVGMMDQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH +IVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRL+E+LAR YFQ
Sbjct  62   IKREISVMKMVKHPHIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLKEDLARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QL+SA+DFCHSRGVYHRD
Sbjct  122  QLVSAIDFCHSRGVYHRD  139



>ref|XP_010265622.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Nelumbo nucifera]
 gb|AIE41753.1| CBL protein interaction protein kinase [Nelumbo nucifera]
Length=435

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            ++ SVLHGKY+LGR LGHGTFAKVYHA+N+ TGKS AMKVVGK KV+K GM EQ+KREIS
Sbjct  8    DQSSVLHGKYDLGRLLGHGTFAKVYHAKNLQTGKSVAMKVVGKEKVIKVGMTEQVKREIS  67

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +VKH NIVEL+EV+ASK+KIYFAMELVRGGELF K++KGRL+E++AR YFQQLISAV
Sbjct  68   VMKIVKHPNIVELHEVLASKSKIYFAMELVRGGELFCKVAKGRLKEDVARAYFQQLISAV  127

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  128  DFCHSRGVYHRD  139



>gb|ADZ99349.1| CBL interacting protein kinase 6 [Gossypium hirsutum]
Length=431

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            +E    E  ++LH KYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV++ GMMEQ
Sbjct  2    AEKTRSENPALLHRKYELGRMLGHGTFAKVYHARNLQTGKSVAMKVVGKEKVIRVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAMELVRGGELF+KI+KGRL+E+LAR YFQ
Sbjct  62   IKREISVMKMVKHPNIVELHEVMASKSKIYFAMELVRGGELFSKIAKGRLKEDLARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QL+S +DFCHSRGVYHRD
Sbjct  122  QLVSVIDFCHSRGVYHRD  139



>gb|EYU25351.1| hypothetical protein MIMGU_mgv1a007012mg [Erythranthe guttata]
Length=422

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 116/134 (87%), Gaps = 1/134 (1%)
 Frame = +2

Query  317  EEKCS-VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            E KC   LHGKYELGR LGHGTF KVYHARN+ T KS AMKVVGK KV + GM E +KRE
Sbjct  5    EMKCGGALHGKYELGRLLGHGTFGKVYHARNLQTSKSVAMKVVGKEKVARVGMTEHVKRE  64

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            IS+M MV H NIVEL+EVMA+KTKIYFAMELVRGGELFAKIS+GRLRE+ AR+YFQQLIS
Sbjct  65   ISIMKMVHHPNIVELHEVMATKTKIYFAMELVRGGELFAKISRGRLREDAARSYFQQLIS  124

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  125  AVDFCHSRGVYHRD  138



>ref|XP_007154893.1| hypothetical protein PHAVU_003G156900g [Phaseolus vulgaris]
 dbj|BAG06675.1| protein kinase [Phaseolus vulgaris]
 gb|ESW26887.1| hypothetical protein PHAVU_003G156900g [Phaseolus vulgaris]
Length=433

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E  ++LHGKYELGR LGHGTFAKVYHARN+ TG+  AMKVVGK KV+K GMMEQ+KREIS
Sbjct  14   EGSTLLHGKYELGRVLGHGTFAKVYHARNLKTGQHVAMKVVGKEKVIKVGMMEQVKREIS  73

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM MVKH NIVEL+EVMASK+KIY AMELVRGGELF K+SKGRL+E++AR YFQQLISAV
Sbjct  74   VMKMVKHSNIVELHEVMASKSKIYIAMELVRGGELFNKVSKGRLKEDVARLYFQQLISAV  133

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  134  DFCHSRGVYHRD  145



>ref|XP_008352090.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Malus domestica]
Length=432

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +2

Query  314  AEEK----CSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            AE+K     S+LHGKYELGR LGHGTFAKVYHAR++ +GK+ AMKVVGK KV+K GMMEQ
Sbjct  2    AEQKESGGSSLLHGKYELGRLLGHGTFAKVYHARHLPSGKNVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EV+ASK+KIYFAM+LVRGGELFAKI+KGRLRE++AR YFQ
Sbjct  62   IKREISVMRMVKHPNIVELHEVLASKSKIYFAMDLVRGGELFAKIAKGRLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>gb|ABJ91216.1| CBL-interacting protein kinase 9 [Populus trichocarpa]
Length=437

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            +E  ++   ++LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQ
Sbjct  2    AEKTSDGHPTLLHGKYELGRLLGHGTFAKVYHARNLQSGKSVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            +KREISVM MV+H +IVEL EVMASK+KIYFAMELVRGGELF+KI+KGRLRE++AR YFQ
Sbjct  62   VKREISVMKMVRHPHIVELNEVMASKSKIYFAMELVRGGELFSKIAKGRLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|XP_009366288.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Pyrus x bretschneideri]
Length=137

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            SE       S+LHGKYELGR LGHGTFAKVYHAR++ +GK+ AMKVVGK KV+K GMMEQ
Sbjct  2    SEQKESGGSSLLHGKYELGRLLGHGTFAKVYHARHLQSGKNVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH NIVEL+EVMASK+KIYFAM+LVRGGELFAKI+KGRLRE++AR YFQ
Sbjct  62   IKREISVMRMVKHPNIVELHEVMASKSKIYFAMDLVRGGELFAKIAKGRLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGV  703
            QLISA+DFCHSRGV
Sbjct  122  QLISAIDFCHSRGV  135



>ref|XP_006473970.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Citrus sinensis]
Length=441

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            S    +++ ++LHGKYELGR LGHGTFAKVY ARN+ TGKS AMKVVGK KV+K GMMEQ
Sbjct  6    SNGGGDDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAMKVVGKDKVIKVGMMEQ  65

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH +IVEL+EVMASK+KIYFAM+LV+GGELF KI+KGRLRE++AR YFQ
Sbjct  66   IKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGELFNKIAKGRLREDVARVYFQ  125

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCHSRGVYHRD
Sbjct  126  QLISAVDFCHSRGVYHRD  143



>ref|XP_006453669.1| hypothetical protein CICLE_v10008315mg [Citrus clementina]
 gb|ESR66909.1| hypothetical protein CICLE_v10008315mg [Citrus clementina]
 gb|KDO59401.1| hypothetical protein CISIN_1g013522mg [Citrus sinensis]
Length=441

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            S    +++ ++LHGKYELGR LGHGTFAKVY ARN+ TGKS AMKVVGK KV+K GMMEQ
Sbjct  6    SNGGGDDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAMKVVGKDKVIKVGMMEQ  65

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            IKREISVM MVKH +IVEL+EVMASK+KIYFAM+LV+GGELF KI+KGRLRE++AR YFQ
Sbjct  66   IKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGELFNKIAKGRLREDVARVYFQ  125

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCHSRGVYHRD
Sbjct  126  QLISAVDFCHSRGVYHRD  143



>ref|XP_010047118.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Eucalyptus grandis]
Length=445

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  299  ESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmE  478
            +S++      SVLHGKYELGR LGHGTFAKVYHARN+ +G+S AMKVVGK KV+K GMME
Sbjct  3    DSKVRDASASSVLHGKYELGRLLGHGTFAKVYHARNLQSGRSVAMKVVGKEKVMKVGMME  62

Query  479  QIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYF  658
            QIKREI+VM MVKH +IVEL EVMASK+KIYFAMELVRGGELF +I+KGRLRE+ AR YF
Sbjct  63   QIKREIAVMKMVKHPHIVELDEVMASKSKIYFAMELVRGGELFNRIAKGRLREDAARMYF  122

Query  659  QQLISAVDFCHSRGVYHRD  715
            QQLISA+DFCHSRGVYHRD
Sbjct  123  QQLISAIDFCHSRGVYHRD  141



>gb|KJB07595.1| hypothetical protein B456_001G032000 [Gossypium raimondii]
Length=455

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHGKYELGR LGHGTFAKVYHARN+ TGKS AMKVVGK KV+ AGM EQIKREISVM M
Sbjct  34   LLHGKYELGRILGHGTFAKVYHARNLQTGKSIAMKVVGKEKVINAGMTEQIKREISVMKM  93

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+E+MA+KTKIYFAMELVRGGELF+K++KGRL E+ AR YFQQL+SA+DFCH
Sbjct  94   VKHPNIVELHEIMATKTKIYFAMELVRGGELFSKVAKGRLDEDSARLYFQQLVSAIDFCH  153

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  154  SRGVYHRD  161



>ref|XP_009358459.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Pyrus x bretschneideri]
Length=432

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +2

Query  314  AEEK----CSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            AE+K     S+LHGKYELGR LGHGTFAKVYHAR++ +GK+ AMKVVGK KV+K GMMEQ
Sbjct  2    AEQKESGGSSLLHGKYELGRLLGHGTFAKVYHARHLPSGKNVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            +KREISVM MVKH NIVEL+EV+ASK+KIYFAM+LVRGGELFAKI+KGRL+E++AR YFQ
Sbjct  62   VKREISVMRMVKHPNIVELHEVLASKSKIYFAMDLVRGGELFAKIAKGRLKEDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|XP_002309336.2| CBL-interacting protein kinase 6 [Populus trichocarpa]
 gb|EEE92859.2| CBL-interacting protein kinase 6 [Populus trichocarpa]
Length=437

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            +E  ++   ++LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQ
Sbjct  2    AEKTSDGHPTLLHGKYELGRLLGHGTFAKVYHARNLQSGKSVAMKVVGKEKVIKVGMMEQ  61

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            +KREISVM MV+H +IVEL EVMASK+KIYFAMELVRGGELF+KI+KG+LRE++AR YFQ
Sbjct  62   VKREISVMKMVRHPHIVELNEVMASKSKIYFAMELVRGGELFSKIAKGKLREDVARVYFQ  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  122  QLISAIDFCHSRGVYHRD  139



>ref|XP_011033439.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Populus euphratica]
Length=437

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHGKYELGR LGHG FAKVYHARN+ +GKS AMKVVGK KV+K GMMEQIKREISVM 
Sbjct  11   TLLHGKYELGRLLGHGPFAKVYHARNLQSGKSVAMKVVGKEKVIKVGMMEQIKREISVMK  70

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MV+H +IVEL EVMASK+KIYFAMELVRGGELF+KI+KGRLRE++AR YFQQLISA+DFC
Sbjct  71   MVRHPHIVELNEVMASKSKIYFAMELVRGGELFSKIAKGRLREDVARVYFQQLISAIDFC  130

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  131  HSRGVYHRD  139



>ref|XP_010526294.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Tarenaya hassleriana]
Length=430

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  344  KYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSMVKHH  523
            KYELGR LGHGTFAKVYHARNV +GKS AMKVVGK KV+K GM EQIKREISVM MVKH 
Sbjct  22   KYELGRLLGHGTFAKVYHARNVQSGKSVAMKVVGKEKVMKVGMAEQIKREISVMRMVKHP  81

Query  524  NIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCHSRGV  703
            NIVEL+EVMASK+KIYFAMELVRGGELFAK++KGRLRE++AR YF+QLISAVDFCHSRGV
Sbjct  82   NIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDVARVYFKQLISAVDFCHSRGV  141

Query  704  YHRD  715
            YHRD
Sbjct  142  YHRD  145



>gb|AGL07710.1| CBL-interacting protein kinase [Ziziphus jujuba]
Length=434

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            ++  ++LHGKYELGR LGHGTFAKVYHA+N+ +GKS AMKVVGK KV+K GMMEQIKREI
Sbjct  9    DQNSTLLHGKYELGRLLGHGTFAKVYHAKNLQSGKSVAMKVVGKEKVIKVGMMEQIKREI  68

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM MVKH + V+L+EVMASK+KIYFAMELVRGGELF+KI++GRLRE++AR YFQQLISA
Sbjct  69   SVMKMVKHPHTVDLHEVMASKSKIYFAMELVRGGELFSKIARGRLREDVARVYFQQLISA  128

Query  677  VDFCHSRGVYHRD  715
            +DFCHSRGVYHRD
Sbjct  129  IDFCHSRGVYHRD  141



>ref|NP_001235809.1| SOS2-like protein kinase [Glycine max]
 gb|AAM83095.1|AF525402_1 SOS2-like protein kinase [Glycine max]
Length=438

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHGKYELGR LGHGTFAKVYHAR++ TGKS AMKVVGK KVVK GMMEQIKREIS M+
Sbjct  15   TLLHGKYELGRLLGHGTFAKVYHARHLKTGKSVAMKVVGKEKVVKVGMMEQIKREISAMN  74

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIV+L+EVMASK+KIY AMELVRGGELF KI++GRLREE+AR YFQQLISAVDFC
Sbjct  75   MVKHPNIVQLHEVMASKSKIYIAMELVRGGELFNKIARGRLREEMARLYFQQLISAVDFC  134

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  135  HSRGVYHRD  143



>ref|XP_006600550.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Glycine max]
Length=422

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHGKYELGR LGHG+FAKVYHARN+ TG+  AMKVVGK KV+K GMMEQ+KREISVM 
Sbjct  11   TLLHGKYELGRVLGHGSFAKVYHARNLKTGQHVAMKVVGKEKVIKVGMMEQVKREISVMK  70

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIY ++ELVRGGELF K+SKGRL+E+LAR YFQQLISAVDFC
Sbjct  71   MVKHPNIVELHEVMASKSKIYISIELVRGGELFNKVSKGRLKEDLARLYFQQLISAVDFC  130

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  131  HSRGVYHRD  139



>gb|KHN18322.1| CBL-interacting serine/threonine-protein kinase 6 [Glycine soja]
Length=422

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHGKYELGR LGHG+FAKVYHARN+ TG+  AMKVVGK KV+K GMMEQ+KREISVM 
Sbjct  11   TLLHGKYELGRVLGHGSFAKVYHARNLKTGQHVAMKVVGKEKVIKVGMMEQVKREISVMK  70

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIVEL+EVMASK+KIY ++ELVRGGELF K+SKGRL+E+LAR YFQQLISAVDFC
Sbjct  71   MVKHPNIVELHEVMASKSKIYISIELVRGGELFNKVSKGRLKEDLARLYFQQLISAVDFC  130

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  131  HSRGVYHRD  139



>gb|ABK25436.1| unknown [Picea sitchensis]
Length=373

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K +VL GKYELG+ LG GTFAKVY+ARNV TG+S A+KV+ K K++K GMMEQIKREI
Sbjct  2    EIKPNVLLGKYELGKLLGQGTFAKVYYARNVKTGESVAIKVMDKAKIMKVGMMEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIVELYEVMASKTKIYF ME VRGGELF K++KGRL+E+ AR YFQQL+SA
Sbjct  62   SVMRLVRHPNIVELYEVMASKTKIYFVMEYVRGGELFNKVAKGRLKEDAARKYFQQLMSA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|ACC96114.1| CBL-interacting protein kinase 6 [Cicer arietinum]
Length=444

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +L GKYELGR LGHGTFAKVYHA+N++TGKS AMKVVGK KV+K GMMEQIKREISVM M
Sbjct  18   LLDGKYELGRVLGHGTFAKVYHAKNLNTGKSVAMKVVGKEKVIKVGMMEQIKREISVMKM  77

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIV+L+EVMASK+KIY AMELVRGGELF K+ KGRL+E+LAR YFQQLISAVDFCH
Sbjct  78   VKHPNIVQLHEVMASKSKIYIAMELVRGGELFNKVVKGRLKEDLARVYFQQLISAVDFCH  137

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  138  SRGVYHRD  145



>ref|XP_004507724.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6-like 
[Cicer arietinum]
Length=444

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +L GKYELGR LGHGTFAKVYHA+N++TGKS AMKVVGK KV+K GMMEQIKREISVM M
Sbjct  18   LLDGKYELGRVLGHGTFAKVYHAKNLNTGKSVAMKVVGKEKVIKVGMMEQIKREISVMKM  77

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIV+L+EVMASK+KIY AMELVRGGELF K+ KGRL+E+LAR YFQQLISAVDFCH
Sbjct  78   VKHPNIVQLHEVMASKSKIYIAMELVRGGELFNKVVKGRLKEDLARVYFQQLISAVDFCH  137

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  138  SRGVYHRD  145



>ref|XP_007138415.1| hypothetical protein PHAVU_009G206900g [Phaseolus vulgaris]
 gb|ESW10409.1| hypothetical protein PHAVU_009G206900g [Phaseolus vulgaris]
Length=438

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQIKREIS M+M
Sbjct  16   LLHGKYELGRLLGHGTFAKVYHARNLKSGKSVAMKVVGKEKVMKVGMMEQIKREISAMNM  75

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH +IV+L+EVMASK+KIY AMELVRGGELF KI++GRLREE AR YFQQL+SAVDFCH
Sbjct  76   VKHPSIVQLHEVMASKSKIYIAMELVRGGELFNKIARGRLREETARLYFQQLVSAVDFCH  135

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  136  SRGVYHRD  143



>dbj|BAG06678.1| protein kinase [Phaseolus vulgaris]
Length=438

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQIKREIS M+M
Sbjct  16   LLHGKYELGRLLGHGTFAKVYHARNLKSGKSVAMKVVGKEKVMKVGMMEQIKREISAMNM  75

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH +IV+L+EVMASK+KIY AMELVRGGELF KI++GRLREE AR YFQQL+SAVDFCH
Sbjct  76   VKHPSIVQLHEVMASKSKIYIAMELVRGGELFNKIARGRLREETARLYFQQLVSAVDFCH  135

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  136  SRGVYHRD  143



>ref|XP_010525811.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Tarenaya hassleriana]
Length=434

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHG+YELGR LGHGTFAKVYHA+NV TGK+ AMKVVGK KV+K GM EQIKREISVM M
Sbjct  16   LLHGRYELGRLLGHGTFAKVYHAKNVQTGKNVAMKVVGKEKVMKVGMAEQIKREISVMKM  75

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH NIVEL+EVMASK+KIYFAMELVRGGELFAK++KGRLRE++AR YF+QLISAVDFCH
Sbjct  76   VKHPNIVELHEVMASKSKIYFAMELVRGGELFAKVAKGRLREDVARVYFKQLISAVDFCH  135

Query  692  SRGVYHRD  715
               VYHRD
Sbjct  136  RLRVYHRD  143



>gb|ABI14664.1| CBL-interacting protein kinase [Aegiceras corniculatum]
Length=210

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  338  HGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSMVK  517
            +GKYELG  LGHGTFAKVY ARNV +GK+ AMKVVGK KV+K GMMEQ+KREI+VM  VK
Sbjct  1    NGKYELGCILGHGTFAKVYLARNVPSGKNVAMKVVGKEKVIKVGMMEQVKREIAVMKRVK  60

Query  518  HHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCHSR  697
            H NIVEL+EVMASKTKIYFAMELVRGGELFAK++KGRL+E++AR+YFQQLISAVDFCHSR
Sbjct  61   HPNIVELHEVMASKTKIYFAMELVRGGELFAKVAKGRLKEDVARHYFQQLISAVDFCHSR  120

Query  698  GVYHRD  715
            GVYHRD
Sbjct  121  GVYHRD  126



>ref|XP_003610339.1| CBL-interacting protein kinase [Medicago truncatula]
 gb|AES92536.1| CBL-interacting kinase [Medicago truncatula]
Length=435

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++L GKYELGR LGHGTFAKVYHA+N++TGK+ AMKVVGK KV+K GM+EQIKREISVM 
Sbjct  12   ALLDGKYELGRVLGHGTFAKVYHAKNLNTGKNVAMKVVGKEKVIKVGMIEQIKREISVMK  71

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIV+L+EVMASK+KIY AMELVRGGELF KI KGRL+E++AR YFQQLISAVDFC
Sbjct  72   MVKHPNIVQLHEVMASKSKIYIAMELVRGGELFNKIVKGRLKEDVARVYFQQLISAVDFC  131

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  132  HSRGVYHRD  140



>ref|XP_003533886.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 6 
[Glycine max]
Length=440

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++LHGKYELGR LGHG+FAKVYHAR+++TGKS AMKVVGK KVVK GMMEQIKREIS M+
Sbjct  17   TLLHGKYELGRLLGHGSFAKVYHARHLNTGKSVAMKVVGKEKVVKVGMMEQIKREISAMN  76

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIV+L+EVMASK+KIY AMELVRGGELF KI++GRLREE AR YFQQLISAVDFC
Sbjct  77   MVKHPNIVQLHEVMASKSKIYIAMELVRGGELFNKIARGRLREETARLYFQQLISAVDFC  136

Query  689  HSRGVYHRD  715
            HSRGV+HRD
Sbjct  137  HSRGVFHRD  145



>gb|ACJ84672.1| unknown [Medicago truncatula]
 gb|AFK33832.1| unknown [Medicago truncatula]
Length=390

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++L GKYELGR LGHGTFAKVYHA+N++TGK+ AMKVVGK KV+K GM+EQIKREISVM 
Sbjct  12   ALLDGKYELGRVLGHGTFAKVYHAKNLNTGKNVAMKVVGKEKVIKVGMIEQIKREISVMK  71

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            MVKH NIV+L+EVMASK+KIY AMELVRGGELF KI KGRL+E++ R YFQQLISAVDFC
Sbjct  72   MVKHPNIVQLHEVMASKSKIYIAMELVRGGELFNKIVKGRLKEDVVRVYFQQLISAVDFC  131

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  132  HSRGVYHRD  140



>ref|XP_008799653.1| PREDICTED: CBL-interacting protein kinase 6 [Phoenix dactylifera]
Length=450

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
              + A E  SVLHG+YELGR LGHGTFAKVY ARN+ TGKS AMKVVGK KV++ GMMEQ
Sbjct  6    PPLPAAEGKSVLHGRYELGRVLGHGTFAKVYLARNLRTGKSVAMKVVGKEKVIRVGMMEQ  65

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-GRLREELARNYF  658
            +KREISVM MV H NIVEL+EVMA+++KI+FAMELVRGGELF++I++ GRLREE AR+YF
Sbjct  66   VKREISVMKMVTHPNIVELHEVMATRSKIFFAMELVRGGELFSRITRAGRLREEAARHYF  125

Query  659  QQLISAVDFCHSRGVYHRD  715
            +QLISAVDFCHSRGVYHRD
Sbjct  126  RQLISAVDFCHSRGVYHRD  144



>ref|XP_008782631.1| PREDICTED: CBL-interacting protein kinase 18-like [Phoenix dactylifera]
Length=445

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA E K SVL  +YE GR LG GTFAKVY+ARN+ T +S A+KV+ K KV+K G+++QIK
Sbjct  1    MATENKGSVLMQRYEFGRLLGQGTFAKVYYARNIRTSQSVAIKVIDKEKVMKVGLIDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H N+V+LYEVMA+K+KIYF ME V+GGELF K+SKG+L+E++AR YFQQL
Sbjct  61   REISVMRLVRHPNVVQLYEVMATKSKIYFVMEYVKGGELFNKVSKGKLKEDVARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISAVDFCHSRGVYHRD
Sbjct  121  ISAVDFCHSRGVYHRD  136



>ref|XP_010655007.1| PREDICTED: CBL-interacting protein kinase 02 isoform X1 [Vitis 
vinifera]
Length=398

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            S+LHGKYELGR LGHGTFAKVYHARN+  G+S AMKVV K KV+K GMMEQ+KREISVM 
Sbjct  13   SLLHGKYELGRLLGHGTFAKVYHARNLRNGESVAMKVVAKDKVIKVGMMEQMKREISVMK  72

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
             V H NIV+L+EVMASK+KIY AME VRGGELF+KI+KGRLRE+ AR+YFQQLISAV+FC
Sbjct  73   KVSHPNIVQLHEVMASKSKIYLAMEYVRGGELFSKIAKGRLREDAARSYFQQLISAVEFC  132

Query  689  HSRGVYHRD  715
            HSRGV+HRD
Sbjct  133  HSRGVFHRD  141



>ref|NP_001268174.1| CBL-interacting protein kinase 02 [Vitis vinifera]
 emb|CAN73080.1| hypothetical protein VITISV_025694 [Vitis vinifera]
 gb|ACQ83521.1| CBL-interacting protein kinase 05 [Vitis vinifera]
Length=398

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            S+LHGKYELGR LGHGTFAKVYHARN+  G+S AMKVV K KV+K GMMEQ+KREISVM 
Sbjct  13   SLLHGKYELGRLLGHGTFAKVYHARNLRNGESVAMKVVAKDKVIKVGMMEQMKREISVMK  72

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
             V H NIV+L+EVMASK+KIY AME VRGGELF+KI+KGRLRE+ AR+YFQQLISAV+FC
Sbjct  73   KVSHPNIVQLHEVMASKSKIYLAMEYVRGGELFSKIAKGRLREDAARSYFQQLISAVEFC  132

Query  689  HSRGVYHRD  715
            HSRGV+HRD
Sbjct  133  HSRGVFHRD  141



>emb|CAN67244.1| hypothetical protein VITISV_015398 [Vitis vinifera]
 gb|ACQ83518.1| CBL-interacting protein kinase 02, partial [Vitis vinifera]
Length=399

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            S+LHGKYELGR LGHGTFAKVYHARN+  G+S AMKVV K KV+K GMMEQ+KREISVM 
Sbjct  13   SLLHGKYELGRLLGHGTFAKVYHARNLRNGESVAMKVVAKDKVIKVGMMEQMKREISVMK  72

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
             V H NIV+L+EVMASK+KIY AME VRGGELF+KI+KGRLRE+ AR+YFQQLISAV+FC
Sbjct  73   KVSHPNIVQLHEVMASKSKIYLAMEYVRGGELFSKIAKGRLREDAARSYFQQLISAVEFC  132

Query  689  HSRGVYHRD  715
            HSRGV+HRD
Sbjct  133  HSRGVFHRD  141



>ref|XP_010921114.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
Length=448

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA E K SVL  +YELGR LG GTFAKVY+ARN+ T +S A+KV+ K KV+K G+++QIK
Sbjct  1    MATENKGSVLMQRYELGRLLGQGTFAKVYYARNIRTSQSVAIKVIDKEKVLKVGLIDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H N+V+LYEVMA+K+KIYF ME V+GGELF K+SKG+L+E++AR YFQQL
Sbjct  61   REISVMRLVRHPNVVQLYEVMATKSKIYFVMEYVKGGELFNKVSKGKLKEDVARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            I AVDFCHSRGVYHRD
Sbjct  121  IGAVDFCHSRGVYHRD  136



>emb|CDO96812.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   181 bits (458),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  KYELGR LG GTFAKVYHARN+ TG S A+K++ K KV+K G+++QIKREI
Sbjct  2    EKKGTILMQKYELGRLLGQGTFAKVYHARNIKTGLSVAVKIIDKEKVMKVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVMS+VKH N+V+L+EVMASKTKIYFAME V+GGELF K++KGRL+E+ AR YFQQLI+A
Sbjct  62   SVMSLVKHSNVVQLHEVMASKTKIYFAMEFVKGGELFNKVAKGRLKEDAARKYFQQLIAA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRG YHRD
Sbjct  122  VDFCHSRGAYHRD  134



>ref|XP_006449516.1| hypothetical protein CICLE_v10015231mg [Citrus clementina]
 gb|ESR62756.1| hypothetical protein CICLE_v10015231mg [Citrus clementina]
Length=448

 Score =   180 bits (456),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  +L  KYELGR LG GTFAKVYH RN+ TG+S A+K+V K K+++ G+++QIKREI
Sbjct  2    EKKAGILMNKYELGRLLGQGTFAKVYHGRNLKTGQSVAIKIVDKEKILRVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASKTKIYFAME VRGGELF K++KG+LREE+AR YFQQL+ A
Sbjct  62   SVMRLVRHPNIVQLYEVMASKTKIYFAMEYVRGGELFNKVAKGKLREEVARKYFQQLVDA  121

Query  677  VDFCHSRGVYHRD  715
            V+FCHSRGVYHRD
Sbjct  122  VEFCHSRGVYHRD  134



>ref|XP_006468199.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Citrus sinensis]
Length=451

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  +L  KYELGR LG GTFAKVYH RN+ TG+S A+K+V K K+ + G+++QIKREI
Sbjct  2    EKKAGILMNKYELGRLLGQGTFAKVYHGRNLKTGQSVAIKIVDKEKIRRVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASKTKIYFAME VRGGELF K++KG+LREE+AR YFQQL+ A
Sbjct  62   SVMRLVRHPNIVQLYEVMASKTKIYFAMEYVRGGELFNKVAKGKLREEVARKYFQQLVDA  121

Query  677  VDFCHSRGVYHRD  715
            V+FCHSRGVYHRD
Sbjct  122  VEFCHSRGVYHRD  134



>ref|XP_004302573.1| PREDICTED: CBL-interacting protein kinase 2-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YELGR LG GTFAKVYHARN+ T  S A+K++ K +++K GM++QIKREI
Sbjct  2    ENKGSVLMQRYELGRLLGQGTFAKVYHARNLKTNMSVAIKIIDKERILKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H N+VELYEVMASKTKIYF ME V+GGELF K+SKG+L+E++AR YFQQL+SA
Sbjct  62   SVMRLIRHPNVVELYEVMASKTKIYFVMEYVKGGELFDKVSKGKLKEDVARKYFQQLVSA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  122  VDYCHSRGVYHRD  134



>gb|KDO77875.1| hypothetical protein CISIN_1g037702mg [Citrus sinensis]
Length=448

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  +L  KYELGR LG GTFAKVYH RN+ TG+S A+K+V K K+ + G+++QIKREI
Sbjct  2    EKKAGILMNKYELGRLLGQGTFAKVYHGRNLKTGQSVAIKIVDKEKIRRVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASKTKIYFAME VRGGELF K++KG+LREE+AR YFQQL+ A
Sbjct  62   SVMRLVRHPNIVQLYEVMASKTKIYFAMEYVRGGELFNKVAKGKLREEVARKYFQQLVDA  121

Query  677  VDFCHSRGVYHRD  715
            V+FCHSRGVYHRD
Sbjct  122  VEFCHSRGVYHRD  134



>ref|XP_009800912.1| PREDICTED: CBL-interacting protein kinase 5 [Nicotiana sylvestris]
Length=462

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            +E+K ++L  +YE+G+ LG GTFAKVYHARN+ TG+S A+K++ K KV+K G+++QIKRE
Sbjct  5    SEKKGNILMQRYEIGKLLGQGTFAKVYHARNLKTGQSVAVKIIDKEKVMKVGLIDQIKRE  64

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM ++KH N+V+LYEVMASKTKIYFAME VRGGELF K++KGRL+E+ AR YFQQLI+
Sbjct  65   ISVMRLIKHPNVVQLYEVMASKTKIYFAMEYVRGGELFNKVAKGRLKEDAARKYFQQLIA  124

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  125  AVDFCHSRGVYHRD  138



>ref|XP_010912157.1| PREDICTED: LOW QUALITY PROTEIN: CBL-interacting protein kinase 
6-like [Elaeis guineensis]
Length=439

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  293  KLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagm  472
            ++    A+ E  +VLHG+YELGR LGHGTFAKVY ARN+ TGK+ A+KV GK KV++AGM
Sbjct  3    EVSPPTASSEGRAVLHGRYELGRLLGHGTFAKVYLARNLRTGKAVAIKVFGKEKVIQAGM  62

Query  473  mEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-GRLREELAR  649
            MEQ+KREIS+M MV H NIVEL+EVMA+++KIYFAMELVRGGELF +I++ GRL+E++AR
Sbjct  63   MEQVKREISLMKMVTHPNIVELHEVMATRSKIYFAMELVRGGELFTRIARAGRLKEDIAR  122

Query  650  NYFQQLISAVDFCHSRGVYHRD  715
            +YF+QLISA+DFCHSRGVYHRD
Sbjct  123  HYFRQLISAIDFCHSRGVYHRD  144



>ref|XP_008808322.1| PREDICTED: CBL-interacting protein kinase 18-like [Phoenix dactylifera]
Length=446

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA E K SVL  +YE+GR LG G+FAKVY+ARN+ T +S A+KV+ K KV+K G+++QIK
Sbjct  1    MATENKGSVLMQRYEVGRLLGKGSFAKVYYARNIGTSQSVAIKVIDKQKVLKVGLIDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H N+V+LYEVMA+K+KIYF +E V+GGELF K+SKG+L+E++AR YFQQL
Sbjct  61   REISVMRLVRHPNVVQLYEVMATKSKIYFVLEYVKGGELFNKVSKGKLKEDVARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISAVDFCHSRGVYHRD
Sbjct  121  ISAVDFCHSRGVYHRD  136



>ref|XP_009616687.1| PREDICTED: CBL-interacting protein kinase 5 [Nicotiana tomentosiformis]
Length=462

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YE+G+ LG GTFAKVYHARN+ TG+S A+K++ K KV+K G+++QIKREI
Sbjct  6    EKKGNILMQRYEIGKLLGKGTFAKVYHARNLKTGESVAVKIIDKEKVMKVGLIDQIKREI  65

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM ++KH N+V+LYEVMASKTKIYFAME VRGGELF K++KGRL+E+ AR YFQQLI+A
Sbjct  66   SVMRLIKHPNVVQLYEVMASKTKIYFAMEYVRGGELFNKVAKGRLKEDAARKYFQQLIAA  125

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  126  VDFCHSRGVYHRD  138



>ref|XP_010937988.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
Length=446

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            MA E K SVL  +YE+GR LG G+FAKVY+ARN+ T ++ A+KV+ K KV+K G+++QIK
Sbjct  1    MATENKGSVLMQRYEVGRLLGQGSFAKVYYARNIGTSQTVAIKVIDKEKVLKLGLIDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H N+V+LYEVMA+K+KIYF +E V+GGELF K+SKGRL+E++AR YFQQL
Sbjct  61   REISVMRLVRHPNVVQLYEVMATKSKIYFVLEYVKGGELFHKVSKGRLKEDVARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISAVDFCHSRGVYHRD
Sbjct  121  ISAVDFCHSRGVYHRD  136



>gb|AFW90522.1| CBL-interacting serine/threonine-protein kinase 6-like protein 
[Phaseolus vulgaris]
Length=438

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +LHGKYELGR LGHGTFAKVYHARN+ +GKS AMKVVGK KV+K GMMEQIKREIS M+M
Sbjct  16   LLHGKYELGRLLGHGTFAKVYHARNLKSGKSVAMKVVGKEKVMKVGMMEQIKREISAMNM  75

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            VKH +IV+L+EVMASK+KIY AMELVRGG+LF KI +GRLR+E  R YFQQL+SAVDFC 
Sbjct  76   VKHPSIVQLHEVMASKSKIYIAMELVRGGQLFNKIPRGRLRKETPRLYFQQLVSAVDFCQ  135

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  136  SRGVYHRD  143



>ref|XP_006830261.1| PREDICTED: CBL-interacting protein kinase 5 [Amborella trichopoda]
 gb|ERM97677.1| hypothetical protein AMTR_s00130p00110630 [Amborella trichopoda]
Length=454

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            ++K ++L  KYELGR LG GTFAKVY+ARN+ T +S A+KV+ K K++K GM++QIKREI
Sbjct  2    QKKGTILMQKYELGRLLGQGTFAKVYYARNLATAQSVAIKVIDKEKILKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+LYEVMASKTKIYF ME V+GGELF K++KG+L+EE+AR YFQQL+SA
Sbjct  62   SVMRLVRHSNVVQLYEVMASKTKIYFCMEYVKGGELFNKVAKGKLKEEIARKYFQQLVSA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_010942099.1| PREDICTED: CBL-interacting protein kinase 6 [Elaeis guineensis]
Length=447

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = +2

Query  311  AAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKR  490
             A E  SVLHG+YELGR LG GTFAKVY ARN+ TGKS AMKVVGK KV++ GMMEQ+KR
Sbjct  9    PAAEGKSVLHGRYELGRVLGRGTFAKVYLARNLRTGKSVAMKVVGKEKVIRVGMMEQVKR  68

Query  491  EISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-GRLREELARNYFQQL  667
            EISVM MV H NIVEL+EVMA+++KI+FAMELVRGGELF++I++ GRLREE AR+YF+QL
Sbjct  69   EISVMKMVTHPNIVELHEVMATRSKIFFAMELVRGGELFSRIARAGRLREETARHYFRQL  128

Query  668  ISAVDFCHSRGVYHRD  715
            ISAVDFCHSRGVYHRD
Sbjct  129  ISAVDFCHSRGVYHRD  144



>ref|NP_001147901.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 gb|ACG29067.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 gb|AFW77803.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=459

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M AE+  ++L  KYE+G+ LG GTFAKVYHARN+ T +S A+KV+ K K+ K G+MEQIK
Sbjct  2    MEAEKNGNILMQKYEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIK  61

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H NIV+LYEVMA+K+KIYF +E V+GGELF KI+KG+LRE+ +R YFQQL
Sbjct  62   REISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDASRKYFQQL  121

Query  668  ISAVDFCHSRGVYHRD  715
            +SAVDFCHSRGVYHRD
Sbjct  122  VSAVDFCHSRGVYHRD  137



>ref|XP_004962439.1| PREDICTED: CBL-interacting protein kinase 18-like isoform X2 
[Setaria italica]
Length=390

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M AE+  ++L  +YE+G+ LG GTFAKVYHARN+ T +S A+KV+ K K+ K G+MEQIK
Sbjct  2    MEAEKNGNILMQRYEVGKLLGQGTFAKVYHARNIVTSQSVAIKVIDKDKIFKVGLMEQIK  61

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H NI++LYEVMA+K+KIYF +E V+GGELF KI+KG+LRE+ AR YFQQL
Sbjct  62   REISVMKLVRHPNIIQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDAARKYFQQL  121

Query  668  ISAVDFCHSRGVYHRD  715
            +SAVDFCHSRGVYHRD
Sbjct  122  VSAVDFCHSRGVYHRD  137



>gb|AEW07563.1| hypothetical protein 0_5117_01, partial [Pinus radiata]
 gb|AFG53107.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53109.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53117.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53119.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53120.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
Length=150

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L GKYELGR LGHGTFAKVYHARN+ TG+S A+K + K K++K GM+E IKREI
Sbjct  4    ETKPNILMGKYELGRLLGHGTFAKVYHARNLKTGESVAIKAMDKEKILKVGMIEPIKREI  63

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKIS-KGRLREELARNYFQQLIS  673
            SVM +V+H NIV LYEVMASK+KIY  ME V+GGELF +++ KG+L EE AR YFQQLI 
Sbjct  64   SVMKLVRHPNIVRLYEVMASKSKIYIVMEYVKGGELFNRVAKKGKLEEEEARKYFQQLIC  123

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  124  AVDFCHSRGVYHRD  137



>ref|XP_004295578.2| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Fragaria vesca subsp. vesca]
Length=464

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (85%), Gaps = 5/142 (4%)
 Frame = +2

Query  290  SKLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkag  469
            SK+E++     K ++L  KYELGR LG GTFAKVYHARN+ TG+S A+K++ K KV + G
Sbjct  2    SKMENK-----KANILMHKYELGRLLGKGTFAKVYHARNLRTGQSVAIKIIDKEKVQQVG  56

Query  470  mmEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELAR  649
            +++QIKREISVM +V+H N+V+LYEVMASKTKIYFAME V+GGELF K++KG+L+E++AR
Sbjct  57   LIDQIKREISVMRLVRHPNVVQLYEVMASKTKIYFAMEYVKGGELFNKVAKGKLKEDIAR  116

Query  650  NYFQQLISAVDFCHSRGVYHRD  715
             YFQQLI AVD+CHSRGVYHRD
Sbjct  117  KYFQQLIGAVDYCHSRGVYHRD  138



>gb|EMT16422.1| CBL-interacting protein kinase 2 [Aegilops tauschii]
Length=454

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
             E+K ++L GKYE+G+ LG GTFAKVYHARN+ T +S A+KV  K KV+K G+ +QIKRE
Sbjct  2    GEQKGNILMGKYEMGKMLGQGTFAKVYHARNIETSQSVAIKVTDKEKVLKGGLTDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +VKH NIV++YEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVKHPNIVQMYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>gb|EMS54742.1| CBL-interacting protein kinase 2 [Triticum urartu]
Length=452

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
             E+K ++L GKYE+G+ LG GTFAKVYHARN+ T +S A+KV  K KV+K G+ +QIKRE
Sbjct  2    GEQKGNILMGKYEMGKMLGQGTFAKVYHARNIETSQSVAIKVTDKEKVLKGGLTDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +VKH NIV++YEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVKHPNIVQMYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_006643890.1| PREDICTED: CBL-interacting protein kinase 5-like [Oryza brachyantha]
Length=461

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELGR LG GTFAKVYHARN+ + +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    EKKVSILMNRYELGRMLGQGTFAKVYHARNLASNQSVAIKVIDKEKVLRIGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+L+EVMASK+KIYFAME VRGGELF+++++GRL+E+ AR YFQQLI A
Sbjct  62   SVMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGELFSRVARGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|AJR22379.1| CBL-interacting protein kinase 2 [Triticum aestivum]
Length=456

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
             E+K ++L GKYE+G+ LG GTFAKVYHARN+ T +S A+KV  K KV+K G+ +QIKRE
Sbjct  2    GEQKGNILMGKYEMGKMLGQGTFAKVYHARNIETSQSVAIKVTDKEKVLKGGLTDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +VKH NIV++YEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVKHPNIVQMYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_011623073.1| PREDICTED: CBL-interacting protein kinase 5 [Amborella trichopoda]
 ref|XP_011623074.1| PREDICTED: CBL-interacting protein kinase 5 [Amborella trichopoda]
 ref|XP_011623075.1| PREDICTED: CBL-interacting protein kinase 5 [Amborella trichopoda]
 gb|ERN05398.1| hypothetical protein AMTR_s00007p00220190 [Amborella trichopoda]
Length=461

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YELGR LG GTFAKVY+ARN+ +G+  A+KVV K KV+K G++EQIKREI
Sbjct  2    ENKGSVLMQRYELGRLLGQGTFAKVYYARNLKSGQRVAIKVVDKEKVLKVGLIEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASK+KIYFAME V+GGELF K++KG+L E++AR YFQQLISA
Sbjct  62   SVMRLVRHPNIVQLYEVMASKSKIYFAMEYVKGGELFNKVAKGKLIEDMARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|AJR22385.1| CBL-interacting protein kinase 27 [Triticum aestivum]
Length=447

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +2

Query  305  EMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQI  484
            E AAE K +VL G+YELGR LGHG F +V+ AR++HTG+  A+KVV K KV +AGM+EQI
Sbjct  2    EDAAEGKTNVLQGRYELGRVLGHGNFGRVHAARDLHTGRGVAVKVVAKDKVERAGMVEQI  61

Query  485  KREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-GRLREELARNYFQ  661
            KREI+VM MV H NIVEL+EV+A++TKIY A+ELVRGGELFA+IS+ GRLRE++AR YF+
Sbjct  62   KREIAVMKMVSHPNIVELHEVLATRTKIYLALELVRGGELFARISRAGRLREDVARRYFR  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCH RGVYHRD
Sbjct  122  QLISAVDFCHGRGVYHRD  139



>gb|AFG53106.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53108.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53110.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53111.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53112.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53113.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53114.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53115.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53116.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53118.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53122.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
 gb|AFG53123.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
Length=150

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L GKYELGR LGHGTFAKVYHARN+ TG+S A+K + K K++K GM+E IKREI
Sbjct  4    ETKPNILMGKYELGRLLGHGTFAKVYHARNLKTGESVAIKAMDKEKILKVGMIEPIKREI  63

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAK-ISKGRLREELARNYFQQLIS  673
            SVM +V+H NIV LYEVMASK+KIY  ME V+GGELF + + KG+L EE AR YFQQLI 
Sbjct  64   SVMKLVRHPNIVRLYEVMASKSKIYIVMEYVKGGELFNRVVKKGKLEEEEARKYFQQLIC  123

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  124  AVDFCHSRGVYHRD  137



>ref|XP_002522223.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
 gb|EEF40081.1| CBL-interacting serine/threonine-protein kinase, putative [Ricinus 
communis]
Length=459

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YELGR LG GTFAKVYHARN+ + +S A+K++ K KV+K+G+++QIKREI
Sbjct  2    EKKGAILMNRYELGRLLGKGTFAKVYHARNLQSNQSVAIKIIDKEKVLKSGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASKTKIYFAME V+GGELF K++KG+L+E++AR YFQQLI A
Sbjct  62   SVMRLVRHPNIVQLYEVMASKTKIYFAMEYVKGGELFNKVAKGKLKEDVARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            V+FCHSRGVYHRD
Sbjct  122  VEFCHSRGVYHRD  134



>ref|XP_010042675.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like, 
partial [Eucalyptus grandis]
Length=253

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K   L  +YE+GR LG GTFAKVYH RN+ TG++ A+K++ K KV++ G+++QIKREI
Sbjct  2    EKKGVTLMHRYEVGRLLGQGTFAKVYHGRNLKTGQNVAIKIIDKEKVLRVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASKTKIYFAME V+GGELF K++KG+L+E++AR YFQQLI A
Sbjct  62   SVMRLVRHPNIVQLYEVMASKTKIYFAMEYVKGGELFNKVAKGKLKEDMARKYFQQLIEA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|NP_001042345.1| Os01g0206700 [Oryza sativa Japonica Group]
 sp|Q9LWM4.1|CIPK5_ORYSJ RecName: Full=CBL-interacting protein kinase 5; AltName: Full=OsCIPK05 
[Oryza sativa Japonica Group]
 dbj|BAA92972.1| putative CBL-interacting protein kinase 2 [Oryza sativa Japonica 
Group]
 dbj|BAB92151.1| putative CBL-interacting protein kinase 2 [Oryza sativa Japonica 
Group]
 dbj|BAF04259.1| Os01g0206700 [Oryza sativa Japonica Group]
 gb|EAY72961.1| hypothetical protein OsI_00833 [Oryza sativa Indica Group]
 gb|EAZ10972.1| hypothetical protein OsJ_00815 [Oryza sativa Japonica Group]
 gb|ACD76976.1| CBL-interacting protein kinase 5 [Oryza sativa Japonica Group]
 dbj|BAG89574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELGR LG GTFAKVYHARN+ + +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    EKKASILMNRYELGRMLGQGTFAKVYHARNLASNQSVAIKVIDKEKVLRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M +V+H NIV+L+EVMASK+KIYFAME VRGGELF+++++GRL+E+ AR YFQQLI A
Sbjct  62   SIMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGELFSRVARGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_004962438.1| PREDICTED: CBL-interacting protein kinase 18-like isoform X1 
[Setaria italica]
Length=459

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M AE+  ++L  +YE+G+ LG GTFAKVYHARN+ T +S A+KV+ K K+ K G+MEQIK
Sbjct  2    MEAEKNGNILMQRYEVGKLLGQGTFAKVYHARNIVTSQSVAIKVIDKDKIFKVGLMEQIK  61

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H NI++LYEVMA+K+KIYF +E V+GGELF KI+KG+LRE+ AR YFQQL
Sbjct  62   REISVMKLVRHPNIIQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDAARKYFQQL  121

Query  668  ISAVDFCHSRGVYHRD  715
            +SAVDFCHSRGVYHRD
Sbjct  122  VSAVDFCHSRGVYHRD  137



>gb|KJB60217.1| hypothetical protein B456_009G294400 [Gossypium raimondii]
Length=441

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K  VL  KYE GR LG G FAKVY+ARN+ T +S A+KV+ K KV+K GMM+Q KREI
Sbjct  2    ENKGKVLMHKYEFGRLLGQGNFAKVYYARNIKTSQSVAVKVIDKGKVLKVGMMDQTKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVMS+VKH NI+ELYEVMASK KIYF ME  +GGELF K+SKG+LRE++AR YFQQLISA
Sbjct  62   SVMSLVKHPNILELYEVMASKNKIYFVMEYAKGGELFKKVSKGKLREDMARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|AJR22390.1| CBL-interacting protein kinase 5 [Triticum aestivum]
Length=464

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  +YELGR LG GTFAKVYHAR++ T +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    ERKSAILMNRYELGRMLGQGTFAKVYHARSLATNQSVAIKVIDKEKVLRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M +V+H NIV+L+EVMASKTKIYFAME VRGGELFA+++KGRL+E+ AR YFQQLI A
Sbjct  62   SIMRLVRHPNIVQLHEVMASKTKIYFAMEYVRGGELFARVTKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSR VYHRD
Sbjct  122  VDFCHSRDVYHRD  134



>ref|XP_010683541.1| PREDICTED: CBL-interacting protein kinase 18-like [Beta vulgaris 
subsp. vulgaris]
Length=447

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            AE K ++L  +YELG+ LG GTFAKVY ARN+ +  SSA+K+V K  V+K GM+EQIKRE
Sbjct  2    AENKVTILMQRYELGKLLGQGTFAKVYFARNIKSDASSAIKIVDKETVLKVGMIEQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +VKH N+V+LYEVMASK KIYF ME VRGGELF K++KG+L+E +AR YFQQLIS
Sbjct  62   ISVMRLVKHPNVVQLYEVMASKAKIYFVMEYVRGGELFNKVAKGKLKENIARKYFQQLIS  121

Query  674  AVDFCHSRGVYHRD  715
            AVD+CHSRGVYHRD
Sbjct  122  AVDYCHSRGVYHRD  135



>ref|XP_002439570.1| hypothetical protein SORBIDRAFT_09g013580 [Sorghum bicolor]
 gb|ACQ83509.1| CBL-interacting protein kinase 15 [Sorghum bicolor]
 gb|EES18000.1| hypothetical protein SORBIDRAFT_09g013580 [Sorghum bicolor]
Length=431

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  E+  ++L  +YE+G+ LG GTFAKVYHARN+ T +S A+KV+ K K+ K G+MEQIK
Sbjct  2    METEKNGNILMHRYEVGKLLGQGTFAKVYHARNIETSQSVAIKVIDKDKIFKVGLMEQIK  61

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H NIV+LYEVMA+K+KIYF +E V+GGELF KI+KG+LRE+ AR YFQQL
Sbjct  62   REISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKIAKGKLREDPARKYFQQL  121

Query  668  ISAVDFCHSRGVYHRD  715
            +SAVDFCHSRGVYHRD
Sbjct  122  VSAVDFCHSRGVYHRD  137



>ref|XP_004234086.1| PREDICTED: CBL-interacting protein kinase 5-like [Solanum lycopersicum]
Length=465

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
             E+K ++L  KYE+G+ LG GTFAKVY+ARN+ TG+  A+KV+ K KV+K G+++QIKRE
Sbjct  9    TEKKGTILLHKYEIGKLLGQGTFAKVYYARNLKTGQIVAVKVIDKEKVMKVGLIDQIKRE  68

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +++H N+VELYEVMASKTKIYFAME VRGGELF K++KGRLRE  AR YFQQLI+
Sbjct  69   ISVMRLIRHPNVVELYEVMASKTKIYFAMEYVRGGELFNKVAKGRLRESAARKYFQQLIA  128

Query  674  AVDFCHSRGVYHRD  715
            +VDFCHSRGVYHRD
Sbjct  129  SVDFCHSRGVYHRD  142



>ref|XP_004150214.1| PREDICTED: CBL-interacting protein kinase 5 [Cucumis sativus]
 gb|KGN65626.1| hypothetical protein Csa_1G470420 [Cucumis sativus]
Length=463

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELGR LG GTFAKVYHARN+ +G+S A+K++ K KV++ G+++QIKREI
Sbjct  2    EKKGSILMQRYELGRMLGQGTFAKVYHARNLKSGQSVAIKIIDKEKVLRVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+LYEVMAS+TKIYFAME VRGGELF K++KG+L+E+ AR YFQQLI A
Sbjct  62   SVMRLVRHPNVVQLYEVMASRTKIYFAMEYVRGGELFNKVAKGKLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  122  VDYCHSRGVYHRD  134



>gb|EMT28985.1| CBL-interacting protein kinase 5 [Aegilops tauschii]
Length=464

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  +YELGR LG GTFAKVYHAR++ T +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    ERKSTILMNRYELGRMLGQGTFAKVYHARSLATNQSVAIKVIDKEKVLRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M +V+H NIV+L+EVMASKTKIYFAME VRGGELFA+++KGRL+E+ AR YFQQLI A
Sbjct  62   SIMRLVRHPNIVQLHEVMASKTKIYFAMEYVRGGELFARVAKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSR VYHRD
Sbjct  122  VDFCHSRDVYHRD  134



>gb|ABK24914.1| unknown [Picea sitchensis]
Length=426

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L G+YELGR LG GTFAKVY+A+ + TG+S A+KV+ K K++K GM+EQIKREI
Sbjct  2    EMKPNILMGRYELGRLLGQGTFAKVYYAKTLKTGESVAIKVMDKEKILKVGMIEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV LYEVMASK+KIYF ME V+GGELF K++KGRL+EE AR YFQQLISA
Sbjct  62   SVMRLVRHPNIVRLYEVMASKSKIYFVMEYVKGGELFNKVAKGRLKEEEARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_009415683.1| PREDICTED: uncharacterized protein LOC103996486 [Musa acuminata 
subsp. malaccensis]
Length=1092

 Score =   181 bits (459),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 93/133 (70%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E++ +VL  +YELGR LG GTFAKVYHARNV TG + A+K++ K K+++ GM++QIKREI
Sbjct  2    EKRGTVLLQRYELGRLLGQGTFAKVYHARNVATGLAVAIKIIDKEKILRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V H NIV+LYEVMA++TKIYFAME VRGGELF K++KGRL+E++AR YFQQLI+A
Sbjct  62   SVMRLVHHPNIVQLYEVMATRTKIYFAMEYVRGGELFNKVAKGRLKEDVARKYFQQLIAA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|AAD31900.1|AF145482_1 putative serine/threonine protein kinase [Mesembryanthemum crystallinum]
Length=462

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 125/150 (83%), Gaps = 5/150 (3%)
 Frame = +2

Query  269  RIEKEKNSKLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgk  448
            +I++++N   E+EM    K   L GKYELGR LG GTFA+VYHARN+ TG S A+KVV K
Sbjct  11   QIKEDRNVSRETEM----KHPALQGKYELGRVLGQGTFARVYHARNLVTGNSLAIKVVAK  66

Query  449  xkvvkagmmEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-G  625
             KV+K GMMEQ+KREISVM  VKH NIV+L+EVMASK+KIY AM+LVRGGELF+K+SK G
Sbjct  67   DKVIKVGMMEQMKREISVMKRVKHPNIVQLHEVMASKSKIYLAMDLVRGGELFSKVSKGG  126

Query  626  RLREELARNYFQQLISAVDFCHSRGVYHRD  715
            +L E++AR+YF+QLISAVDFCHSRGVYHRD
Sbjct  127  KLDEDVARSYFKQLISAVDFCHSRGVYHRD  156



>ref|XP_006358155.1| PREDICTED: CBL-interacting protein kinase 5-like [Solanum tuberosum]
Length=459

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YE+G+ LG GTFAKVYHARN+ TG+S A+KV+ K K++K G+++Q KREI
Sbjct  7    EKKGNILMQRYEIGKLLGQGTFAKVYHARNLKTGQSVAIKVIDKEKIMKVGLIDQTKREI  66

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM ++KH NIV+LYEVMASKTKIYFAME VRGGELF K++KGRL+E+ AR YFQQLI+A
Sbjct  67   SVMRLIKHPNIVQLYEVMASKTKIYFAMEYVRGGELFNKVAKGRLKEDAARKYFQQLIAA  126

Query  677  VDFCHSRGVYHRD  715
            VDFCHSR VYHRD
Sbjct  127  VDFCHSRDVYHRD  139



>ref|XP_008225305.1| PREDICTED: CBL-interacting protein kinase 5 [Prunus mume]
Length=464

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            ++K ++L  KYELGR LG GTFAKVYHARN+ +G+S A+KV+ K KV + G+++QIKREI
Sbjct  3    KKKGNILMNKYELGRLLGQGTFAKVYHARNLRSGQSVAIKVIDKEKVQQVGLIDQIKREI  62

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+L+EVMASKTKIYFAME VRGGELF K++KG+L+E++AR YFQQL+ A
Sbjct  63   SVMRLVRHPNVVQLFEVMASKTKIYFAMEYVRGGELFNKVAKGKLKEDVARKYFQQLVGA  122

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  123  VDYCHSRGVYHRD  135



>ref|XP_007211421.1| hypothetical protein PRUPE_ppa005365mg [Prunus persica]
 gb|EMJ12620.1| hypothetical protein PRUPE_ppa005365mg [Prunus persica]
Length=464

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            ++K ++L  KYELGR LG GTFAKVYHARN+ +G+S A+KV+ K KV + G+++QIKREI
Sbjct  3    KKKGNILMNKYELGRLLGQGTFAKVYHARNLRSGQSVAIKVIDKEKVQQVGLIDQIKREI  62

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+L+EVMASKTKIYFAME VRGGELF K++KG+L+E++AR YFQQL+ A
Sbjct  63   SVMRLVRHPNVVQLFEVMASKTKIYFAMEYVRGGELFNKVAKGKLKEDVARKYFQQLVGA  122

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  123  VDYCHSRGVYHRD  135



>ref|XP_009373129.1| PREDICTED: CBL-interacting protein kinase 2-like [Pyrus x bretschneideri]
Length=491

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YELGR LG GTFAKV+HARN+ TG S A+K++ K +++K GM++QIKREI
Sbjct  2    ENKGSVLMQRYELGRILGQGTFAKVHHARNLKTGMSVAIKIIDKERILKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM ++KH N+VELYEVMASKTKIYF ME V+GGELF K+SKG+L+E++AR YFQQLISA
Sbjct  62   SVMRLIKHPNVVELYEVMASKTKIYFVMEYVKGGELFNKVSKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_010252111.1| PREDICTED: CBL-interacting protein kinase 18-like [Nelumbo nucifera]
Length=444

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YELGR LG GTFAKVY+ARN+ TG+S A+KV+ K KV+K G+++QIKREI
Sbjct  2    ENKGSVLMQRYELGRLLGQGTFAKVYYARNLKTGQSVAIKVIDKEKVLKVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASK+KIYF ME  +GGELF K++KG+L+E++AR YFQQLISA
Sbjct  62   SVMRLVRHPNIVQLYEVMASKSKIYFVMEYCKGGELFNKVAKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|AFG53121.1| hypothetical protein 0_5117_01, partial [Pinus taeda]
Length=150

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L GKYELGR LGHGTFAKVYHA+N+ TG+S A+K + K K++K GM+E IKREI
Sbjct  4    ETKPNILMGKYELGRLLGHGTFAKVYHAKNLKTGESVAIKAMDKEKILKVGMIEPIKREI  63

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAK-ISKGRLREELARNYFQQLIS  673
            SVM +V+H NIV LYEVMASK+KIY  ME V+GGELF + + KG+L EE AR YFQQLI 
Sbjct  64   SVMKLVRHPNIVRLYEVMASKSKIYIVMEYVKGGELFNRVVKKGKLEEEEARKYFQQLIC  123

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  124  AVDFCHSRGVYHRD  137



>ref|XP_004958693.1| PREDICTED: CBL-interacting protein kinase 2-like isoform X2 [Setaria 
italica]
Length=381

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            AE+K +VL  KYE+G+ LG GTFAKVY ARN  T +S A+KV+ K KV+K G+++QIKRE
Sbjct  2    AEQKGNVLMQKYEMGKMLGQGTFAKVYRARNTKTSESVAIKVIDKEKVMKVGLIDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +V+H NIV+LYEVMA+KTKIYF +E VRGGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVRGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_008783865.1| PREDICTED: CBL-interacting protein kinase 6-like [Phoenix dactylifera]
Length=439

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +2

Query  293  KLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagm  472
            ++    A+    +VLHG+YELGR LGHG+FAKVY ARN+ TGKS A+KVVGK KV++AGM
Sbjct  3    EVSPPTASSAGGTVLHGRYELGRLLGHGSFAKVYLARNLRTGKSVAIKVVGKEKVIRAGM  62

Query  473  mEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-GRLREELAR  649
            ME +KREISVM MV H NIVEL+EVMA+++KIYFAMELVRGGELFA+I++ GRL+E+ AR
Sbjct  63   MEHVKREISVMKMVTHPNIVELHEVMATRSKIYFAMELVRGGELFARIARSGRLKEDAAR  122

Query  650  NYFQQLISAVDFCHSRGVYHRD  715
            +YF+QLISAVDFCHSRGVYHRD
Sbjct  123  HYFRQLISAVDFCHSRGVYHRD  144



>gb|EYU41998.1| hypothetical protein MIMGU_mgv1a006238mg [Erythranthe guttata]
Length=451

 Score =   175 bits (443),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELG+ LG GTFAKVYHAR++ TG + A+KV+ K K++K  +M+QIKREI
Sbjct  2    EKKGSILMQRYELGKLLGQGTFAKVYHARDIKTGATVAIKVINKKKILKVDLMDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVMS+V+H NIV+LYEVMA+K KIYF +E V+GGELF K++KG+L+E+ AR YFQQLISA
Sbjct  62   SVMSLVRHPNIVQLYEVMATKEKIYFVIEYVKGGELFNKVAKGKLKEDAARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_003590281.1| CBL-interacting protein kinase, partial [Medicago truncatula]
Length=307

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  KYE+GR LG G+FAKVYHARN+ TG++ A+KV  K  ++K G+ EQIKREI
Sbjct  2    ENKGTILMQKYEVGRMLGQGSFAKVYHARNLKTGQNVAIKVFDKAMIMKVGLKEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIVE YEVMASKTKIYFAME V+GGELF K+S+G+LRE++AR YFQQLI+A
Sbjct  62   SVMRLVRHPNIVEFYEVMASKTKIYFAMEQVKGGELFHKVSRGKLREDMARKYFQQLIAA  121

Query  677  VDFCHSRGVYHRD  715
            VD CH RG+YHRD
Sbjct  122  VDHCHRRGIYHRD  134



>ref|XP_008803093.1| PREDICTED: CBL-interacting protein kinase 5 isoform X3 [Phoenix 
dactylifera]
Length=440

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELGR +G GTFAKVYHARN+ +G+S A+K++ K K ++ GM++QIKREI
Sbjct  2    EKKGSILMHRYELGRMVGQGTFAKVYHARNITSGQSVAIKIISKEKALRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            +VM +V+H NIV+LYEVMASKTKIYF ME V+GGELF K++KGRL+E+ AR YFQQLI A
Sbjct  62   AVMRLVRHPNIVQLYEVMASKTKIYFVMEYVKGGELFNKVAKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>dbj|BAJ86283.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +2

Query  305  EMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQI  484
            E AAE K +VL GKYELGR LGHG F +V+ AR++ TG+  A+KVV K KV +AGM+EQI
Sbjct  2    EDAAEGKTNVLQGKYELGRVLGHGNFGRVHAARDLRTGRGVAVKVVAKDKVERAGMVEQI  61

Query  485  KREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-GRLREELARNYFQ  661
            KREI+VM MV H NIVEL+EV+A++TKIY A+ELVRGGELFA+IS+ GRLRE++AR YF+
Sbjct  62   KREIAVMKMVSHPNIVELHEVLATRTKIYLALELVRGGELFARISRAGRLREDVARRYFR  121

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISAVDFCH RGVYHRD
Sbjct  122  QLISAVDFCHGRGVYHRD  139



>ref|XP_009386828.1| PREDICTED: CBL-interacting protein kinase 6-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            + E  SVLHG+YELGR +G GTF KV+ ARN+ TGKS A+KVVGK KV++ GMMEQ+KRE
Sbjct  10   SSEGRSVLHGRYELGRVIGQGTFGKVHLARNLLTGKSVAIKVVGKEKVIQVGMMEQVKRE  69

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISK-GRLREELARNYFQQLI  670
            ISVM MV+H NIVELYEVMA+++KIYF MELVRGGELFAK+++ GRLRE+ ARNYF+QL+
Sbjct  70   ISVMKMVRHPNIVELYEVMATRSKIYFVMELVRGGELFAKVARSGRLREDAARNYFRQLV  129

Query  671  SAVDFCHSRGVYHRD  715
            SA+DFCH RGVYHRD
Sbjct  130  SAIDFCHGRGVYHRD  144



>ref|XP_003562454.1| PREDICTED: CBL-interacting protein kinase 2 [Brachypodium distachyon]
Length=446

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  KYE+G+ LG GTFAKVYHARN+ T +S A+KV  K KV+K G+ +QIKREI
Sbjct  3    EQKGNILMQKYEMGKMLGQGTFAKVYHARNIQTSQSVAIKVTDKEKVLKGGLTDQIKREI  62

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV++YEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI A
Sbjct  63   SVMKLVKHPNIVQMYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLICA  122

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  123  VDFCHSRGVYHRD  135



>gb|AIZ68214.1| CBL-interacting protein kinase 18-like protein [Ornithogalum 
saundersiae]
Length=473

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  + K S+L  +YE+GR LG GTFAKVYHARN+ T +S A+KV+ K KV+K G+++QIK
Sbjct  1    MGTDMKGSILMQRYEVGRMLGQGTFAKVYHARNLKTSQSVAIKVIDKEKVLKVGLIDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H +IV+LYEVMA+KTKIYF +E V+GGELF K++KG+L+E++AR YFQQL
Sbjct  61   REISVMRLVRHPHIVQLYEVMATKTKIYFVLEYVKGGELFNKVAKGKLKEDVARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            ISAVDFCHSRGVYHRD
Sbjct  121  ISAVDFCHSRGVYHRD  136



>ref|XP_004233056.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Solanum lycopersicum]
Length=460

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            ++K ++L  +YE+G+ LG GTFAKVYHARN+ TG+S A+KV+ K K++K G+++Q KREI
Sbjct  6    DKKGNILMQRYEIGKLLGQGTFAKVYHARNLKTGQSVAIKVIDKEKIMKVGLIDQTKREI  65

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM ++KH NIV+LYEVMASKTKIYFAME VRGGELF K++KGRL+E+ AR YFQQLI+A
Sbjct  66   SVMRLIKHPNIVQLYEVMASKTKIYFAMEYVRGGELFNKVAKGRLKEDAARKYFQQLIAA  125

Query  677  VDFCHSRGVYHRD  715
            VDFCHSR VYHRD
Sbjct  126  VDFCHSRDVYHRD  138



>emb|CDM82235.1| unnamed protein product [Triticum aestivum]
Length=464

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  +YELGR LG GTFAKVYHAR++ T +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    ERKSTILMNRYELGRMLGQGTFAKVYHARSLATNQSVAIKVIDKEKVLRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M +V+H NIV+L+EVMASK+KIYFAME VRGGELFA+++KGRL+E+ AR YFQQLI A
Sbjct  62   SIMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGELFARVAKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSR VYHRD
Sbjct  122  VDFCHSRDVYHRD  134



>ref|XP_008801610.1| PREDICTED: CBL-interacting protein kinase 5 isoform X1 [Phoenix 
dactylifera]
Length=458

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELGR +G GTFAKVYHARN+ +G+S A+K++ K K ++ GM++QIKREI
Sbjct  2    EKKGSILMHRYELGRMVGQGTFAKVYHARNITSGQSVAIKIISKEKALRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            +VM +V+H NIV+LYEVMASKTKIYF ME V+GGELF K++KGRL+E+ AR YFQQLI A
Sbjct  62   AVMRLVRHPNIVQLYEVMASKTKIYFVMEYVKGGELFNKVAKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_008443358.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Cucumis melo]
Length=463

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELGR LG GTFAKVYHARN+ +G+S A+K++ K KV++ G+++QIKREI
Sbjct  2    EKKGSILMQRYELGRMLGQGTFAKVYHARNLKSGQSVAIKIIDKEKVLRVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+LYEVMAS+TKIYFAME V+GGELF K++KG+L+E+ AR YFQQLI A
Sbjct  62   SVMRLVRHPNVVQLYEVMASRTKIYFAMEYVKGGELFNKVAKGKLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  122  VDYCHSRGVYHRD  134



>ref|XP_008802343.1| PREDICTED: CBL-interacting protein kinase 5 isoform X2 [Phoenix 
dactylifera]
Length=443

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K S+L  +YELGR +G GTFAKVYHARN+ +G+S A+K++ K K ++ GM++QIKREI
Sbjct  2    EKKGSILMHRYELGRMVGQGTFAKVYHARNITSGQSVAIKIISKEKALRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            +VM +V+H NIV+LYEVMASKTKIYF ME V+GGELF K++KGRL+E+ AR YFQQLI A
Sbjct  62   AVMRLVRHPNIVQLYEVMASKTKIYFVMEYVKGGELFNKVAKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|NP_001268154.1| CBL-interacting protein kinase 07 [Vitis vinifera]
 ref|XP_010653329.1| PREDICTED: CBL-interacting protein kinase 07 isoform X1 [Vitis 
vinifera]
 emb|CAN81218.1| hypothetical protein VITISV_040419 [Vitis vinifera]
 gb|ACQ83523.1| CBL-interacting protein kinase 07 [Vitis vinifera]
Length=462

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E   S+L  +YELG+ LG GTFAKV+HARN+ TG S A+K++ K K++K GM++QIKREI
Sbjct  2    ENNGSILMQRYELGKLLGQGTFAKVHHARNLKTGTSVAIKIIDKEKILKVGMVDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+VELYEVMASKTKIYF ME  +GGELF K++KG+L+E++AR YFQQLISA
Sbjct  62   SVMRLVRHPNVVELYEVMASKTKIYFVMEYAKGGELFNKVAKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_011095114.1| PREDICTED: CBL-interacting protein kinase 2 [Sesamum indicum]
Length=471

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K S+L  +YELG+ LG GTFAKVYHAR++ TG S A+K++ K K++K GMM+QIKREI
Sbjct  2    ESKGSILMYRYELGKLLGQGTFAKVYHARDIKTGTSVAIKIIDKEKIMKVGMMDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+LYEVMASK KIYF ME VRGGELF K++KG+++E+ AR YFQQLISA
Sbjct  62   SVMRLVRHPNVVQLYEVMASKAKIYFVMEYVRGGELFNKVAKGKMKEDAARRYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>dbj|BAK07613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  +YELGR LG GTFAKVYHAR++ T +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    ERKSTILMNRYELGRMLGQGTFAKVYHARSLATNQSVAIKVIDKEKVLRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M +V+H NIV+L+EVMASK+KIYFAME VRGGELFA+++KGRL+E+ AR YFQQLI A
Sbjct  62   SIMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGELFARVAKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSR VYHRD
Sbjct  122  VDFCHSRDVYHRD  134



>ref|XP_008374611.1| PREDICTED: CBL-interacting protein kinase 2-like [Malus domestica]
Length=450

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K  +L  KYE+GR LG G FAKVYHARN+ TG S A+KV+ K KV+K G+++Q KREI
Sbjct  2    ENKGKILMQKYEIGRMLGQGNFAKVYHARNLQTGHSVAIKVINKEKVLKVGLIDQTKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV+L+EVMA+KTKIYF +E V+GGELF K+SKGRL+EE+AR YFQQLISA
Sbjct  62   SVMRLVKHPNIVQLFEVMATKTKIYFVLEYVKGGELFHKVSKGRLKEEMARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_008789399.1| PREDICTED: CBL-interacting protein kinase 5-like [Phoenix dactylifera]
Length=543

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E+ +VL  +YELGR LG GTFAKVY ARN+ TG++ A+K++ K KV++ GM++QIKREI+
Sbjct  64   ERGTVLMRRYELGRLLGQGTFAKVYKARNILTGETVAIKIIDKEKVLRTGMIDQIKREIA  123

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            +M +V+H N+V+LYEVMA+K+KI+FAMELVRGGELFAK++KGRL E++AR YFQQL+ AV
Sbjct  124  IMRLVRHPNVVQLYEVMATKSKIFFAMELVRGGELFAKVAKGRLSEDMARKYFQQLVGAV  183

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  184  DFCHSRGVYHRD  195



>ref|XP_011085980.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Sesamum indicum]
 ref|XP_011085981.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Sesamum indicum]
Length=459

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YE+G+ LG GTFAKV+HARN+ TG+S A+K++ K KV+K G+++QIKREI
Sbjct  2    EKKGNILMQRYEIGKLLGQGTFAKVHHARNLKTGESVAIKIIDKQKVMKVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH N+V+L+EVMASK+KIYFAME +RGGELF K+SKGRL+E+ AR YFQQL++A
Sbjct  62   SVMRLVKHPNVVQLHEVMASKSKIYFAMEYIRGGELFNKVSKGRLKEDAARKYFQQLVAA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_004958692.1| PREDICTED: CBL-interacting protein kinase 2-like isoform X1 [Setaria 
italica]
Length=450

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            AE+K +VL  KYE+G+ LG GTFAKVY ARN  T +S A+KV+ K KV+K G+++QIKRE
Sbjct  2    AEQKGNVLMQKYEMGKMLGQGTFAKVYRARNTKTSESVAIKVIDKEKVMKVGLIDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +V+H NIV+LYEVMA+KTKIYF +E VRGGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVRGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>gb|AFK39318.1| unknown [Lotus japonicus]
Length=443

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  KYELGR LG G FAKVY+ARN+ TG+S+A+KV+ K  +V+ G+ EQIKREI
Sbjct  2    ENKPTILMKKYELGRMLGQGNFAKVYYARNMKTGQSAAIKVLNKEMIVRVGLNEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV+LYEVMASKTKIYFAME V+GGELF K+S+G+LRE++AR YFQQLI+A
Sbjct  62   SVMRLVKHPNIVQLYEVMASKTKIYFAMEYVKGGELFDKVSRGKLREDVARKYFQQLINA  121

Query  677  VDFCHSRGVYHRD  715
            VD CH+RGVYH D
Sbjct  122  VDHCHNRGVYHLD  134



>ref|XP_010092195.1| CBL-interacting serine/threonine-protein kinase 5 [Morus notabilis]
 gb|EXB50421.1| CBL-interacting serine/threonine-protein kinase 5 [Morus notabilis]
Length=442

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvka-gmmEQIKREISVM  505
            ++L GKYE+GR LG GTFAKVYHARN+ TG+S A+KV+ K +V +   +MEQIKREIS+M
Sbjct  15   NILFGKYEMGRLLGQGTFAKVYHARNLVTGESVAIKVINKKQVKRDGLVMEQIKREISIM  74

Query  506  SMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDF  685
             +V+H NIVEL EVMA+KTKI+F ME V+GGELFAK+SKGRL+E+LAR YFQQLISAVDF
Sbjct  75   RLVRHPNIVELKEVMATKTKIFFVMECVKGGELFAKVSKGRLKEDLARKYFQQLISAVDF  134

Query  686  CHSRGVYHRD  715
            CHSRGV HRD
Sbjct  135  CHSRGVSHRD  144



>gb|AGK91199.1| CIPK2 [Brachypodium distachyon]
Length=446

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  KYE+G+ LG GTFAKVYHARN+ T +S A+KV  K KV+K G+ +QIKREI
Sbjct  3    EQKGNILMQKYEMGKMLGQGTFAKVYHARNIQTSQSVAIKVTDKEKVLKGGLTDQIKREI  62

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV+ YEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI A
Sbjct  63   SVMKLVKHPNIVQTYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLICA  122

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  123  VDFCHSRGVYHRD  135



>ref|XP_012078353.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
[Jatropha curcas]
 ref|XP_012078360.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10 
[Jatropha curcas]
 gb|KDP45725.1| hypothetical protein JCGZ_17332 [Jatropha curcas]
Length=458

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  KYE+GR LG GTFAKVYHAR++ T +S A+KV+ K KV+K G+++QIKREI
Sbjct  2    EHKPSVLTQKYEVGRLLGQGTFAKVYHARSIRTNQSVAIKVIDKEKVLKVGLVDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEV+A+KTKI+FAME  +GGELF+K++KG+L+E+ AR YFQQLI+A
Sbjct  62   SVMRIVRHPNIVQLYEVLATKTKIFFAMEYCKGGELFSKVAKGKLKEDAARKYFQQLINA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|AET80728.1| calcineurin B-like-interacting protein kinase [Hordeum brevisubulatum]
Length=452

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
             E+K ++L  KYE+G+ LG GTFAKVYHARN+ T +S A+KV  K KV+K G+ +QIKRE
Sbjct  2    GEQKGNILMHKYEMGKMLGQGTFAKVYHARNIETSQSVAIKVTDKEKVMKGGLTDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +VKH NIV++YEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVKHPNIVQMYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_008233852.1| PREDICTED: CBL-interacting protein kinase 18-like [Prunus mume]
 ref|XP_008233853.1| PREDICTED: CBL-interacting protein kinase 18-like [Prunus mume]
Length=441

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K  VL  KYE+GR LG G FAKVYHAR++ TG++ A+KV+ K KV K G+ +Q KREI
Sbjct  2    ENKGKVLMQKYEIGRLLGQGNFAKVYHARHLQTGQNVAIKVINKEKVTKVGLTDQTKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV+LYEVMA+KTKIYF +E V+GGELF K+SKGRL+E++AR YFQQLISA
Sbjct  62   SVMRLVKHPNIVQLYEVMATKTKIYFVLEYVKGGELFHKVSKGRLKEDMARMYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|ADE76223.1| unknown [Picea sitchensis]
Length=431

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L G+YELGR LG GTFAKVY+ARN+ TG+S A+KV+ K K++K GM+EQIKRE+
Sbjct  2    EMKSNILMGRYELGRLLGQGTFAKVYYARNLKTGESVAIKVMAKEKILKVGMIEQIKREV  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKIS-KGRLREELARNYFQQLIS  673
            SVM +V+H NIV LYEVMASKTKIYF ME V+GGELF +++ KG+L+EE AR YFQQLIS
Sbjct  62   SVMRLVRHPNIVRLYEVMASKTKIYFVMEYVKGGELFNRVADKGKLKEEEARKYFQQLIS  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_007218015.1| hypothetical protein PRUPE_ppa005839mg [Prunus persica]
 gb|EMJ19214.1| hypothetical protein PRUPE_ppa005839mg [Prunus persica]
Length=441

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K  VL  KYE+GR LG G FAKVYHAR++ TG++ A+KV+ K KV K G+ +Q KREI
Sbjct  2    ENKGKVLMQKYEIGRLLGQGNFAKVYHARHLQTGQNVAIKVINKEKVTKVGLTDQTKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV+LYEVMA+KTKIYF +E V+GGELF K+SKGRL+E++AR YFQQLISA
Sbjct  62   SVMRLVKHPNIVQLYEVMATKTKIYFVLEYVKGGELFHKVSKGRLKEDMARMYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_007205114.1| hypothetical protein PRUPE_ppa004815mg [Prunus persica]
 gb|EMJ06313.1| hypothetical protein PRUPE_ppa004815mg [Prunus persica]
Length=490

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YE+GR LG GTFAKV+HARN+ TG S A+K++ K +V+K GM++QIKREI
Sbjct  2    ENKGSVLMQRYEMGRLLGQGTFAKVHHARNLKTGISVAIKIIDKERVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H N+VELYEVMASKTKIYF ME V+GGELF K+SKG+L+E++AR YFQQLISA
Sbjct  62   SVMRLIRHPNVVELYEVMASKTKIYFVMEYVKGGELFNKVSKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_008245119.1| PREDICTED: CBL-interacting protein kinase 2 [Prunus mume]
Length=508

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YE+GR LG GTFAKV+HARN+ TG S A+K++ K +V+K GM++QIKREI
Sbjct  2    ENKGSVLMQRYEMGRLLGQGTFAKVHHARNLKTGISVAIKIIDKERVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H N+VELYEVMASKTKIYF ME V+GGELF K+SKG+L+E++AR YFQQLISA
Sbjct  62   SVMRLIRHPNVVELYEVMASKTKIYFVMEYVKGGELFDKVSKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_006658129.1| PREDICTED: CBL-interacting protein kinase 2-like [Oryza brachyantha]
Length=444

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            AE++ + L  KYE+G+ LG GTFAKVYHARN  T +S A+KV+ K KV+K G+M+QIKRE
Sbjct  2    AEQRGTTLMKKYEMGKLLGQGTFAKVYHARNTETLESVAIKVIDKEKVLKGGLMDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +V+H NIV+LYEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_010686216.1| PREDICTED: CBL-interacting protein kinase 5 [Beta vulgaris subsp. 
vulgaris]
Length=464

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  KYELGRFLG GTFAKVY+AR++ +GKS A+K+V K KV++ GM+ QIKREI
Sbjct  2    EKKDTILFRKYELGRFLGQGTFAKVYYARHIVSGKSVAIKIVDKEKVLRVGMINQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM ++KH NIV+LYEVMASKTKIYFA+E V+GGELF KISKGRL EE +R YFQQLI A
Sbjct  62   SVMRLIKHPNIVQLYEVMASKTKIYFAIEYVKGGELFNKISKGRLNEEQSRKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            +DFCHSRGVYHRD
Sbjct  122  IDFCHSRGVYHRD  134



>ref|NP_001060636.1| Os07g0678600 [Oryza sativa Japonica Group]
 sp|Q7X996.1|CIPK2_ORYSJ RecName: Full=CBL-interacting protein kinase 2; AltName: Full=OsCIPK02 
[Oryza sativa Japonica Group]
 dbj|BAC79539.1| putative Serine/threonine Kinase [Oryza sativa Japonica Group]
 dbj|BAF22550.1| Os07g0678600 [Oryza sativa Japonica Group]
 gb|EAZ05144.1| hypothetical protein OsI_27338 [Oryza sativa Indica Group]
 gb|EAZ41090.1| hypothetical protein OsJ_25582 [Oryza sativa Japonica Group]
 gb|ACD76974.1| CBL-interacting protein kinase 2 [Oryza sativa Japonica Group]
 dbj|BAG93180.1| unnamed protein product [Oryza sativa Japonica Group]
Length=443

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            AE++ ++L  KYE+G+ LG GTFAKVYHARN  T +S A+K++ K KV+K G+M+QIKRE
Sbjct  2    AEQRGNMLMKKYEMGKLLGQGTFAKVYHARNTETSESVAIKMIDKEKVLKGGLMDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +V+H NIV+LYEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>gb|KHN07024.1| CBL-interacting serine/threonine-protein kinase 25 [Glycine soja]
Length=256

 Score =   167 bits (424),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E+C  + GKYE+GR LG GTFAKVY+ + + TG++ A+KV+ K +V K GMMEQIKREIS
Sbjct  2    EECHTVFGKYEMGRLLGKGTFAKVYYGKQISTGENVAIKVINKEQVRKEGMMEQIKREIS  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+VE+ EVMA+KTKI+F ME VRGGELFAKISKG+L+E+LAR YFQQLISAV
Sbjct  62   VMRLVRHPNVVEIKEVMATKTKIFFVMEYVRGGELFAKISKGKLKEDLARKYFQQLISAV  121

Query  680  DFCHSRGVYHRD  715
            D+CHSRGV HRD
Sbjct  122  DYCHSRGVSHRD  133



>ref|XP_007011240.1| CBL-interacting protein kinase 10 [Theobroma cacao]
 gb|EOY20050.1| CBL-interacting protein kinase 10 [Theobroma cacao]
Length=450

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E    VL  KYE GR LG G FAKVY+ARN+ + +S A+KV+ K KV+K GM++Q KREI
Sbjct  2    ENTGKVLMQKYEFGRLLGQGNFAKVYYARNIESSQSVAIKVIDKEKVLKVGMIDQTKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVMS+VKH NI+ELYEVMASK+KIYF ME  +GGELF K++KG+LRE++AR YFQQLISA
Sbjct  62   SVMSLVKHPNILELYEVMASKSKIYFVMEYAKGGELFNKVAKGKLREDMARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_010276975.1| PREDICTED: CBL-interacting protein kinase 5-like [Nelumbo nucifera]
Length=469

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YE+GR LG GTFAKVYHARN+ +G+S A+KV+ K KV+K G+MEQIKREI
Sbjct  27   EKKGTILMQRYEMGRLLGQGTFAKVYHARNIRSGQSVAIKVIDKEKVLKVGLMEQIKREI  86

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V H N+V+LYEV+ASK+KIYFAME VRGGELF K+SKG+L+E+ AR YFQQLI A
Sbjct  87   SVMHLVHHPNVVQLYEVLASKSKIYFAMEYVRGGELFNKVSKGKLKEDAARKYFQQLIGA  146

Query  677  VDFCHSRGVYHRD  715
            +D+CHSRGVYHRD
Sbjct  147  IDYCHSRGVYHRD  159



>ref|NP_001267894.1| CBL-interacting protein kinase 16 [Vitis vinifera]
 gb|ACQ83532.1| CBL-interacting protein kinase 16 [Vitis vinifera]
Length=450

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  +L  +YE+GR LG GTFAKVYHARN+ +G+S A+K++ K KV+K G+++QIKREI
Sbjct  2    EKKGVILMQRYEMGRMLGQGTFAKVYHARNLKSGQSVAIKMIDKEKVLKVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+LYEVMASKTKIYF ME V+GGELF K++KG+L+E+ AR YFQQLI A
Sbjct  62   SVMRLVRHPNVVQLYEVMASKTKIYFVMEYVKGGELFNKVAKGKLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_009371993.1| PREDICTED: CBL-interacting protein kinase 2 [Pyrus x bretschneideri]
Length=483

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  ++ELGR LG GTFAKV+HARN+ TG S A+K++ K +V+K GM++QIKREI
Sbjct  2    ENKGSVLMQRFELGRLLGQGTFAKVHHARNLKTGMSVAIKIIDKERVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H N+VELYEVMASKTKIYF ME V+GGELF K+SKG+L+E++AR YFQQLISA
Sbjct  62   SVMRLIRHPNVVELYEVMASKTKIYFVMEYVKGGELFNKVSKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_002454972.1| hypothetical protein SORBIDRAFT_03g002340 [Sorghum bicolor]
 gb|ACQ83496.1| CBL-interacting protein kinase 20 [Sorghum bicolor]
 gb|EES00092.1| hypothetical protein SORBIDRAFT_03g002340 [Sorghum bicolor]
Length=455

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YELGR LG GTFAKVYH RN+ + +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    EKKPTILMNRYELGRMLGQGTFAKVYHGRNLASSQSVAIKVIDKEKVLRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+L+EVMASK+KIYFAME VRGGELFA++++GRL+E++AR YF QLI A
Sbjct  62   SVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDVARRYFHQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_003636793.1| CBL-interacting protein kinase [Medicago truncatula]
 gb|KEH36611.1| CBL-interacting kinase [Medicago truncatula]
Length=445

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  KYE+GR LG G+FAKVYHARN+ TG++ A+KV  K  ++K G+ EQIKREI
Sbjct  2    ENKGTILMQKYEVGRMLGQGSFAKVYHARNLKTGQNVAIKVFDKAMIMKVGLKEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIVE YEVMASKTKIYFAME V+GGELF K+S+G+LRE++AR YFQQLI+A
Sbjct  62   SVMRLVRHPNIVEFYEVMASKTKIYFAMEQVKGGELFHKVSRGKLREDMARKYFQQLIAA  121

Query  677  VDFCHSRGVYHRD  715
            VD CH RG+YHRD
Sbjct  122  VDHCHRRGIYHRD  134



>ref|XP_008383618.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X1 [Malus domestica]
Length=470

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +K ++L  KYELGR LG GTFAKVYHARN+ + +S A+K++ K KV   G+++QIKREIS
Sbjct  14   KKGNILMHKYELGRLLGKGTFAKVYHARNLSSSQSVAIKIIDKEKVQHVGLIDQIKREIS  73

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+V+L+EVMASKTKIYFAME V+GGELF K++KG+L+E++AR YFQQLI AV
Sbjct  74   VMRLVRHPNVVQLFEVMASKTKIYFAMEYVKGGELFDKVAKGKLKEDVARKYFQQLIGAV  133

Query  680  DFCHSRGVYHRD  715
            D+CHSRGVYHRD
Sbjct  134  DYCHSRGVYHRD  145



>gb|EYU43341.1| hypothetical protein MIMGU_mgv1a006048mg [Erythranthe guttata]
Length=459

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  KYE+G+ LG GTFAKVYHARN+ TG++ A+K++ K K+V+ G+++Q KREI
Sbjct  2    EKKGNILMQKYEIGKLLGQGTFAKVYHARNLKTGQNVAIKIIDKEKIVRVGLIDQTKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            +VM +V H N+V LYEVMASK+KIYFAME VRGGELF K++KGRL+E+ AR YFQQLI+A
Sbjct  62   AVMRLVNHPNVVHLYEVMASKSKIYFAMEYVRGGELFNKVAKGRLKEDAARKYFQQLIAA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_009350943.1| PREDICTED: CBL-interacting protein kinase 5-like [Pyrus x bretschneideri]
Length=463

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +K ++L  KYE+GR LG GTFAKVYHARN+ +G+S A+K++ K KV K G+++QIKREIS
Sbjct  4    KKGNILMRKYEVGRLLGKGTFAKVYHARNLKSGQSVAIKIIDKEKVQKVGLIDQIKREIS  63

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+V+L+EVMASKTKIYFAME VRGGELF K++KG+L+E++AR YFQQLI AV
Sbjct  64   VMRLVRHPNVVQLFEVMASKTKIYFAMEYVRGGELFNKVAKGKLKEDVARKYFQQLIGAV  123

Query  680  DFCHSRGVYHRD  715
            D+CHSRGVYHRD
Sbjct  124  DYCHSRGVYHRD  135



>ref|XP_009403856.1| PREDICTED: CBL-interacting protein kinase 18-like [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  E K SVL  KYE GRFLG GTFAKVY+ARN+ T +  A+KV+ K KV+K G+ +QIK
Sbjct  1    MEMESKGSVLMQKYEFGRFLGKGTFAKVYYARNLKTSQGVAVKVIDKEKVMKIGLTDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REI+VM +V H N+V+LYEVMA+K+KIYF +E V+GGELF KI+KGRL+E +AR YFQQL
Sbjct  61   REIAVMRLVSHPNVVQLYEVMATKSKIYFILEYVKGGELFNKIAKGRLKENVARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            IS VDFCHS+GVYHRD
Sbjct  121  ISVVDFCHSKGVYHRD  136



>ref|XP_009387685.1| PREDICTED: CBL-interacting protein kinase 18-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  E K +VL  KYE+GR LG GTFAKVY+ARN+ T +S AMKV+ K KV+K G+++QIK
Sbjct  1    METENKGNVLLQKYEVGRLLGKGTFAKVYYARNIRTSQSVAMKVIDKEKVLKVGLIDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISV  +V+H NIVELYEVMA+++KIYF +E V+GGELF K+++GRL+E++AR YFQQL
Sbjct  61   REISVTRLVRHPNIVELYEVMATRSKIYFVLEYVKGGELFNKVAQGRLKEDVARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            I+AVDFCHSRGVYHRD
Sbjct  121  INAVDFCHSRGVYHRD  136



>ref|XP_012091789.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Jatropha curcas]
 gb|KDP21108.1| hypothetical protein JCGZ_21579 [Jatropha curcas]
Length=445

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YE+GR LG GTFAKVYHARN+ +G+S A+K++ K KV+K+G+++QIK EI
Sbjct  2    EKKGAILMNRYEIGRLLGQGTFAKVYHARNLQSGQSVAIKIIDKQKVLKSGLIDQIKTEI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMASKTKIYFAME V+GGELF K+ KG+L+E+ AR YFQQLI A
Sbjct  62   SVMRLVRHPNIVQLYEVMASKTKIYFAMEYVKGGELFNKVVKGKLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            V+FCHSRGVYHRD
Sbjct  122  VEFCHSRGVYHRD  134



>gb|KDP33521.1| hypothetical protein JCGZ_07092 [Jatropha curcas]
Length=199

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            VL  KYE+GR LG GTFAKVY+ +N+ TG+S A+KV+ K +V K GMMEQIKREISVM +
Sbjct  6    VLFQKYEMGRLLGKGTFAKVYYGKNITTGESVAIKVISKDQVKKEGMMEQIKREISVMRL  65

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            V+H NIVEL EV+A+KTKI+F ME VRGGELFAK++KG+L+EE+AR YFQQLISA+DFCH
Sbjct  66   VRHPNIVELKEVLATKTKIFFVMEHVRGGELFAKVAKGKLKEEIARKYFQQLISAIDFCH  125

Query  692  SRGVYHRD  715
            SRGV HRD
Sbjct  126  SRGVSHRD  133



>ref|XP_008370241.1| PREDICTED: CBL-interacting protein kinase 2 [Malus domestica]
Length=466

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YELGR LG GTFAKV++ARN+ TG S A+K++ K +V+K GM++QIKREI
Sbjct  2    ENKGSVLMQRYELGRILGQGTFAKVHYARNLKTGMSVAIKIIDKERVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H N+VELYEVMASKTKIYF ME V+GGELF K+SKG+L+E++AR YFQQLISA
Sbjct  62   SVMRLIRHPNVVELYEVMASKTKIYFVMEYVKGGELFNKVSKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_009352756.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X1 [Pyrus x bretschneideri]
Length=473

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +K ++L  KYELGR LG GTFAKVYHARN+ + +S A+K++ K KV   G+++QIKREIS
Sbjct  14   KKGNILMHKYELGRLLGKGTFAKVYHARNLSSSQSVAIKIIDKEKVQHVGLIDQIKREIS  73

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+V+L+EVMASKTKIYFAME V+GGELF K++KG+L+E++AR YFQQLI AV
Sbjct  74   VMRLVRHPNVVQLFEVMASKTKIYFAMEYVKGGELFNKVAKGKLKEDVARKYFQQLIGAV  133

Query  680  DFCHSRGVYHRD  715
            D+CHSRGVYHRD
Sbjct  134  DYCHSRGVYHRD  145



>ref|XP_008371484.1| PREDICTED: LOW QUALITY PROTEIN: CBL-interacting protein kinase 
5 [Malus domestica]
Length=463

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +K ++L  KYE+GR LG GTFAKVYHARN+ +G+S A+K++ K KV K G+++QIKREIS
Sbjct  4    KKGNILMHKYEVGRLLGKGTFAKVYHARNLKSGQSVAIKIIDKEKVQKVGLIDQIKREIS  63

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+V+L+EVMASKTKIYFAME VRGGELF K++KG+L+E++AR YFQQLI AV
Sbjct  64   VMRLVRHPNVVQLFEVMASKTKIYFAMEYVRGGELFNKVAKGKLKEDVARKYFQQLIGAV  123

Query  680  DFCHSRGVYHRD  715
            D+CHSRGVYHRD
Sbjct  124  DYCHSRGVYHRD  135



>ref|XP_010922709.1| PREDICTED: CBL-interacting protein kinase 18-like [Elaeis guineensis]
Length=447

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E + ++L  +YELGR LG GTFAKV++ARN+ TG+S A+K++ K KV++ G+++QIKREI
Sbjct  2    ENRGTILMQRYELGRLLGQGTFAKVHYARNLKTGQSVAIKIIDKEKVLRVGLVDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV+LYEVMASKTKIYF ME ++GGELF K++KG+L+E++AR YFQQLISA
Sbjct  62   SVMRLVKHPNIVQLYEVMASKTKIYFVMEYIKGGELFNKVAKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  122  VDYCHSRGVYHRD  134



>ref|XP_010231608.1| PREDICTED: CBL-interacting protein kinase 5-like [Brachypodium 
distachyon]
Length=475

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            EK +VL  +YELGR LGHGTFAKV+HAR++ +  S A+KV+ K KV++ GM++QIKREIS
Sbjct  30   EKGTVLMNRYELGRTLGHGTFAKVHHARSLMSNHSVAIKVIDKEKVMRVGMIDQIKREIS  89

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            +M +V+H NIV+L+EVMASKTKIYF ME VRGGELF+K++KGRL+EE+AR YFQQLI A+
Sbjct  90   IMRLVRHPNIVQLHEVMASKTKIYFVMEHVRGGELFSKVAKGRLKEEVARKYFQQLIGAI  149

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  150  DFCHSRGVYHRD  161



>ref|XP_009414263.1| PREDICTED: CBL-interacting protein kinase 18 [Musa acuminata 
subsp. malaccensis]
Length=444

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  E + +VL  KYE+GR LG GTFAKVY+ARN+ T +S A+KV+ K KV+K G+++QIK
Sbjct  1    MELENRGTVLMQKYEVGRLLGKGTFAKVYYARNIKTSQSVAIKVIDKEKVLKVGLIDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REIS+M MV+H NIVELYEVMA+++KIYF +E V+GGELF K++KG+L+E++AR YFQQL
Sbjct  61   REISIMRMVRHPNIVELYEVMATRSKIYFVLEYVKGGELFNKVAKGKLKEDVARRYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            I+AV+FCHSRGVYHRD
Sbjct  121  INAVEFCHSRGVYHRD  136



>gb|KDO41575.1| hypothetical protein CISIN_1g015005mg [Citrus sinensis]
Length=414

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++L GKYE+GR LG GTFAKVY+ +N+ T +S A+KV+ K +V K G+MEQIKREISVM 
Sbjct  12   NILFGKYEMGRMLGQGTFAKVYYGKNLVTQESVAIKVINKDQVKKQGLMEQIKREISVMR  71

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            +VKH NIVEL EVMA+KTK++F +E V+GGELFAK+ KG+L+EE AR YFQQLISAVDFC
Sbjct  72   LVKHPNIVELKEVMATKTKVFFVIEYVKGGELFAKVLKGKLKEESARKYFQQLISAVDFC  131

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  132  HSRGVYHRD  140



>ref|XP_010253153.1| PREDICTED: CBL-interacting protein kinase 18 [Nelumbo nucifera]
 ref|XP_010253154.1| PREDICTED: CBL-interacting protein kinase 18 [Nelumbo nucifera]
 ref|XP_010253156.1| PREDICTED: CBL-interacting protein kinase 18 [Nelumbo nucifera]
Length=452

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YELGR LG GTFAKVY+ARN+ TG+  A+KV+ K KV+K G+++QIKREI
Sbjct  2    ENKGSVLMQRYELGRLLGQGTFAKVYYARNLKTGQGVAIKVIDKEKVLKVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NI++LYEVMAS+ KIYF ME  +GGELF KI+KG+L+E+ AR YFQQLISA
Sbjct  62   SVMRLVRHPNILQLYEVMASRKKIYFVMEYAKGGELFNKIAKGKLKEDAARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|AGW15605.1| CBL-interacting protein kinase [Populus tomentosa]
Length=464

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  KYE+GR LG GTFAKVY ARN+ T +S A+K++ K KV++ G+++QIKREI
Sbjct  2    ENKPSVLTQKYEVGRLLGQGTFAKVYFARNIKTNQSVAIKLIEKEKVLRVGLVDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NI++LYEV+A+K+KIYF +E  +GGELF K++KGRL+E++AR YFQQLI+A
Sbjct  62   SVMRLVRHPNIIQLYEVLATKSKIYFVLEYAKGGELFNKVAKGRLKEDVARKYFQQLINA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_010089697.1| CBL-interacting protein kinase 5 [Morus notabilis]
 gb|EXB38220.1| CBL-interacting protein kinase 5 [Morus notabilis]
Length=461

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  KYELGR LG GTFAKVYHAR++ +G+S A+KV+ K KV   G+M+QIKREI
Sbjct  2    EKKGTILMQKYELGRLLGQGTFAKVYHARSLSSGESVAIKVIDKEKVNNNGLMDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            +VM +VKH +IV L+EVMASK+KIYFAME V+GGELF K++KGRLRE+LAR YFQQLI A
Sbjct  62   AVMRLVKHPHIVNLHEVMASKSKIYFAMEYVKGGELFDKVAKGRLREDLARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  122  VDYCHSRGVYHRD  134



>ref|XP_003565293.1| PREDICTED: CBL-interacting protein kinase 5 [Brachypodium distachyon]
Length=460

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YELGR LG GTFAKVYHAR++ + +S A+KV+ K KV++ GM+EQIKREI
Sbjct  2    EKKAAILMNRYELGRMLGQGTFAKVYHARHLASNQSVAIKVIDKEKVLRVGMIEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M +V+H N+V L+EVMASK+KIYFAME VRGGELF K+++GRL+E+ AR YFQQLI A
Sbjct  62   SIMRLVRHPNVVHLHEVMASKSKIYFAMEYVRGGELFGKVARGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_008383619.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X2 [Malus domestica]
Length=458

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +K ++L  KYELGR LG GTFAKVYHARN+ + +S A+K++ K KV   G+++QIKREIS
Sbjct  2    KKGNILMHKYELGRLLGKGTFAKVYHARNLSSSQSVAIKIIDKEKVQHVGLIDQIKREIS  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+V+L+EVMASKTKIYFAME V+GGELF K++KG+L+E++AR YFQQLI AV
Sbjct  62   VMRLVRHPNVVQLFEVMASKTKIYFAMEYVKGGELFDKVAKGKLKEDVARKYFQQLIGAV  121

Query  680  DFCHSRGVYHRD  715
            D+CHSRGVYHRD
Sbjct  122  DYCHSRGVYHRD  133



>ref|XP_006427620.1| hypothetical protein CICLE_v10025649mg [Citrus clementina]
 gb|ESR40860.1| hypothetical protein CICLE_v10025649mg [Citrus clementina]
Length=432

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            ++L GKYE+GR LG GTFAKVY+ +N+ T +S A+KV+ K +V K G+MEQIKREISVM 
Sbjct  12   NILFGKYEMGRMLGQGTFAKVYYGKNLVTQESVAIKVINKDQVKKQGLMEQIKREISVMR  71

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            +VKH NIVEL EVMA+KTK++F +E V+GGELFAK+ KG+L+EE AR YFQQLISAVDFC
Sbjct  72   LVKHPNIVELKEVMATKTKVFFVIEYVKGGELFAKVLKGKLKEESARKYFQQLISAVDFC  131

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  132  HSRGVYHRD  140



>ref|XP_009784196.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana sylvestris]
Length=457

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            SVL  +YELG+ LG GTFAKV+HAR+V TG + A+K++ K K+VK GM++QIKREISVM 
Sbjct  7    SVLMERYELGKLLGQGTFAKVHHARDVKTGLNVAIKMIDKEKIVKVGMIDQIKREISVMK  66

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            +V+H NIV+LYEVMASK KIYF ME V+GGELF K++KG+L+E++AR YFQQLISA+DFC
Sbjct  67   LVRHSNIVQLYEVMASKKKIYFVMEYVKGGELFNKVAKGKLKEDVARKYFQQLISAIDFC  126

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  127  HSRGVYHRD  135



>ref|XP_008388328.1| PREDICTED: CBL-interacting protein kinase 2-like [Malus domestica]
 ref|XP_008359819.1| PREDICTED: CBL-interacting protein kinase 2-like [Malus domestica]
Length=483

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  VL  +YELGR LG GTFAKV+HARN+ TG S A+K++ K +V+K GM++QIKREI
Sbjct  2    EKKGCVLMQRYELGRLLGQGTFAKVHHARNLKTGMSVAIKIIDKERVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H N+VELYEVMA+KTKIYF ME V+GGELF K+SKG+L+E++AR YFQQLISA
Sbjct  62   SVMRLIRHPNVVELYEVMATKTKIYFVMEYVKGGELFNKVSKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>gb|AFW98257.1| calcineurin B-like-interacting protein kinase [Hordeum brevisubulatum]
Length=450

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
             E+K ++L  KYE+G+ LG GTFAKVYHARN+ T +S A+KV  K KV+K G+ +QIKRE
Sbjct  2    GEQKGNILMHKYEVGKMLGQGTFAKVYHARNIETSQSVAIKVTDKEKVLKGGLTDQIKRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +VKH NIV++YEVMA+KTKIYF +E V+GGELF K+ +GR +E+ AR YFQQLI 
Sbjct  62   ISVMKLVKHPNIVQMYEVMATKTKIYFVLEHVKGGELFNKVQRGRFKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_008810573.1| PREDICTED: CBL-interacting protein kinase 18 [Phoenix dactylifera]
Length=450

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E + + L  +YELGR LG GTFAKV++ARN+ TG+S A+K++ K KV++ G++EQIKREI
Sbjct  2    ENRGTTLMQRYELGRLLGQGTFAKVHYARNLKTGQSVAIKIIDKEKVLRVGLVEQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH NIV+LYEVMASKTKIYF +E V+GGELF K++KG+L+E++AR YFQQLISA
Sbjct  62   SVMRLVKHPNIVQLYEVMASKTKIYFVLEYVKGGELFNKVAKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  122  VDYCHSRGVYHRD  134



>ref|XP_009352757.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
isoform X2 [Pyrus x bretschneideri]
Length=461

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +K ++L  KYELGR LG GTFAKVYHARN+ + +S A+K++ K KV   G+++QIKREIS
Sbjct  2    KKGNILMHKYELGRLLGKGTFAKVYHARNLSSSQSVAIKIIDKEKVQHVGLIDQIKREIS  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+V+L+EVMASKTKIYFAME V+GGELF K++KG+L+E++AR YFQQLI AV
Sbjct  62   VMRLVRHPNVVQLFEVMASKTKIYFAMEYVKGGELFNKVAKGKLKEDVARKYFQQLIGAV  121

Query  680  DFCHSRGVYHRD  715
            D+CHSRGVYHRD
Sbjct  122  DYCHSRGVYHRD  133



>ref|NP_001055223.1| Os05g0332300 [Oryza sativa Japonica Group]
 sp|Q5W736.1|CIPKI_ORYSJ RecName: Full=CBL-interacting protein kinase 18; AltName: Full=OsCIPK18 
[Oryza sativa Japonica Group]
 gb|AAV43835.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|AAV43911.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF17137.1| Os05g0332300 [Oryza sativa Japonica Group]
 gb|ACD76981.1| CBL-interacting protein kinase 18 [Oryza sativa Japonica Group]
 gb|ACD76982.1| CBL-interacting protein kinase 22 [Oryza sativa Japonica Group]
 dbj|BAG95024.1| unnamed protein product [Oryza sativa Japonica Group]
Length=457

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  E+  ++L  +YE+G+ LG GTFAKVYH RN+ T +S A+KV+ K K+ K G+M+QIK
Sbjct  2    MELEKNGNILLRRYEIGKLLGQGTFAKVYHGRNIVTSQSVAIKVIDKDKIFKVGLMDQIK  61

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H NIV+LYEVMA+K+KIYF +E V+GGELF K++KGRL+E+ AR YFQQL
Sbjct  62   REISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKVAKGRLKEDAARKYFQQL  121

Query  668  ISAVDFCHSRGVYHRD  715
            +SAVDFCHSRGVYHRD
Sbjct  122  VSAVDFCHSRGVYHRD  137



>gb|ACQ83494.1| CBL-interacting protein kinase 25 [Sorghum bicolor]
Length=449

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K +VL  KYE+G+ LG GTFAKVYHARN  T +S A+KV+ K KV+K G+++QIKREI
Sbjct  3    EHKGNVLMHKYEMGKLLGQGTFAKVYHARNTKTSESVAIKVIDKDKVMKVGLIDQIKREI  62

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI A
Sbjct  63   SVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLICA  122

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  123  VDFCHSRGVYHRD  135



>gb|EAY97566.1| hypothetical protein OsI_19494 [Oryza sativa Indica Group]
 gb|EEE63285.1| hypothetical protein OsJ_18095 [Oryza sativa Japonica Group]
Length=456

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  E+  ++L  +YE+G+ LG GTFAKVYH RN+ T +S A+KV+ K K+ K G+M+QIK
Sbjct  1    MELEKNGNILLRRYEIGKLLGQGTFAKVYHGRNIVTSQSVAIKVIDKDKIFKVGLMDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H NIV+LYEVMA+K+KIYF +E V+GGELF K++KGRL+E+ AR YFQQL
Sbjct  61   REISVMKLVRHPNIVQLYEVMATKSKIYFVLEYVKGGELFNKVAKGRLKEDAARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            +SAVDFCHSRGVYHRD
Sbjct  121  VSAVDFCHSRGVYHRD  136



>emb|CDP04063.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E   SVL  +YELGR LG GTFAKVY+ RN+ TG+S A+K++ K K+++ G+++QIKREI
Sbjct  2    ENTVSVLMERYELGRLLGQGTFAKVYYGRNISTGQSVAIKMIDKEKILRVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +VKH N+V+LYEVMA+KTKIYF ME  +GGELF K++KG+L+E++AR YFQQL++A
Sbjct  62   SVMRLVKHPNVVQLYEVMATKTKIYFVMEYAKGGELFYKVAKGKLKEDVARRYFQQLVNA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_002863452.1| cbl-interacting protein kinase 20 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39711.1| cbl-interacting protein kinase 20 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            VL  KYELGR LG GTFAKVYHARN+ TG+S A+KV+ K KV K G+++QIKREISVM +
Sbjct  7    VLMRKYELGRLLGQGTFAKVYHARNIKTGESVAIKVIDKQKVAKVGLIDQIKREISVMRL  66

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            V+H N+V L+EVMASKTKIYFAME V GGELF K+SKG+L+E++AR YFQQLI A+D+CH
Sbjct  67   VRHPNVVFLHEVMASKTKIYFAMEYVTGGELFDKVSKGKLKEDIARKYFQQLIGAIDYCH  126

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  127  SRGVYHRD  134



>ref|XP_003526181.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 25-like 
[Glycine max]
Length=453

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E+C  + GKYE+GR LG GTFAKVY+ + + TG++ A+KV+ K +V K GMMEQIKREIS
Sbjct  2    EECHTVFGKYEMGRLLGKGTFAKVYYGKQISTGENVAIKVINKEQVRKEGMMEQIKREIS  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+VE+ EVMA+KTKI+F ME VRGGELFAKISKG+L+E+LAR YFQQLISAV
Sbjct  62   VMRLVRHPNVVEIKEVMATKTKIFFVMEYVRGGELFAKISKGKLKEDLARKYFQQLISAV  121

Query  680  DFCHSRGVYHRD  715
            D+CHSRGV HRD
Sbjct  122  DYCHSRGVSHRD  133



>ref|XP_004485907.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Cicer arietinum]
Length=426

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            ++K ++L  KYE+GR LG G FAKVYHARN+ TG+S A+KV  K  +++ G+ EQ+KREI
Sbjct  2    DKKATILMQKYEIGRMLGQGNFAKVYHARNLKTGQSVAIKVFNKEMIMRVGLKEQVKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S M +V+H NIVELYEVMASKTKIYFAME V+GGELF K+SKG+LRE++AR YFQQLI A
Sbjct  62   SGMRLVRHPNIVELYEVMASKTKIYFAMEYVKGGELFDKVSKGKLREDVARKYFQQLIEA  121

Query  677  VDFCHSRGVYHRD  715
            V+ CH RGVYHRD
Sbjct  122  VNHCHKRGVYHRD  134



>gb|AGQ43462.1| CBL-interacting protein kinase 2 [Nitraria tangutorum]
Length=447

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K  VL  KYELGR LG GTFAKVY+ARN+ T +S A+KV+ K K++KA + EQ   E+
Sbjct  3    EHKGKVLMEKYELGRLLGQGTFAKVYYARNLETSQSVAVKVIDKEKILKAELAEQTLTEV  62

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM ++KH N++ELYEVMA+KTKIYF ME  +GGELF K++KGRLREE AR YFQQLISA
Sbjct  63   SVMRLIKHPNVLELYEVMATKTKIYFIMEYAKGGELFNKLAKGRLREERARKYFQQLISA  122

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  123  VDFCHSRGVYHRD  135



>ref|XP_007148034.1| hypothetical protein PHAVU_006G174900g [Phaseolus vulgaris]
 gb|ESW20028.1| hypothetical protein PHAVU_006G174900g [Phaseolus vulgaris]
Length=436

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            +VL  KYE+GRFLG G FAKVYHA+N+ TG+S A+KV+ K  ++K GM EQIKREISVM 
Sbjct  4    NVLMQKYEIGRFLGQGNFAKVYHAKNLKTGQSVAVKVINKEMMMKVGMEEQIKREISVMR  63

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            +V+H N+V+LYEVMA+K KIYFAME+V+GGELF K+S+GRLRE++AR YFQQLI AVD+C
Sbjct  64   LVRHPNVVQLYEVMATKKKIYFAMEMVKGGELFDKVSRGRLREDVARKYFQQLIDAVDYC  123

Query  689  HSRGVYHRD  715
            HS GV HRD
Sbjct  124  HSLGVCHRD  132



>ref|XP_008653467.1| PREDICTED: CBL-interacting protein kinase 2 [Zea mays]
 tpg|DAA64116.1| TPA: putative CBL-interacting protein kinase family protein isoform 
1 [Zea mays]
 tpg|DAA64117.1| TPA: putative CBL-interacting protein kinase family protein isoform 
2 [Zea mays]
Length=451

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
            AE K +VL  KYE+G+ LG GTFAKVYHARN  T +S A+KV+ K KV+K G+++QI+RE
Sbjct  2    AEHKGNVLLHKYEMGKLLGQGTFAKVYHARNTATSESVAIKVIDKEKVMKVGLIDQIQRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +V+H NIV+LYEVMA+KTKIYF +E V+GGELF KI +GRL+E+ AR YFQQLI 
Sbjct  62   ISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKIQRGRLKEDAARKYFQQLIC  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_007136949.1| hypothetical protein PHAVU_009G087500g [Phaseolus vulgaris]
 dbj|BAG06677.1| protein kinase [Phaseolus vulgaris]
 gb|ESW08943.1| hypothetical protein PHAVU_009G087500g [Phaseolus vulgaris]
Length=446

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E+C  + GKYE+GR LG GTFAKVY+ + + TG+S A+KV+ K +V K GMMEQIKREIS
Sbjct  2    EECHTVFGKYEMGRLLGKGTFAKVYYGKQISTGESVAIKVMSKEQVRKEGMMEQIKREIS  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+VEL EVMA+KTKI+F ME VRGGELF+KISKG+L+E+LAR YFQQLISA+
Sbjct  62   VMRLVRHPNVVELKEVMATKTKIFFVMEYVRGGELFSKISKGKLKEDLARRYFQQLISAI  121

Query  680  DFCHSRGVYHRD  715
            D+CHSRGV HRD
Sbjct  122  DYCHSRGVSHRD  133



>gb|AHA84184.1| CBL-interacting serine/threonine-protein kinase 25 [Phaseolus 
vulgaris]
Length=448

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E+C  + GKYE+GR LG GTFAKVY+ + + TG+S A+KV+ K +V K GMMEQIKREIS
Sbjct  2    EECHTVFGKYEMGRLLGKGTFAKVYYGKQISTGESVAIKVMSKEQVRKEGMMEQIKREIS  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+VEL EVMA+KTKI+F ME VRGGELF+KISKG+L+E+LAR YFQQLISA+
Sbjct  62   VMRLVRHPNVVELKEVMATKTKIFFVMEYVRGGELFSKISKGKLKEDLARRYFQQLISAI  121

Query  680  DFCHSRGVYHRD  715
            D+CHSRGV HRD
Sbjct  122  DYCHSRGVSHRD  133



>ref|XP_006429548.1| hypothetical protein CICLE_v10011650mg [Citrus clementina]
 ref|XP_006481165.1| PREDICTED: CBL-interacting protein kinase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481166.1| PREDICTED: CBL-interacting protein kinase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR42788.1| hypothetical protein CICLE_v10011650mg [Citrus clementina]
Length=472

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K S+L  +YELGR LG GTFAKV++ARN+ TG S A+K++ K KV+K GM++QIKREI
Sbjct  2    ENKGSILMQRYELGRLLGQGTFAKVHYARNLKTGMSVAIKIIDKEKVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+VELYEVMASKTKIYF ME V+GGELF K++KG+L+E+ AR YFQQLISA
Sbjct  62   SVMRLVRHPNVVELYEVMASKTKIYFVMEYVKGGELFGKVAKGKLKEDAARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_006654265.1| PREDICTED: CBL-interacting protein kinase 18-like [Oryza brachyantha]
Length=456

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            M  E+  ++L  +YE+G+ LG GTFAKVYH+RN+ T +S A+KV+ K K+ K G+M+QIK
Sbjct  1    MELEKNGNILLQRYEIGKLLGQGTFAKVYHSRNIVTSQSVAIKVIDKDKIFKVGLMDQIK  60

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REISVM +V+H NIV+LYEVMA+K++IYF +E V+GGELF K++KGRL+E+ AR YFQQL
Sbjct  61   REISVMKLVRHPNIVQLYEVMATKSRIYFVLEYVKGGELFNKVAKGRLKEDAARKYFQQL  120

Query  668  ISAVDFCHSRGVYHRD  715
            +SAVDFCHSRGVYHRD
Sbjct  121  VSAVDFCHSRGVYHRD  136



>gb|KDO49657.1| hypothetical protein CISIN_1g012046mg [Citrus sinensis]
 gb|KDO49658.1| hypothetical protein CISIN_1g012046mg [Citrus sinensis]
 gb|KDO49659.1| hypothetical protein CISIN_1g012046mg [Citrus sinensis]
Length=472

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K S+L  +YELGR LG GTFAKV++ARN+ TG S A+K++ K KV+K GM++QIKREI
Sbjct  2    ENKGSILMQRYELGRLLGQGTFAKVHYARNLKTGMSVAIKIIDKEKVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+VELYEVMASKTKIYF ME V+GGELF K++KG+L+E+ AR YFQQLISA
Sbjct  62   SVMRLVRHPNVVELYEVMASKTKIYFVMEYVKGGELFGKVAKGKLKEDAARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_009126755.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 10-like 
[Brassica rapa]
Length=443

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  KYE+GR LG GTFAKVY+ R+VHT +S A+K++ K KV+K G+  QIKREI
Sbjct  2    ENKPSVLTDKYEVGRLLGQGTFAKVYYGRSVHTNQSVAIKMIDKEKVIKLGLNNQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM + KH N+VELYEVMA+KT+IYF ME  +GGELF K++KG+LR+++A NYF QLI+A
Sbjct  62   SVMRIAKHPNVVELYEVMATKTRIYFVMEYCKGGELFNKLTKGKLRDDVAWNYFYQLINA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|KHN14263.1| CBL-interacting protein kinase 18 [Glycine soja]
Length=362

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  VL  +YELGR LG GTFAKVYHARN+ TG S A+K++ K K++K GM++QIKREI
Sbjct  2    EQKGGVLMQRYELGRLLGQGTFAKVYHARNIITGMSVAIKIIDKEKILKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H ++VELYEVMASKTKIYF ME V+GGELF K+SKG+L+++ AR YFQQLISA
Sbjct  62   SVMRLIRHPHVVELYEVMASKTKIYFVMEYVKGGELFNKVSKGKLKQDDARRYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>gb|EMS57676.1| CBL-interacting protein kinase 5 [Triticum urartu]
Length=466

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K ++L  +YELGR LG GTFAKVYHAR++ T +S A+KV+ K KV++ GM++QIKREI
Sbjct  2    ERKSTILMNRYELGRMLGQGTFAKVYHARSLATNQSVAIKVIDKDKVLRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M +V+H  IV+L+EVMASK+KIYFAME VRGGELFA+++KGRL+E+ AR YFQQLI A
Sbjct  62   SIMRLVRHPYIVQLHEVMASKSKIYFAMEYVRGGELFARVAKGRLKEDAARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSR VYHRD
Sbjct  122  VDFCHSRDVYHRD  134



>ref|XP_002323059.2| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
 gb|ABJ91228.1| CBL-interacting protein kinase 22 [Populus trichocarpa]
 gb|ABK95707.1| unknown [Populus trichocarpa]
 gb|EEF04820.2| calcineurin B-like-interacting protein kinase [Populus trichocarpa]
Length=470

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K +VL  KYE+GR LG GTFAKV+HAR++ TG S A+K++ K KV K GMM+QIKREI
Sbjct  2    ENKGNVLMQKYEIGRLLGQGTFAKVHHARDLKTGMSVAIKMIDKEKVFKVGMMDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H N+VELYEVMA+KTKIYF ME V+GGELF K++KG+L+E++AR YFQQLISA
Sbjct  62   SVMRLIRHPNVVELYEVMATKTKIYFVMEYVKGGELFNKVAKGKLKEDVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVSHRD  134



>gb|KFK31507.1| hypothetical protein AALP_AA6G121600 [Arabis alpina]
Length=433

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            VL  +YELGR LG GTFAKVYHARN+ TG+S A+KV+ K KV+K G+++QIKREISVM +
Sbjct  7    VLMQRYELGRLLGQGTFAKVYHARNLKTGESVAIKVIDKQKVLKVGLIDQIKREISVMRL  66

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            V+H N+V L+EVMASKTKIYFAME V+GGELF K+SKG+L+E++AR YFQQLI A+D+CH
Sbjct  67   VRHPNVVFLHEVMASKTKIYFAMEYVKGGELFDKVSKGKLKEDIARKYFQQLIGAIDYCH  126

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  127  SRGVYHRD  134



>ref|XP_008345915.1| PREDICTED: CBL-interacting protein kinase 5-like [Malus domestica]
Length=463

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            +K ++L  KYE+GR LG GTFAKVYHARN+ +G+S A+K++ K KV K G+++QIKREIS
Sbjct  4    KKGNILMHKYEVGRLLGKGTFAKVYHARNLKSGQSVAIKIIDKEKVQKVGLIDQIKREIS  63

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+V+L+EVMASKTKIYFAME VRGGELF K++KG+L+E++AR YFQQLI AV
Sbjct  64   VMRLVRHPNVVQLFEVMASKTKIYFAMEYVRGGELFNKVAKGKLKEDVARKYFQQLIGAV  123

Query  680  DFCHSRGVYHRD  715
            D+CHSRG YHRD
Sbjct  124  DYCHSRGXYHRD  135



>ref|XP_010441665.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Camelina sativa]
Length=437

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            VL  KYELGR LG GTFAKVYHARN+ TG+S A+KV+ K ++VK G+++QIKREISVM +
Sbjct  7    VLMRKYELGRLLGQGTFAKVYHARNMKTGESVAIKVIDKHEIVKVGLIDQIKREISVMRL  66

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            V+H N+V L+EVMASKTKIYFAME V+GGELF K+SKG+L+E++AR YFQQLI A+D+CH
Sbjct  67   VRHPNVVFLHEVMASKTKIYFAMEYVKGGELFDKVSKGKLKEDIARKYFQQLIGAIDYCH  126

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  127  SRGVYHRD  134



>ref|NP_001149741.1| LOC100283368 [Zea mays]
 gb|ACG36627.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
 gb|ACG39742.1| CBL-interacting serine/threonine-protein kinase 15 [Zea mays]
Length=459

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YELGR LG GTFAKVYH RN+ +G+S A+KV+ K KV++ GM++QIKREI
Sbjct  2    EKKPTILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+L+EVMASK+KIYFAME VRGGELFA++++GRL+E+ AR YF QL+ A
Sbjct  62   SVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_007025354.1| CBL-interacting protein kinase 20 [Theobroma cacao]
 gb|EOY27976.1| CBL-interacting protein kinase 20 [Theobroma cacao]
Length=474

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  +L  ++ELGR LG GTFAKVYHARN+ TG+S A+KV+ K K++K G+++QIKREI
Sbjct  26   EKKGVILMNRFELGRLLGQGTFAKVYHARNLTTGQSCAIKVIDKEKIMKGGLIDQIKREI  85

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V LYEVMASK KIYF ME VRGGELF K++KG+L+E+ AR+YFQQLI+A
Sbjct  86   SVMRLVRHPNVVRLYEVMASKAKIYFVMEYVRGGELFNKVAKGKLKEDAARHYFQQLIAA  145

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  146  VDYCHSRGVYHRD  158



>gb|ACF78341.1| unknown [Zea mays]
 gb|ACL54079.1| unknown [Zea mays]
 gb|AFW80366.1| putative CBL-interacting protein kinase family protein [Zea mays]
Length=453

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YELGR LG GTFAKVYH RN+ +G+S A+KV+ K KV++ GM++QIKREI
Sbjct  2    EKKPTILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+L+EVMASK+KIYFAME VRGGELFA++++GRL+E+ AR YF QL+ A
Sbjct  62   SVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|NP_001105966.1| putative protein kinase [Zea mays]
 gb|ABM21448.1| putative protein kinase [Zea mays]
Length=453

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K ++L  +YELGR LG GTFAKVYH RN+ +G+S A+KV+ K KV++ GM++QIKREI
Sbjct  2    EKKPTILMNRYELGRTLGQGTFAKVYHGRNLASGESVAIKVIDKEKVMRVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V+L+EVMASK+KIYFAME VRGGELFA++++GRL+E+ AR YF QL+ A
Sbjct  62   SVMRLVRHPNVVQLHEVMASKSKIYFAMEYVRGGELFARVARGRLKEDAARRYFHQLVGA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>gb|ABC67804.1| protein kinase SRK [Nicotiana tabacum]
Length=479

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            ++ +E   +L G+YE+G+ LGHGTFAKVYHARNV T +S A+KV+ K K++K G+++ IK
Sbjct  24   LSKKENQGLLSGRYEIGKLLGHGTFAKVYHARNVKTNESVAIKVIDKEKILKVGLIDHIK  83

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REIS++  V+H NIV+LYEVMA+K KIYF ME V+GGELF K++KGRL+EE+AR YFQQL
Sbjct  84   REISILRRVRHPNIVQLYEVMATKAKIYFVMEYVKGGELFNKVAKGRLKEEVARKYFQQL  143

Query  668  ISAVDFCHSRGVYHRD  715
            ISAV FCH+RGVYHRD
Sbjct  144  ISAVAFCHARGVYHRD  159



>ref|XP_008350054.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 5-like 
[Malus domestica]
 ref|XP_008359386.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 5-like 
[Malus domestica]
Length=440

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E+ +VL GKYE+G+ LG GTFAKVYH R + T +S A+KV+ K +V K GMMEQIKREI 
Sbjct  2    EERTVLFGKYEVGKLLGKGTFAKVYHGRQIATNESVAIKVISKDQVRKEGMMEQIKREIE  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+VEL EVMA+KTKI+F ME VRGGELFAK++KG+L+E+ AR YFQQLISAV
Sbjct  62   VMRLVRHPNVVELKEVMATKTKIFFVMEYVRGGELFAKVAKGKLKEDQARKYFQQLISAV  121

Query  680  DFCHSRGVYHRD  715
            DFCHSRGV HRD
Sbjct  122  DFCHSRGVSHRD  133



>gb|KEH23254.1| CBL-interacting kinase [Medicago truncatula]
Length=462

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YE+GR LG GTFAKVYHARN+ TG S A+KV+ K KV K GM++QIKREI
Sbjct  2    EPKGSVLMQRYEMGRLLGQGTFAKVYHARNLITGVSVAIKVIDKEKVYKVGMVDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+VELYEVMASKTKI+  ME  RGGELF KI+KG+L+ ++AR YFQQL+SA
Sbjct  62   SVMRLVRHPNVVELYEVMASKTKIFIVMEYARGGELFHKIAKGKLKTDVARRYFQQLVSA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGVYHRD
Sbjct  122  VDYCHSRGVYHRD  134



>emb|CDY32704.1| BnaA02g07660D [Brassica napus]
Length=438

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  KYE+GR LG GTFAKVY+ R++ T +S A+K++ K KV+K G+ +QIKREI
Sbjct  2    ENKPSVLTDKYEVGRLLGQGTFAKVYYGRSIRTNQSVAIKMIDKEKVIKLGLTDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM + KH NIVELYEVMA+KT+IYF ME  +GGELF K++KG+LR+++A NYF QLI+A
Sbjct  62   SVMRIAKHPNIVELYEVMATKTRIYFVMEYCKGGELFNKLTKGKLRDDVAWNYFHQLINA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_011658253.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 12-like 
[Cucumis sativus]
 gb|KGN49312.1| hypothetical protein Csa_6G519640 [Cucumis sativus]
Length=467

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +2

Query  284  KNSKLESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvk  463
             +   ++E   ++  ++L G+YE+G+ LGHGTFAKVYHARN+ T  S A+KV+ K K++K
Sbjct  5    PDPDKKTETTRKDMPALLLGRYEIGKLLGHGTFAKVYHARNIKTNDSVAIKVIDKEKILK  64

Query  464  agmmEQIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREEL  643
             G++  IKREIS++  V+H NIV+L+EVMA+K KIYF ME VRGGELF K+SKGRL+EE+
Sbjct  65   GGLIAHIKREISILRRVRHPNIVQLFEVMATKAKIYFVMEYVRGGELFKKVSKGRLKEEV  124

Query  644  ARNYFQQLISAVDFCHSRGVYHRD  715
            AR YFQQLISAV FCH+RGVYHRD
Sbjct  125  ARKYFQQLISAVAFCHARGVYHRD  148



>ref|XP_008439731.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 12-like 
[Cucumis melo]
Length=467

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +2

Query  299  ESEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmE  478
            ++E   ++  ++L G+YE+G+ LGHGTFAKVYHARN+ T +S A+KV+ K K++K G++ 
Sbjct  10   KTETTRKDMPALLLGRYEIGKLLGHGTFAKVYHARNIKTNESVAIKVIDKEKILKGGLIA  69

Query  479  QIKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYF  658
             IKREIS++  V+H NIV+L+EVMA+K KIYF ME VRGGELF K+SKGRL+EE+AR YF
Sbjct  70   HIKREISILRRVRHPNIVQLFEVMATKAKIYFVMEYVRGGELFKKVSKGRLKEEVARKYF  129

Query  659  QQLISAVDFCHSRGVYHRD  715
            QQLISAV FCH+RGVYHRD
Sbjct  130  QQLISAVAFCHARGVYHRD  148



>ref|XP_010481526.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Camelina sativa]
Length=441

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            +L  KYELGR LG GTFAKVYHARN+ TG+S A+KV+ K K+VK G+++QIKREISVM +
Sbjct  7    ILMRKYELGRLLGQGTFAKVYHARNMKTGQSVAIKVIDKHKIVKVGLIDQIKREISVMRL  66

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            V+H N+V L+EVMASKTKIYFAME V+GGELF K+SKG+L+E++AR YFQQLI A+D+CH
Sbjct  67   VRHPNVVFLHEVMASKTKIYFAMEYVKGGELFDKVSKGKLKEDIARKYFQQLIGAIDYCH  126

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  127  SRGVYHRD  134



>ref|XP_006650055.1| PREDICTED: CBL-interacting protein kinase 10-like [Oryza brachyantha]
Length=451

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  302  SEMAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQ  481
            S    E+K ++L  +YE+G+ LG G+FAKVYH RNV   +S A+KV+ K K++K+ +M+Q
Sbjct  3    SNKMVEQKGNILMKRYEIGKLLGQGSFAKVYHGRNVKNSQSVAIKVIDKEKILKSELMDQ  62

Query  482  IKREISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQ  661
            I+REISVM++V+H  IV+LYEVMA+K+KIYF +E V+GGELF KI +GRL+EE+AR YFQ
Sbjct  63   IRREISVMNLVRHPCIVQLYEVMATKSKIYFVLEYVKGGELFNKIRRGRLKEEVARKYFQ  122

Query  662  QLISAVDFCHSRGVYHRD  715
            QLISA+DFCHSRGVYHRD
Sbjct  123  QLISAIDFCHSRGVYHRD  140



>ref|XP_009347309.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 25-like 
[Pyrus x bretschneideri]
Length=440

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            E+ + L GKYE+G+ LG GTFAKVYH R + T +S A+KV+ K +V K GMMEQIKREI 
Sbjct  2    EERTALFGKYEVGKLLGKGTFAKVYHGRQIATNESVAIKVISKDQVKKEGMMEQIKREIE  61

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +V+H N+VEL EVMA+KTKI+F ME VRGGELFAK++KGRL+E+ AR YFQQLISA+
Sbjct  62   VMRLVRHPNVVELKEVMATKTKIFFVMEYVRGGELFAKVAKGRLKEDQARKYFQQLISAI  121

Query  680  DFCHSRGVYHRD  715
            DFCHSRGV HRD
Sbjct  122  DFCHSRGVSHRD  133



>ref|XP_003517006.1| PREDICTED: CBL-interacting protein kinase 2-like [Glycine max]
Length=467

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E+K  VL  +YELGR LG GTFAKVYHARN+ TG S A+K++ K K++K GM++QIKREI
Sbjct  2    EQKGGVLMQRYELGRLLGQGTFAKVYHARNIITGMSVAIKIIDKEKILKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +++H ++VELYEVMASKTKIYF ME V+GGELF K+SKG+L+++ AR YFQQLISA
Sbjct  62   SVMRLIRHPHVVELYEVMASKTKIYFVMEYVKGGELFNKVSKGKLKQDDARRYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VD+CHSRGV HRD
Sbjct  122  VDYCHSRGVCHRD  134



>ref|XP_009629516.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana tomentosiformis]
 ref|XP_009629517.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana tomentosiformis]
Length=463

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  323  KCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISV  502
            K S+L  +YELGR LG GTFAKVY+ARN+  G+S A+KV+ K KV++ G++ QIKREISV
Sbjct  4    KGSILMERYELGRLLGQGTFAKVYYARNIRNGQSVAIKVIDKEKVLRVGLVNQIKREISV  63

Query  503  MSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVD  682
            M +V+H NIV LYEVMA+KTKIYF ME  +GGELF +++KGRL+E++AR YFQQLI+AVD
Sbjct  64   MRLVRHPNIVHLYEVMATKTKIYFVMEYAKGGELFNQVAKGRLKEDVARKYFQQLINAVD  123

Query  683  FCHSRGVYHRD  715
            FCHSRGVYHRD
Sbjct  124  FCHSRGVYHRD  134



>ref|XP_003557957.1| PREDICTED: CBL-interacting protein kinase 10-like [Brachypodium 
distachyon]
Length=447

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  314  AEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKRE  493
             E+K ++L  +YE+GR LG G+FAKVY+ R+V+T +S A+KV+ K K+ K G+M+Q++RE
Sbjct  2    PEQKGNILMQRYEMGRLLGQGSFAKVYYGRDVNTSQSVAIKVIDKEKIFKCGLMDQVRRE  61

Query  494  ISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLIS  673
            ISVM +VKH NIV+LYEVMA+KTKIYF +E V+GGELF K+ +GRL+E++AR YFQQL S
Sbjct  62   ISVMKLVKHPNIVQLYEVMATKTKIYFVLEYVKGGELFNKVQRGRLKEDVARKYFQQLNS  121

Query  674  AVDFCHSRGVYHRD  715
            AVDFCHSRGVYHRD
Sbjct  122  AVDFCHSRGVYHRD  135



>ref|XP_007033570.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007033571.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
 gb|EOY04496.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
 gb|EOY04497.1| SOS3-interacting protein 1 isoform 1 [Theobroma cacao]
Length=469

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K SVL  +YELGR LG GTFAKV++ARN+ TG S A+K++ K KV+K GM++QIKREI
Sbjct  2    ERKGSVLMQRYELGRLLGQGTFAKVHYARNLKTGMSVAIKIIDKEKVLKVGMIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+VELYEVMASKTKIYF ME  +GGELF K+ KG+L+E+ AR YFQQLISA
Sbjct  62   SVMKLVRHPNVVELYEVMASKTKIYFVMEYAKGGELFNKVVKGKLKEDAARRYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGV HRD
Sbjct  122  VDFCHSRGVCHRD  134



>ref|XP_009128822.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20 
[Brassica rapa]
Length=435

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            ++K  VL  +YELGR LG GTFAKVYHARN+ TG+S A+KV+ K KV K G+++QIKREI
Sbjct  2    DKKGIVLMKRYELGRLLGKGTFAKVYHARNLKTGESVAIKVIDKEKVTKVGLIDQIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H N+V L+EVMASKTKIYF ME V+GGELF K+SKG+L+E++AR YFQQLI A
Sbjct  62   SVMRLVRHPNVVFLHEVMASKTKIYFVMEYVKGGELFNKVSKGKLKEDIARKYFQQLIGA  121

Query  677  VDFCHSRGVYHRD  715
            +D+CHSRGVYHRD
Sbjct  122  IDYCHSRGVYHRD  134



>ref|XP_009616688.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 12-like 
[Nicotiana tomentosiformis]
Length=479

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  MAAEEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIK  487
            ++ +E   +L G+YE+G+ LGHGTFAKVYHARNV T +S A+KV+ K K++K G+++ IK
Sbjct  24   LSKKENQGLLLGRYEIGKLLGHGTFAKVYHARNVKTNESVAIKVIDKEKILKVGLIDHIK  83

Query  488  REISVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQL  667
            REIS++  V+H NIV+LYEVMA+K KIYF ME V+GGELF K++KGRL+EE+AR YFQQL
Sbjct  84   REISILRRVRHPNIVQLYEVMATKAKIYFVMEYVKGGELFNKVAKGRLKEEVARKYFQQL  143

Query  668  ISAVDFCHSRGVYHRD  715
            ISAV FCH+RGVYHRD
Sbjct  144  ISAVAFCHARGVYHRD  159



>ref|XP_009602782.1| PREDICTED: CBL-interacting protein kinase 2-like [Nicotiana tomentosiformis]
Length=473

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +2

Query  329  SVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMS  508
            +VL  +YELG+ LG GTFAKV+HAR++ T  + A+K++ K K+VK GM++QIKREISVM 
Sbjct  7    TVLMERYELGKLLGQGTFAKVHHARDLKTRLNVAIKMIDKEKIVKVGMIDQIKREISVMR  66

Query  509  MVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFC  688
            +V+H NIV+LYEVMASK KIYF ME V+GGELF K++KG+L+E++AR YFQQLISA+DFC
Sbjct  67   LVRHSNIVQLYEVMASKKKIYFVMEYVKGGELFNKVAKGKLKEDVARKYFQQLISAIDFC  126

Query  689  HSRGVYHRD  715
            HSRGVYHRD
Sbjct  127  HSRGVYHRD  135



>gb|AGT16994.1| CBL-interacting protein kinase [Saccharum hybrid cultivar R570]
Length=449

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K +VL  KYE+G+ LG GTFAKVYHAR+  T +S A+KV+ K KV+K G+++QIKREI
Sbjct  3    EYKGNVLMHKYEMGKLLGQGTFAKVYHARDTKTSESVAIKVIDKEKVMKVGLIDQIKREI  62

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            SVM +V+H NIV+LYEVMA+KTKIYF +E V+GGELF K+ +GRL+E+ AR YFQQLI A
Sbjct  63   SVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLICA  122

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  123  VDFCHSRGVYHRD  135



>ref|XP_004984448.1| PREDICTED: CBL-interacting protein kinase 10-like isoform X2 
[Setaria italica]
Length=380

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +2

Query  320  EKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREIS  499
            EK ++L  +YE+G+ LG G+FAKVYHAR V+T  S A+KV+ K K+ K G+M+QI REIS
Sbjct  3    EKGNILMQRYEMGKLLGKGSFAKVYHARCVNTSHSVAIKVIDKDKIFKCGLMDQISREIS  62

Query  500  VMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAV  679
            VM +VKH NIV++YEVMA+KTKIYF +E V+GGELF K+ +GRL+E++AR YFQQLISA+
Sbjct  63   VMKLVKHPNIVQMYEVMATKTKIYFVLEYVKGGELFNKVQRGRLKEDVARKYFQQLISAI  122

Query  680  DFCHSRGVYHRD  715
            DFCHSRGVYHRD
Sbjct  123  DFCHSRGVYHRD  134



>gb|KJB73033.1| hypothetical protein B456_011G210500 [Gossypium raimondii]
Length=439

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            E K  ++  KYELGR LG G FAKVY+ARN+ T +S A+KV+ K KV+K G+++  KREI
Sbjct  2    ETKGKIVMKKYELGRLLGQGNFAKVYYARNIETSQSVAIKVIDKEKVLKVGLIDHTKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S+M++VKH NI+ELYEVMASKTKIYF ME  +GGELF K+ K +LRE+LAR YFQQLISA
Sbjct  62   SIMNLVKHPNILELYEVMASKTKIYFVMEYAKGGELFKKVFKRKLREDLARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            VDFCHSRGVYHRD
Sbjct  122  VDFCHSRGVYHRD  134



>ref|XP_003590290.1| CBL-interacting protein kinase, partial [Medicago truncatula]
Length=215

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  317  EEKCSVLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREI  496
            +E  ++L G++E+G+ LGHGTFAKVY+A+N+ T +  A+KV+ K K++K G++  IKREI
Sbjct  2    KETSTLLLGRFEVGKLLGHGTFAKVYYAKNIKTDEGVAIKVIDKEKILKGGLVAHIKREI  61

Query  497  SVMSMVKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISA  676
            S++  V+H NIV+L+EVMA+KTKIYF ME VRGGELF K++KGRL+EE+AR YFQQLISA
Sbjct  62   SILRRVRHPNIVQLFEVMATKTKIYFVMEYVRGGELFNKVAKGRLKEEVARKYFQQLISA  121

Query  677  VDFCHSRGVYHRD  715
            V FCH+RGVYHRD
Sbjct  122  VGFCHARGVYHRD  134



>ref|XP_006279541.1| hypothetical protein CARUB_v10028407mg [Capsella rubella]
 gb|EOA12439.1| hypothetical protein CARUB_v10028407mg [Capsella rubella]
Length=436

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  332  VLHGKYELGRFLGHGTFAKVYHARNVHTgkssamkvvgkxkvvkagmmEQIKREISVMSM  511
            VL  KYELGR LG GTFAKVY+ARN+ TG+S A+KV+ K K+VK G+++QIKREISVM +
Sbjct  7    VLMQKYELGRLLGQGTFAKVYYARNMETGESVAIKVIDKHKIVKVGLIDQIKREISVMRL  66

Query  512  VKHHNIVELYEVMASKTKIYFAMELVRGGELFAKISKGRLREELARNYFQQLISAVDFCH  691
            V+H N+V L+EVMASKTKIYFAME V+GGELF K+SKG+L+E++AR YFQQLI A+D+CH
Sbjct  67   VRHPNVVFLHEVMASKTKIYFAMEYVKGGELFDKVSKGKLKEDIARKYFQQLIGAIDYCH  126

Query  692  SRGVYHRD  715
            SRGVYHRD
Sbjct  127  SRGVYHRD  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1295251989378