BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1182

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    333   4e-108   Nicotiana sylvestris
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    327   7e-106   Nicotiana tomentosiformis
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    322   4e-104   Solanum lycopersicum
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    322   5e-104   Solanum tuberosum [potatoes]
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    322   7e-104   Citrus sinensis [apfelsine]
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    321   1e-103   Gossypium arboreum [tree cotton]
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             320   3e-103   Citrus clementina [clementine]
gb|KJB10880.1|  hypothetical protein B456_001G230200                    317   7e-103   Gossypium raimondii
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    318   2e-102   Vitis vinifera
gb|KJB10878.1|  hypothetical protein B456_001G230200                    317   3e-102   Gossypium raimondii
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    316   1e-101   Gossypium arboreum [tree cotton]
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           313   1e-101   Medicago truncatula
ref|XP_007049652.1|  O-Glycosyl hydrolases family 17 protein isof...    310   2e-101   
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       315   4e-101   Morus notabilis
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           313   1e-100   Medicago truncatula
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    312   2e-100   
gb|KJB84083.1|  hypothetical protein B456_N004800                       312   4e-100   Gossypium raimondii
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             309   7e-100   
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    310   2e-99    Prunus mume [ume]
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    307   2e-99    Ricinus communis
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    310   3e-99    Nelumbo nucifera [Indian lotus]
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    309   6e-99    Cucumis sativus [cucumbers]
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    308   7e-99    Cucumis melo [Oriental melon]
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    307   2e-98    Sesamum indicum [beniseed]
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    307   3e-98    Cicer arietinum [garbanzo]
ref|XP_006386885.1|  3-glucanase family protein                         307   4e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    306   7e-98    Populus euphratica
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    308   7e-98    
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    306   1e-97    Fragaria vesca subsp. vesca
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    305   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    305   2e-97    Eucalyptus grandis [rose gum]
ref|XP_012085272.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    304   7e-97    Jatropha curcas
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         303   1e-96    Jatropha curcas
dbj|BAA89481.1|  beta-1,3-glucanase                                     301   9e-96    Salix gilgiana
gb|KJB10879.1|  hypothetical protein B456_001G230200                    300   1e-95    Gossypium raimondii
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             300   3e-95    Phaseolus vulgaris [French bean]
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    299   6e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    298   8e-95    
ref|XP_002303070.2|  3-glucanase family protein                         298   1e-94    
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    311   8e-94    
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    295   1e-93    Arabis alpina [alpine rockcress]
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    296   2e-93    Brassica rapa
emb|CDY28063.1|  BnaC05g44650D                                          294   4e-93    Brassica napus [oilseed rape]
emb|CDY45466.1|  BnaC09g12840D                                          293   7e-93    Brassica napus [oilseed rape]
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    293   1e-92    Camelina sativa [gold-of-pleasure]
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  290   2e-92    Medicago truncatula
emb|CDY24629.1|  BnaA05g30280D                                          292   2e-92    Brassica napus [oilseed rape]
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             291   3e-92    Capsella rubella
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    291   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    291   4e-92    Camelina sativa [gold-of-pleasure]
ref|XP_007134153.1|  hypothetical protein PHAVU_010G0238001g            287   4e-92    Phaseolus vulgaris [French bean]
ref|XP_003626949.1|  Beta-1 3-glucanase                                 291   5e-92    Medicago truncatula
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             291   5e-92    Eutrema salsugineum [saltwater cress]
ref|XP_010906169.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    283   6e-92    Elaeis guineensis
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               290   8e-92    Arabidopsis lyrata subsp. lyrata
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               290   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    290   2e-91    Populus euphratica
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               289   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    288   1e-90    Nelumbo nucifera [Indian lotus]
emb|CDP03931.1|  unnamed protein product                                286   2e-90    Coffea canephora [robusta coffee]
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    286   2e-90    Tarenaya hassleriana [spider flower]
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    286   6e-90    
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             285   9e-90    
emb|CDY08004.1|  BnaC03g35190D                                          284   3e-89    Brassica napus [oilseed rape]
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    283   6e-89    Glycine max [soybeans]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    283   7e-89    Glycine max [soybeans]
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    283   7e-89    Tarenaya hassleriana [spider flower]
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    279   2e-88    
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                281   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    281   3e-88    Brassica rapa
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    280   1e-87    
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    280   1e-87    Phoenix dactylifera
ref|XP_006830552.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    277   8e-87    
gb|ERM97968.1|  hypothetical protein AMTR_s00117p00097230               277   1e-86    Amborella trichopoda
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    274   3e-86    
emb|CDO96794.1|  unnamed protein product                                274   2e-85    Coffea canephora [robusta coffee]
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    273   4e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012078455.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    273   6e-85    Jatropha curcas
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    273   9e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            273   5e-84    
gb|EPS58986.1|  hypothetical protein M569_15824                         270   5e-84    Genlisea aurea
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             270   7e-84    Populus trichocarpa [western balsam poplar]
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    270   9e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    270   9e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011620347.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    268   2e-83    Amborella trichopoda
ref|XP_002298669.2|  glucan endo-1 family protein                       267   2e-83    
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    269   3e-83    Populus euphratica
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    266   2e-82    Populus euphratica
dbj|BAJ88052.1|  predicted protein                                      266   6e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    265   7e-82    Vitis vinifera
gb|KJB28087.1|  hypothetical protein B456_005G026800                    264   1e-81    Gossypium raimondii
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    263   3e-81    
gb|ACR37660.1|  unknown                                                 253   2e-80    Zea mays [maize]
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   260   3e-80    Citrus sinensis [apfelsine]
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    261   3e-80    Brachypodium distachyon [annual false brome]
emb|CDX74052.1|  BnaA03g29950D                                          263   4e-80    
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    259   9e-80    
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          259   1e-79    Sorghum bicolor [broomcorn]
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             259   1e-79    
gb|ERM97971.1|  hypothetical protein AMTR_s00117p00104410               259   2e-79    Amborella trichopoda
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    259   2e-79    Solanum tuberosum [potatoes]
gb|ACN28576.1|  unknown                                                 254   2e-79    Zea mays [maize]
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    258   2e-79    
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           258   3e-79    Medicago truncatula
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    257   1e-78    
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    255   4e-78    
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         253   9e-78    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      254   1e-77    Zea mays [maize]
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    254   2e-77    Tarenaya hassleriana [spider flower]
dbj|BAK04571.1|  predicted protein                                      255   4e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    251   9e-77    Nicotiana tomentosiformis
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    252   1e-76    Nicotiana sylvestris
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    251   1e-76    Nicotiana tomentosiformis
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    252   2e-76    
emb|CDY50110.1|  BnaC01g43580D                                          251   3e-76    Brassica napus [oilseed rape]
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             250   4e-76    
gb|EEC84834.1|  hypothetical protein OsI_31928                          250   4e-76    Oryza sativa Indica Group [Indian rice]
emb|CDY63754.1|  BnaAnng19080D                                          250   5e-76    Brassica napus [oilseed rape]
ref|NP_001063586.1|  Os09g0502200                                       250   5e-76    
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    250   6e-76    Brassica rapa
emb|CDY06469.1|  BnaC06g11750D                                          250   7e-76    
emb|CAA49513.1|  beta-1,3-glucanase homologue                           249   8e-76    Brassica napus [oilseed rape]
emb|CDP15106.1|  unnamed protein product                                249   9e-76    Coffea canephora [robusta coffee]
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             249   2e-75    Eutrema salsugineum [saltwater cress]
emb|CDY59775.1|  BnaCnng35540D                                          249   2e-75    Brassica napus [oilseed rape]
emb|CDY67322.1|  BnaA03g57600D                                          240   2e-75    Brassica napus [oilseed rape]
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    248   3e-75    Brassica rapa
gb|EMT13087.1|  Putative glucan endo-1,3-beta-glucosidase A6            244   4e-75    
emb|CDY18092.1|  BnaA01g23530D                                          248   5e-75    Brassica napus [oilseed rape]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    248   5e-75    Setaria italica
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    248   5e-75    Brassica rapa
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             247   6e-75    
emb|CDY08310.1|  BnaA05g13090D                                          247   1e-74    Brassica napus [oilseed rape]
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    246   2e-74    
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    246   2e-74    Arabis alpina [alpine rockcress]
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    245   3e-74    Cucumis melo [Oriental melon]
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    245   5e-74    Camelina sativa [gold-of-pleasure]
emb|CDY12371.1|  BnaC08g08340D                                          244   6e-74    Brassica napus [oilseed rape]
gb|KFK39673.1|  a6 anther-specific protein                              244   7e-74    Arabis alpina [alpine rockcress]
emb|CDP15107.1|  unnamed protein product                                239   1e-73    Coffea canephora [robusta coffee]
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    244   2e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    243   2e-73    
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          243   4e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   7e-73    
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   8e-73    Brassica rapa
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   8e-73    Brassica rapa
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                241   1e-72    Erythranthe guttata [common monkey flower]
gb|KJB37880.1|  hypothetical protein B456_006G224700                    241   1e-72    Gossypium raimondii
emb|CDY53213.1|  BnaC03g74070D                                          241   2e-72    Brassica napus [oilseed rape]
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               241   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28569.1|  unknown                                                 241   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011651104.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    240   2e-72    Cucumis sativus [cucumbers]
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             240   3e-72    
emb|CDY27122.1|  BnaA08g07600D                                          240   4e-72    Brassica napus [oilseed rape]
dbj|BAK05423.1|  predicted protein                                      240   4e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             240   5e-72    Capsella rubella
gb|AAM64490.1|  beta-1,3-glucanase, putative                            239   5e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             239   9e-72    Capsella rubella
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    236   2e-71    Setaria italica
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             238   2e-71    Eutrema salsugineum [saltwater cress]
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    237   6e-71    Brassica rapa
emb|CDY12732.1|  BnaC04g29090D                                          237   7e-71    Brassica napus [oilseed rape]
emb|CDY01191.1|  BnaA04g06280D                                          236   8e-71    
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    236   1e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    236   3e-70    Tarenaya hassleriana [spider flower]
gb|ADE76604.1|  unknown                                                 234   4e-70    Picea sitchensis
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   5e-70    Camelina sativa [gold-of-pleasure]
ref|NP_001168659.1|  uncharacterized protein LOC100382447               230   3e-69    Zea mays [maize]
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    231   7e-69    Camelina sativa [gold-of-pleasure]
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    230   3e-68    Zea mays [maize]
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    229   6e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008669802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   1e-67    Zea mays [maize]
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    227   4e-67    Brachypodium distachyon [annual false brome]
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       225   2e-66    Cucumis sativus [cucumbers]
emb|CBI39414.3|  unnamed protein product                                221   6e-66    Vitis vinifera
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             218   1e-64    Brassica oleracea var. italica [asparagus broccoli]
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             216   9e-64    Brassica rapa var. perviridis [kabuna]
gb|EEC76519.1|  hypothetical protein OsI_14305                          216   7e-63    Oryza sativa Indica Group [Indian rice]
ref|NP_001051879.1|  Os03g0845600                                       216   7e-63    
ref|XP_001777261.1|  predicted protein                                  211   3e-61    
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          209   2e-60    Sorghum bicolor [broomcorn]
dbj|BAE80092.1|  glycosyl hydrolase family 17                           206   2e-59    Silene latifolia
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    205   8e-59    
ref|XP_001780045.1|  predicted protein                                  204   1e-58    
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          200   6e-57    Sorghum bicolor [broomcorn]
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    202   6e-57    Brachypodium distachyon [annual false brome]
ref|NP_001062294.2|  Os08g0525800                                       197   5e-56    
emb|CAK18899.1|  glucan 1,3-beta glucosidase                            188   2e-55    Cocos nucifera
dbj|BAC75423.1|  putative beta-1,3-glucanase                            196   2e-55    Oryza sativa Japonica Group [Japonica rice]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     194   3e-55    Eucalyptus grandis [rose gum]
gb|EAZ07710.1|  hypothetical protein OsI_29967                          200   1e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_001784285.1|  predicted protein                                  193   1e-54    
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             183   1e-50    Selaginella moellendorffii
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   1e-50    Glycine max [soybeans]
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             182   3e-50    Selaginella moellendorffii
gb|KHG21190.1|  hypothetical protein F383_01641                         182   4e-50    Gossypium arboreum [tree cotton]
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              181   5e-50    
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              181   6e-50    
gb|KJB13749.1|  hypothetical protein B456_002G092600                    181   8e-50    Gossypium raimondii
gb|EEC76518.1|  hypothetical protein OsI_14304                          173   9e-50    Oryza sativa Indica Group [Indian rice]
gb|ADU15553.1|  GLU                                                     179   4e-49    Gossypium hirsutum [American cotton]
gb|KJB62900.1|  hypothetical protein B456_009G442700                    179   5e-49    Gossypium raimondii
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   8e-49    Glycine max [soybeans]
gb|KHG04965.1|  hypothetical protein F383_30444                         178   9e-49    Gossypium arboreum [tree cotton]
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    178   1e-48    Cicer arietinum [garbanzo]
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    177   2e-48    Glycine max [soybeans]
ref|XP_001781801.1|  predicted protein                                  176   3e-48    
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   177   4e-48    Medicago truncatula
emb|CAA49515.1|  beta-1,3-glucanase homologue                           167   6e-48    Brassica napus [oilseed rape]
gb|ABR16205.1|  unknown                                                 175   2e-47    Picea sitchensis
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     174   3e-47    Glycine soja [wild soybean]
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      174   3e-47    Sesamum indicum [beniseed]
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     172   4e-47    Glycine soja [wild soybean]
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     173   6e-47    Cucumis melo [Oriental melon]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    173   7e-47    
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    172   2e-46    Arabis alpina [alpine rockcress]
emb|CDX92794.1|  BnaC07g40520D                                          171   3e-46    
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     171   4e-46    Brassica rapa
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     171   5e-46    Cucumis sativus [cucumbers]
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     171   7e-46    Cucumis sativus [cucumbers]
gb|KHG21189.1|  hypothetical protein F383_01641                         171   1e-45    Gossypium arboreum [tree cotton]
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            169   4e-45    
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     168   5e-45    Solanum lycopersicum
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   6e-45    Solanum tuberosum [potatoes]
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   7e-45    Eucalyptus grandis [rose gum]
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             168   7e-45    Citrus clementina [clementine]
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             168   7e-45    Phaseolus vulgaris [French bean]
dbj|BAF01977.1|  putative beta-1,3-glucanase                            164   8e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     168   8e-45    Cucumis melo [Oriental melon]
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     167   9e-45    Populus euphratica
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         167   1e-44    Jatropha curcas
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-44    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-44    Camelina sativa [gold-of-pleasure]
ref|XP_012070897.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-44    Jatropha curcas
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   1e-44    
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             167   2e-44    Phaseolus vulgaris [French bean]
gb|ACN39797.1|  unknown                                                 167   2e-44    Picea sitchensis
emb|CDP14397.1|  unnamed protein product                                167   2e-44    Coffea canephora [robusta coffee]
emb|CDY46679.1|  BnaA03g48290D                                          166   2e-44    Brassica napus [oilseed rape]
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     167   2e-44    Nelumbo nucifera [Indian lotus]
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   2e-44    
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               167   3e-44    
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             166   3e-44    Capsella rubella
gb|EPS68573.1|  hypothetical protein M569_06194                         166   3e-44    Genlisea aurea
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                166   4e-44    Erythranthe guttata [common monkey flower]
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                166   4e-44    Erythranthe guttata [common monkey flower]
gb|EPS59841.1|  hypothetical protein M569_14964                         166   5e-44    Genlisea aurea
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               165   7e-44    
gb|EPS73917.1|  hypothetical protein M569_00835                         164   9e-44    Genlisea aurea
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     165   1e-43    Nicotiana tomentosiformis
ref|XP_012080639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     165   1e-43    Jatropha curcas
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   1e-43    Nicotiana sylvestris
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   1e-43    Solanum tuberosum [potatoes]
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     164   1e-43    Vitis vinifera
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               164   1e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001761806.1|  predicted protein                                  164   2e-43    
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     164   2e-43    Fragaria vesca subsp. vesca
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    164   2e-43    Camelina sativa [gold-of-pleasure]
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                163   3e-43    Erythranthe guttata [common monkey flower]
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    163   3e-43    Camelina sativa [gold-of-pleasure]
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                164   3e-43    Erythranthe guttata [common monkey flower]
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         163   3e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     163   3e-43    Sesamum indicum [beniseed]
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    163   4e-43    Populus euphratica
gb|AAL77689.1|  AT5g55180/MCO15_13                                      162   5e-43    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               162   6e-43    Arabidopsis thaliana [mouse-ear cress]
emb|CDP13790.1|  unnamed protein product                                164   6e-43    Coffea canephora [robusta coffee]
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        163   6e-43    Populus trichocarpa [western balsam poplar]
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        162   6e-43    Arabidopsis lyrata subsp. lyrata
gb|KHG05496.1|  hypothetical protein F383_30989                         162   7e-43    Gossypium arboreum [tree cotton]
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               162   8e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   1e-42    Populus euphratica
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             162   1e-42    
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        162   1e-42    
emb|CDP05678.1|  unnamed protein product                                162   1e-42    Coffea canephora [robusta coffee]
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   1e-42    Fragaria vesca subsp. vesca
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             161   2e-42    Eutrema salsugineum [saltwater cress]
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    161   2e-42    Ricinus communis
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             162   2e-42    Capsella rubella
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  162   2e-42    
gb|KJB10704.1|  hypothetical protein B456_001G216900                    158   2e-42    
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   2e-42    
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    161   2e-42    
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     161   3e-42    
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   3e-42    
ref|XP_001752749.1|  predicted protein                                  160   3e-42    
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             160   3e-42    
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      161   4e-42    
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   4e-42    
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    160   4e-42    
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   4e-42    
gb|ERN00121.1|  hypothetical protein AMTR_s00112p00108890               160   4e-42    
emb|CDY18049.1|  BnaC07g04210D                                          160   5e-42    
ref|XP_006837267.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     160   5e-42    
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   5e-42    
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     160   5e-42    
ref|XP_010914932.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   6e-42    
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     160   8e-42    
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             160   8e-42    
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     160   1e-41    
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-41    
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-41    
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             159   1e-41    
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-41    
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-41    
emb|CAN60692.1|  hypothetical protein VITISV_007558                     158   1e-41    
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      159   1e-41    
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   1e-41    
ref|XP_001772420.1|  predicted protein                                  159   1e-41    
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             159   2e-41    
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   2e-41    
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     159   2e-41    
emb|CDY19908.1|  BnaC09g31740D                                          158   2e-41    
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     159   2e-41    
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             158   2e-41    
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    159   2e-41    
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     158   2e-41    
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        158   3e-41    
emb|CDY36734.1|  BnaA03g11520D                                          158   3e-41    
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   3e-41    
gb|KJB10701.1|  hypothetical protein B456_001G216900                    158   3e-41    
emb|CDY12009.1|  BnaC03g14350D                                          158   3e-41    
emb|CDY14214.1|  BnaA08g13450D                                          158   4e-41    
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     158   4e-41    
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        157   4e-41    
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              157   4e-41    
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              157   4e-41    
ref|XP_012076842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   4e-41    
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             157   5e-41    
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             157   5e-41    
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   7e-41    
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      157   7e-41    
ref|XP_001767901.1|  predicted protein                                  157   8e-41    
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    157   8e-41    
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             157   8e-41    
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     157   8e-41    
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             157   1e-40    
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             157   1e-40    
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        156   1e-40    
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    157   1e-40    
emb|CDY20780.1|  BnaA02g09200D                                          156   1e-40    
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   1e-40    
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   1e-40    
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    156   1e-40    
emb|CDY56498.1|  BnaAnng14330D                                          156   1e-40    
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             156   1e-40    
emb|CDY06601.1|  BnaC02g13250D                                          156   1e-40    
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   2e-40    
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   2e-40    
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   2e-40    
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   2e-40    
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   2e-40    
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             156   2e-40    
emb|CDY17308.1|  BnaA10g09420D                                          155   2e-40    
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      156   2e-40    
ref|XP_007017515.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    153   3e-40    
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   156   3e-40    
gb|AAZ40342.1|  beta-1,3-glucanase 2                                    155   3e-40    
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     155   3e-40    
gb|EPS73640.1|  hypothetical protein M569_01113                         155   3e-40    
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    155   4e-40    
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     155   4e-40    
gb|KHN47213.1|  Putative glucan endo-1,3-beta-glucosidase A6            152   4e-40    
ref|XP_003569762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   4e-40    
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     155   4e-40    
ref|XP_010232285.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   4e-40    
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     155   5e-40    
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     155   5e-40    
ref|XP_003541516.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    153   5e-40    
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    156   5e-40    
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     155   5e-40    
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   6e-40    
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    154   7e-40    
ref|XP_007012990.1|  O-Glycosyl hydrolases family 17 protein isof...    154   7e-40    
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   7e-40    
gb|KJB27172.1|  hypothetical protein B456_004G282300                    155   7e-40    
ref|XP_008672638.1|  PREDICTED: uncharacterized protein LOC100278...    154   8e-40    
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    154   9e-40    
ref|XP_002976500.1|  hypothetical protein SELMODRAFT_105435             154   9e-40    
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    154   9e-40    
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             154   1e-39    
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   1e-39    
ref|XP_012086410.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      154   1e-39    
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         154   1e-39    
emb|CAN61862.1|  hypothetical protein VITISV_043447                     154   1e-39    
ref|XP_006644680.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   1e-39    
ref|XP_002973407.1|  hypothetical protein SELMODRAFT_413735             154   1e-39    
ref|XP_008799775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   1e-39    
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   1e-39    
gb|KHG14816.1|  hypothetical protein F383_17797                         154   1e-39    
ref|XP_001784088.1|  predicted protein                                  153   2e-39    
ref|XP_006371969.1|  glycosyl hydrolase family 17 family protein        154   2e-39    
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      153   2e-39    
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   2e-39    
ref|XP_007017516.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    153   2e-39    
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    153   2e-39    
ref|XP_007017514.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    153   2e-39    
gb|KHG11479.1|  hypothetical protein F383_06303                         153   2e-39    
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   2e-39    
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    154   2e-39    
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   2e-39    
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             153   2e-39    
emb|CAB36529.1|  putative beta-1, 3-glucanase                           153   2e-39    
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        153   2e-39    
ref|XP_002456331.1|  hypothetical protein SORBIDRAFT_03g034100          153   2e-39    
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     153   2e-39    
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    153   2e-39    
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   2e-39    
ref|XP_004969893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   3e-39    
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     152   3e-39    
ref|XP_008672637.1|  PREDICTED: uncharacterized protein LOC100278...    154   3e-39    
emb|CDP16794.1|  unnamed protein product                                153   3e-39    
gb|KJB22745.1|  hypothetical protein B456_004G064200                    153   4e-39    
gb|EEC71452.1|  hypothetical protein OsI_03677                          152   4e-39    
gb|EAZ13481.1|  hypothetical protein OsJ_03397                          152   4e-39    
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            152   4e-39    
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   4e-39    
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   4e-39    
gb|AAD26909.1|  putative beta-1,3-glucanase                             152   4e-39    
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             152   4e-39    
ref|NP_001044198.1|  Os01g0739700                                       152   4e-39    
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    152   5e-39    
ref|XP_003620800.1|  Glucan endo-1,3-beta-glucosidase                   151   5e-39    
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             152   6e-39    
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   6e-39    
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             152   6e-39    
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      152   6e-39    
ref|XP_008806478.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    152   6e-39    
ref|XP_011078239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   6e-39    
emb|CDM84006.1|  unnamed protein product                                152   6e-39    
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   7e-39    
gb|KHN25369.1|  Glucan endo-1,3-beta-glucosidase 7                      149   7e-39    
dbj|BAJ85556.1|  predicted protein                                      152   8e-39    
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      152   8e-39    
gb|EMT15518.1|  Glucan endo-1,3-beta-glucosidase 13                     152   9e-39    
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   9e-39    
ref|XP_006379239.1|  hypothetical protein POPTR_0009s11830g             151   9e-39    
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      151   1e-38    
emb|CDP00829.1|  unnamed protein product                                151   1e-38    
gb|KHG26459.1|  hypothetical protein F383_04538                         151   1e-38    
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     151   1e-38    
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      151   1e-38    
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   1e-38    
dbj|BAH57260.1|  AT3G13560                                              150   2e-38    
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      150   2e-38    
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   2e-38    
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   2e-38    
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   2e-38    
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   2e-38    
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   2e-38    
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                154   2e-38    
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     150   2e-38    
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   3e-38    
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     150   3e-38    
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             150   3e-38    
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   3e-38    
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                150   3e-38    
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      150   3e-38    
gb|KEH27229.1|  glucan endo-1,3-beta-glucosidase-like protein           150   3e-38    
gb|ABD91577.1|  beta-1,3-glucanase                                      150   3e-38    
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    150   3e-38    
gb|ADE76367.1|  unknown                                                 150   3e-38    
gb|ABD91576.1|  beta-1,3-glucanase                                      150   3e-38    
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   3e-38    
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     149   3e-38    
gb|AFU52641.1|  beta-1,3-glucanase 6                                    150   4e-38    
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   4e-38    
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        150   4e-38    
gb|KJB10512.1|  hypothetical protein B456_001G204900                    150   4e-38    
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      150   4e-38    
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   150   4e-38    
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      150   4e-38    
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      150   5e-38    
gb|EMS49856.1|  Glucan endo-1,3-beta-glucosidase 13                     149   5e-38    
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   5e-38    
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    149   5e-38    
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        149   5e-38    
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   5e-38    
ref|XP_011626761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     149   6e-38    
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 149   6e-38    
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    149   6e-38    
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   6e-38    
gb|KEH40123.1|  glucan endo-1,3-beta-glucosidase-like protein           149   6e-38    
emb|CDY62033.1|  BnaC03g77660D                                          149   6e-38    
emb|CDY48807.1|  BnaC02g34070D                                          149   6e-38    
gb|ERN15184.1|  hypothetical protein AMTR_s00056p00158530               149   7e-38    
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      149   7e-38    
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   7e-38    
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   7e-38    
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             149   7e-38    
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      149   7e-38    
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             149   7e-38    
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             149   8e-38    
gb|AFU52656.1|  beta-1,3-glucanase 23                                   149   8e-38    
ref|XP_010929505.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   8e-38    
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             149   9e-38    
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   9e-38    
ref|XP_004251644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     149   9e-38    
gb|ERN17398.1|  hypothetical protein AMTR_s00037p00209440               149   9e-38    
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   9e-38    



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN G+VDQIGASIYN+ATYNRNV+KKFT+K  VGTPA+PGV++PTL+FALYNENQK
Sbjct  268  ETGWPNAGNVDQIGASIYNAATYNRNVIKKFTAKPPVGTPAKPGVIVPTLLFALYNENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGTNIY IDLSGKTP SE+ PLP+P  N+PYKGK+WCVV   A++T
Sbjct  328  PGPGTERHFGLLYPNGTNIYEIDLSGKTPLSEYEPLPRPRNNEPYKGKIWCVVGRKASVT  387

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             V+ AL+YACGQGNRTC+ I+PGG CY PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA
Sbjct  388  EVSGALAYACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLA  447

Query  247  VKTINDPSYGACKYPSITL  191
            + T +DPSYGACK+PS+TL
Sbjct  448  IPTKSDPSYGACKFPSVTL  466



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN G+VDQIGA+IYN+ATYNRNV+KKFT+K  VGTPA+PGVV+PTL+FALYNEN+K
Sbjct  267  ETGWPNAGNVDQIGANIYNAATYNRNVIKKFTAKPPVGTPAKPGVVVPTLLFALYNENEK  326

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGTNIY IDLSGKT  SE+ PLP+P  N+PYKGK+WCVV   A++T
Sbjct  327  PGPGTERHFGLLYPNGTNIYGIDLSGKTSLSEYEPLPRPRNNEPYKGKIWCVVGRKASVT  386

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             V+ AL+YACGQGNRTC+ I+PGG CY PNSL+ HA+YAFSSYWAQF+S GGTCYFNGLA
Sbjct  387  EVSGALAYACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGGTCYFNGLA  446

Query  247  VKTINDPSYGACKYPSITL  191
            + T +DPSYGACK+PS+TL
Sbjct  447  IPTKSDPSYGACKFPSVTL  465



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN G VDQIGA+IYN+ATYNRNV+KKFT K  +GTPA+PGVV+PTL+FALYNENQK
Sbjct  266  ETGWPNAGGVDQIGANIYNAATYNRNVIKKFTVKPPIGTPAKPGVVVPTLLFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGTNIY IDLSGKTPESE+  LP+   N+PY GK+WCVV+ +AN +
Sbjct  326  PGPGTERHFGLLYPNGTNIYGIDLSGKTPESEYKALPRARNNEPYTGKIWCVVSRSANAS  385

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  A+SYACGQGNRTC+ IQPGG CYNPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL 
Sbjct  386  ELGGAMSYACGQGNRTCDEIQPGGKCYNPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLT  445

Query  247  VKTINDPSYGACKYPSITL  191
            + T  DPSYG+CK+PS+TL
Sbjct  446  IPTKKDPSYGSCKFPSVTL  464



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   322 bits (825),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN G +DQIGA+IYN+ATYNRNV+KKFT+K  +GTPA+PGVV+PTL+FALYNENQK
Sbjct  266  ETGWPNAGGMDQIGANIYNAATYNRNVIKKFTAKPPIGTPAKPGVVVPTLLFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGTN+Y IDLSGKTPESE+  LP+   N+PYKGK+WCVV   AN +
Sbjct  326  PGPGTERHFGLLYPNGTNVYGIDLSGKTPESEYKALPRARNNEPYKGKIWCVVGRNANAS  385

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  A+SYACGQGNRTC+ I+PGG CYNPNSL+ HA+YAFSSYW+QF+S GGTCYFNGL 
Sbjct  386  ELGGAMSYACGQGNRTCDEIRPGGKCYNPNSLVSHANYAFSSYWSQFKSSGGTCYFNGLT  445

Query  247  VKTINDPSYGACKYPSITL  191
            + T  DPSYG+CK+PS+TL
Sbjct  446  IPTKKDPSYGSCKFPSVTL  464



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   322 bits (824),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGA+IYN+ATYNRN+VKK T+K  +GTPARPG V+P+ IFALYNENQK
Sbjct  268  ETGWPNGGDYDQIGANIYNAATYNRNIVKKLTAKRAIGTPARPGWVLPSFIFALYNENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+++Y IDLSG  PE E+ PLPKPT N+PYKGK+WCV A  AN T
Sbjct  328  PGPGTERHFGLLYPNGSHVYEIDLSGNAPEKEYEPLPKPTNNEPYKGKIWCVAAKVANTT  387

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A++ ALSYAC QGN+TC+PIQPG  C  P SL+  ASYAFSSYW+QFR LGGTCYFNGLA
Sbjct  388  ALSSALSYACSQGNKTCDPIQPGKPCAKPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLA  447

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPS+G+CK+PS+TL
Sbjct  448  TQTIKDPSHGSCKFPSVTL  466



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQK
Sbjct  263  ETGWPNAGDIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGTN+Y IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N T
Sbjct  323  PGPGTERHFGLLYPNGTNVYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNET  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A++ ALSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q+R  G TCYFNGLA
Sbjct  383  ALSSALSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQYRKTGATCYFNGLA  442

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS+G CK+PS+TL
Sbjct  443  TQTAKDPSFGHCKFPSVTL  461



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGA+IYN+ATYNRN+VKK T+K  +GTPARPG V+P+ IFALYNENQK
Sbjct  268  ETGWPNGGDYDQIGANIYNAATYNRNIVKKLTAKPAIGTPARPGWVLPSFIFALYNENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+++Y IDLSG  PE E+ PLPKPT N+PYKGK+WCV A  AN T
Sbjct  328  PGPGTERHFGLLYPNGSHVYEIDLSGNAPEKEYGPLPKPTNNEPYKGKIWCVAAKVANTT  387

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A++ ALSYAC QGN+TC+PIQPG  C  P SL+  ASYAFSSYW+QFR LGGTCYFNGLA
Sbjct  388  ALSSALSYACSQGNKTCDPIQPGKPCAKPGSLVWKASYAFSSYWSQFRKLGGTCYFNGLA  447

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPS+G+CK+PS+TL
Sbjct  448  TQTIKDPSHGSCKFPSVTL  466



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   317 bits (811),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 168/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQK
Sbjct  188  ETGWPNAGDIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQK  247

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N T
Sbjct  248  PGPGTERHFGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNET  307

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A++ ALSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA
Sbjct  308  ALSSALSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLA  367

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS+G CK+PS+TL
Sbjct  368  TQTAKDPSFGHCKFPSVTL  386



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRN++K+  +K  VGTPARPG V+PT IF+LYNENQK
Sbjct  269  ETGWPNAGDIDQIGANIYNAATYNRNLIKRLNAKPPVGTPARPGSVLPTFIFSLYNENQK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+LYPN +++Y IDL+G+TPESE+PPLP P  N+PYKGK+WCVVA  AN T
Sbjct  329  GGPGTERHWGLLYPNESSVYQIDLTGETPESEYPPLPAPENNEPYKGKIWCVVAKGANRT  388

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL+YACGQGN TC P+QPG  CY P SL+RHAS+AFSSYWAQFRS GGTCYFNGLA
Sbjct  389  ELGSALTYACGQGNGTCEPVQPGRKCYKPVSLVRHASFAFSSYWAQFRSTGGTCYFNGLA  448

Query  247  VKTINDPSYGACKYPSITL  191
            V+T+ DPSYG+CK+PS+TL
Sbjct  449  VQTMKDPSYGSCKFPSVTL  467



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 168/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQK
Sbjct  263  ETGWPNAGDIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N T
Sbjct  323  PGPGTERHFGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNET  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A++ ALSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA
Sbjct  383  ALSSALSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLA  442

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS+G CK+PS+TL
Sbjct  443  TQTAKDPSFGHCKFPSVTL  461



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 168/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNV+KK T+K  VGTPARPG V+P+ IFALYNENQK
Sbjct  266  ETGWPNAGDIDQIGANIYNAATYNRNVIKKLTAKPPVGTPARPGRVLPSFIFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+N+Y IDLSGKTP+S + PLPKPT N+PYKGK+WCV A   N +
Sbjct  326  PGPGTERHFGLLYPNGSNVYAIDLSGKTPDSAYEPLPKPTNNEPYKGKIWCVAARGVNAS  385

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  ALSYAC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+QF+  G TCYFNGLA
Sbjct  386  ELGSALSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQFKKTGATCYFNGLA  445

Query  247  VKTINDPSYGACKYPSITL  191
              T  DPS+G CK+PS+TL
Sbjct  446  TPTAKDPSFGRCKFPSVTL  464



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 169/199 (85%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGDVDQIGA+++N+ATYNRN VKK   K  VGTPARPG+++P+ +FAL+NEN K
Sbjct  188  ETGWPNGGDVDQIGANVFNAATYNRNFVKKVMKKPIVGTPARPGLILPSFLFALFNENIK  247

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+ +Y IDLSGKTPE EFP LP P  N+PYKGK+WCV    +N+T
Sbjct  248  PGPGTERHFGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRGSNVT  307

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+ +AL+YAC QGNRTC+P+QPG  C+ P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA
Sbjct  308  ALGEALTYACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLA  367

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPSYG+CK+PS+TL
Sbjct  368  TQTAKDPSYGSCKFPSVTL  386



>ref|XP_007049652.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX93809.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=328

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRN +KK T+K  +GTPARPG V+P+ IFALYNENQK
Sbjct  130  ETGWPNAGDIDQIGANIYNAATYNRNAIKKLTAKPAIGTPARPGWVLPSFIFALYNENQK  189

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+N+Y IDLSG+TP+S+F PLPKP  N+PYKGK+WCV A   N +
Sbjct  190  PGPGTERHFGLLYPNGSNVYGIDLSGETPDSDFEPLPKPDNNEPYKGKIWCVAARGVNAS  249

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  ALSYAC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+Q +  G TCYFNGLA
Sbjct  250  ELGSALSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQLKQTGATCYFNGLA  309

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS+G CK+PS+TL
Sbjct  310  TQTAKDPSFGHCKFPSVTL  328



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 171/202 (85%), Gaps = 5/202 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQIGA+IYN+ATYNRNVVKK ++K  VGTPARPG V+P+ IFALYNENQK
Sbjct  269  ETGWPNGGDIDQIGANIYNAATYNRNVVKKLSAKPPVGTPARPGSVLPSFIFALYNENQK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---  437
            PGPGTERHFG+LYP+G NIYPI+LSG+TP S++PPLP P  N PYKGK+WCVVA  A   
Sbjct  329  PGPGTERHFGLLYPSGKNIYPINLSGETPLSDYPPLPAPENNTPYKGKIWCVVAKEAMRG  388

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N T +A ALSYAC QGN+TC+ IQPGG C  P+SL+R ASYAFSSYWAQF+ LGG CYFN
Sbjct  389  NKTELAAALSYACSQGNKTCDAIQPGGICSRPDSLVRRASYAFSSYWAQFKKLGGGCYFN  448

Query  256  GLAVKTINDPSYGACKYPSITL  191
            GLAV+T  DPSYG CKY S+TL
Sbjct  449  GLAVQTTKDPSYGYCKYASVTL  470



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 169/199 (85%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGDVDQIGA+++N+ATYNRN VKK   K  VGTPARPG+++P+ +FAL+NEN K
Sbjct  265  ETGWPNGGDVDQIGANVFNAATYNRNFVKKVMKKPIVGTPARPGLILPSFLFALFNENIK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+ +Y IDLSGKTPE EFP LP P  N+PYKGK+WCV    +N+T
Sbjct  325  PGPGTERHFGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRGSNVT  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+ +AL+YAC QGNRTC+P+QPG  C+ P+S+  HASYAFSSYWAQF+ +GGTCYFNGLA
Sbjct  385  ALGEALTYACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLA  444

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPSYG+CK+PS+TL
Sbjct  445  TQTAKDPSYGSCKFPSVTL  463



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRN +KK T+K  +GTPARPG V+P+ IFALYNENQK
Sbjct  263  ETGWPNAGDIDQIGANIYNAATYNRNAIKKLTAKPAIGTPARPGWVLPSFIFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+N+Y IDLSG+TP+S+F PLPKP  N+PYKGK+WCV A   N +
Sbjct  323  PGPGTERHFGLLYPNGSNVYGIDLSGETPDSDFEPLPKPDNNEPYKGKIWCVAARGVNAS  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  ALSYAC QGN+TC+PIQPG  C+ P+SL+ HASYAFSSYW+Q +  G TCYFNGLA
Sbjct  383  ELGSALSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQLKQTGATCYFNGLA  442

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS+G CK+PS+TL
Sbjct  443  TQTAKDPSFGHCKFPSVTL  461



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNV+KK T+K  VGTPARPG V+P+ IFALYNENQK
Sbjct  266  ETGWPNAGDIDQIGANIYNAATYNRNVIKKLTAKPPVGTPARPGRVLPSFIFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNG+N+Y IDLSGKTP+S + PLPKPT ++PYKGKVWCV A   N +
Sbjct  326  PGPGTERHFGLLYPNGSNVYGIDLSGKTPDSAYEPLPKPTNDEPYKGKVWCVAARRVNAS  385

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  ALSYAC QGN+TC+PIQ G  C+ P+SL+ HASYAFSSYW+QF+  G TCYFNGLA
Sbjct  386  ELGSALSYACSQGNKTCDPIQSGKECFKPDSLVWHASYAFSSYWSQFKKTGATCYFNGLA  445

Query  247  VKTINDPSYGACKYPSITL  191
              T  DPS+G CK+PS+TL
Sbjct  446  TPTAKDPSFGRCKFPSVTL  464



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   309 bits (791),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD DQIGA+I N+ATYNRNVVKKF +K  VGTPARPG V+P+ +FALYNEN+K
Sbjct  189  ETGWPSGGDYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGSVLPSFLFALYNENKK  248

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGP TER+FG+LYPNG+N+YPIDLSGKTPESE+ PLP  T N PYKG +WC+VA  AN +
Sbjct  249  PGPSTERNFGLLYPNGSNVYPIDLSGKTPESEYGPLPVATNNVPYKGPIWCLVAKGANRS  308

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AVA ALSYAC QGN+TC+PIQPGG C+ P+SL+ HASYAFS+YWAQFR +GG+CYF GLA
Sbjct  309  AVASALSYACSQGNKTCDPIQPGGKCFKPDSLVWHASYAFSAYWAQFRKVGGSCYFGGLA  368

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG+CK+P   L
Sbjct  369  TQTIKDPSYGSCKFPGAKL  387



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD DQIGA+I N+ATYNRNVVKKF +K  VGTPARPG V+P+ +FALYNEN+K
Sbjct  264  ETGWPSGGDYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGSVLPSFLFALYNENKK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGP TER+FG+LYPNG+N+YPIDLSGKTPESE+ PLP  T N PYKG +WC+VA  AN +
Sbjct  324  PGPSTERNFGLLYPNGSNVYPIDLSGKTPESEYGPLPAATNNVPYKGPIWCLVAKGANRS  383

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AVA ALSYAC QGN+TC+PIQPGG C+ P+SL+ HASYAFS+YWAQFR++GG+CYF GLA
Sbjct  384  AVASALSYACSQGNKTCDPIQPGGKCFKPDSLVWHASYAFSAYWAQFRNVGGSCYFGGLA  443

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPS+G+CK+P   L
Sbjct  444  TQTIKDPSFGSCKFPGAKL  462



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD DQIGA+IYN+ATYNRNVVK+ T+K  +GTPARPG  +PT IFALYNENQK
Sbjct  188  ETGWPSNGDFDQIGANIYNAATYNRNVVKRLTTKPAIGTPARPGSGLPTFIFALYNENQK  247

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTERHFG+LYPNG+NIY IDLSG+T +SE+  PLP PT N+PYKGK+WCVVA  AN 
Sbjct  248  PGPGTERHFGLLYPNGSNIYEIDLSGETLDSEYKEPLPVPTNNEPYKGKIWCVVAKGANK  307

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TAVA AL+YAC QGN+TC+PIQPG  C+ P SL  HASYAFSSYWAQF+ +GGTC FNGL
Sbjct  308  TAVAGALTYACSQGNKTCDPIQPGKQCFKPESLYWHASYAFSSYWAQFKKIGGTCQFNGL  367

Query  250  AVKTINDPSYGACKYPSITL  191
            A +T+ DPS+G CK PS+TL
Sbjct  368  ATQTVMDPSFGHCKLPSVTL  387



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GDVDQIGA+I+N+ATYNRN++++ TSK  +GTPARPGVVIPT IFALYNENQK
Sbjct  266  ETGWPNAGDVDQIGANIFNAATYNRNLIRRMTSKPAIGTPARPGVVIPTFIFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L P+GT++Y +DL+GK PE ++ PLP P  N+PYKGK+WCVVA  AN T
Sbjct  326  GGPGTERHWGLLNPDGTSVYEVDLTGKRPEFDYKPLPAPLNNEPYKGKIWCVVARGANRT  385

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  A+ YACGQGN TC  I+PG  CY P SL+RHASYAFSSYWAQFR  GGTCYFNGLA
Sbjct  386  ALGSAIKYACGQGNGTCEEIRPGSDCYEPVSLVRHASYAFSSYWAQFRKFGGTCYFNGLA  445

Query  247  VKTINDPSYGACKYPSITL  191
            V+T  DP +G+CKYPS+TL
Sbjct  446  VQTTKDPGHGSCKYPSVTL  464



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGASI+N+A YNRN+VK+ TSK  VGTPARPG ++PT+IF+LYNENQK
Sbjct  265  ETGWPNGGDYDQIGASIHNAAVYNRNIVKRVTSKPPVGTPARPGRMLPTIIFSLYNENQK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYP G  +Y +DLSG   E++F PLP+   N+PYKGK+WCVV    N++
Sbjct  325  PGPGTERHFGLLYPKGKAVYEMDLSGSRAETKFKPLPEAERNEPYKGKIWCVVGKGVNMS  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             V  ALSYAC QGN+TC PI+ GG CY P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA
Sbjct  385  DVVGALSYACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKVGGTCYFNGLA  444

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG CK+PS+TL
Sbjct  445  TQTIKDPSYGKCKFPSVTL  463



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   308 bits (790),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGA+I+N+A YNRN+VK+ TSK  VGTPARPG V+PT+IF+LYNEN+K
Sbjct  265  ETGWPNGGDYDQIGANIHNAAVYNRNIVKRMTSKPPVGTPARPGRVLPTIIFSLYNENEK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+LYP+G  +Y +DLSG T E++F PLP+  TN+PYKG++WCVV    N++
Sbjct  325  GGPGTERHFGLLYPSGKAVYEMDLSGSTAETKFKPLPEAETNEPYKGRIWCVVGKGVNMS  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             V  ALSYAC QGN+TC PI+ GG CY P+SL RHAS+AFSSYWAQFR +GGTCYFNGLA
Sbjct  385  EVVGALSYACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKIGGTCYFNGLA  444

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG CK+PS+TL
Sbjct  445  TQTIKDPSYGKCKFPSVTL  463



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 168/199 (84%), Gaps = 6/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD DQ+GA+IYN+ATYNRNVVKKF +K  +GTPARPG VIPT+IFALYNENQK
Sbjct  267  ETGWPSGGDPDQLGANIYNAATYNRNVVKKFMAKPPIGTPARPGAVIPTMIFALYNENQK  326

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTER+FG+LYPNG+++YPIDLSGKT  S++PPL KP  N    GK+WCVVA  AN T
Sbjct  327  PGPGTERNFGLLYPNGSHVYPIDLSGKTQVSDYPPLAKPANN----GKLWCVVAEGANKT  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  ALSYAC QGNRTC+PIQPGG CY PNSLI+HASYAFSSYWAQ R+ G TC F+GLA
Sbjct  383  ALTGALSYACSQGNRTCDPIQPGGKCYKPNSLIKHASYAFSSYWAQMRAAGATCSFSGLA  442

Query  247  VKTINDPSYGACKYPSITL  191
            V    DPSYGACKYPS+ L
Sbjct  443  VMISKDPSYGACKYPSVNL  461



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQIGA+++N+ATYNRN ++K   K  VGTPARPG+++P+ +FAL+NEN K
Sbjct  265  ETGWPNGGDIDQIGANVFNAATYNRNFIRKVMKKPVVGTPARPGLILPSFLFALFNENIK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTER+FG+LYPNG+ +Y IDL GKTPES+FP LP P  N+PYKGK+WCV A  +NLT
Sbjct  325  PGPGTERNFGLLYPNGSRVYEIDLFGKTPESDFPALPPPENNEPYKGKIWCVAARGSNLT  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGNRTC+ +QPG  C+ P S+  HASYAFSSYWAQF+ +GGTCYFNGLA
Sbjct  385  ELGEALSYACSQGNRTCDAVQPGKKCFKPESIFWHASYAFSSYWAQFKKIGGTCYFNGLA  444

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPSYG+CK+PS+TL
Sbjct  445  TQTAKDPSYGSCKFPSVTL  463



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYNSAT+NRNV+KK T+K  +GTPARPG VIP++IFALYNENQK
Sbjct  266  ETGWPNDGDIDQIGANIYNSATFNRNVIKKLTTKPAIGTPARPGWVIPSIIFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTERHFG+LYPNGT IY IDLSG TP SE+  PLP PT N+PYKGK+WC+VA   N 
Sbjct  326  PGPGTERHFGLLYPNGTKIYEIDLSGDTPLSEYTKPLPAPTNNEPYKGKIWCMVAKGVNE  385

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TAV DALSYAC QGN+TC+ IQ G  CY P+SL  HASYAFSSYWAQF+  GGTC FNGL
Sbjct  386  TAVGDALSYACSQGNKTCDAIQTGKECYKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGL  445

Query  250  AVKTINDPSYGACKYPSITL  191
            A  T  DPS+G CK+P  TL
Sbjct  446  ATMTPKDPSFGHCKFPGTTL  465



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   306 bits (784),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYNSAT+NRNVVKK T+K  +GTPARPG VIP++IFALYNENQK
Sbjct  266  ETGWPNDGDIDQIGANIYNSATFNRNVVKKLTTKPAIGTPARPGWVIPSIIFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTERHFG+LYPNGT IY IDLSG TP SE+  PLP PT N+PYKGK+WC+VA   N 
Sbjct  326  PGPGTERHFGLLYPNGTKIYEIDLSGDTPLSEYKKPLPAPTNNEPYKGKIWCMVAKGVNE  385

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TAV DALSYAC QGN TC+ IQ G  CY P+SL  HASYAFSSYWAQF+  GGTC FNGL
Sbjct  386  TAVRDALSYACSQGNGTCDAIQTGKKCYKPDSLFWHASYAFSSYWAQFKKSGGTCSFNGL  445

Query  250  AVKTINDPSYGACKYPSITL  191
            A  T  DPS+G CK+P +TL
Sbjct  446  ATMTPKDPSFGHCKFPGVTL  465



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD DQIGA+I N+ATYNRNVVKKF +K  VGTPARPG V+P+ +FAL+NEN K
Sbjct  317  ETGWPSGGDYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGAVLPSFVFALFNENTK  376

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGP TER+FG LYPNG+N+YPIDLSGKTPESE+ PLP  T N+PYKG +WC+VA  AN +
Sbjct  377  PGPSTERNFGFLYPNGSNVYPIDLSGKTPESEYAPLPVATNNEPYKGPIWCMVAKGANQS  436

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AVA ALSYAC QGN+TC+PIQPGG C+ P+SL  HASYAFS+YW+QFR  GG+CYF GLA
Sbjct  437  AVASALSYACSQGNKTCDPIQPGGKCFKPDSLAWHASYAFSAYWSQFRKAGGSCYFGGLA  496

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG+CK+P   L
Sbjct  497  TQTIKDPSYGSCKFPGAKL  515



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 167/195 (86%), Gaps = 2/195 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD DQIG +I+N+ATYNRNV+KKFT+K  VGTPARPGVV+P+ IFALYNEN K
Sbjct  265  ETGWPSGGDYDQIGTNIHNAATYNRNVIKKFTAKPPVGTPARPGVVLPSFIFALYNENMK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTER+FG+LYPNG+N+Y IDL+GKTP  EF PLP  T N+PY G +WC+V   AN T
Sbjct  325  PGPGTERNFGLLYPNGSNVYEIDLTGKTPVLEFKPLPPATNNKPYPGPIWCLVKEGANKT  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AVA+ALSYAC QGN+TC+PIQPGG C+ PN+L +HASYAFS+YWAQFR  GG+C F GLA
Sbjct  385  AVAEALSYACSQGNKTCDPIQPGGKCFKPNTLAQHASYAFSAYWAQFRKAGGSCSFGGLA  444

Query  247  VKTINDPSYGACKYP  203
            V+TI DPSYG+CKYP
Sbjct  445  VQTIKDPSYGSCKYP  459



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 167/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD DQIGA+I N+ATYNRNVVKKF +K  VGTPARPGVV+P+ IFAL+NEN K
Sbjct  265  ETGWPSSGDFDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGVVLPSFIFALFNENTK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGP TER+FG+LYPNG+++YPIDLSGKTP SE+PPLP    N+PY+G +WC+VA  AN +
Sbjct  325  PGPSTERNFGLLYPNGSHVYPIDLSGKTPLSEYPPLPAAKNNKPYEGPIWCIVAKGANRS  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AVA ALSYAC QGN+TC+PIQPGG C+ P+SL  HASYAFS+YWAQFR  GG+CYF GLA
Sbjct  385  AVASALSYACSQGNKTCDPIQPGGKCFKPDSLFWHASYAFSAYWAQFRKAGGSCYFGGLA  444

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG+CK+P   L
Sbjct  445  TQTIKDPSYGSCKFPGAKL  463



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 168/199 (84%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK +++  +GTPARPG V+P+ +FALYNENQK
Sbjct  268  ETGWPNAGDYDQIGANIYNAATYNRNVVKKLSARPAIGTPARPGWVLPSFMFALYNENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+LYPN + +Y IDLSG+TP++E+  LP PT N+PY+GK+WCVVA  AN +
Sbjct  328  TGPGTERHFGLLYPNDSFVYDIDLSGETPDTEYGKLPAPTNNEPYEGKIWCVVAKRANRS  387

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+A ALSYAC QGN TC PIQPG AC+   SL+R ASYAFSSYWAQFR  GG+CYFNGLA
Sbjct  388  ALASALSYACSQGNATCGPIQPGKACHRKGSLVRQASYAFSSYWAQFRKTGGSCYFNGLA  447

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG+C++P++TL
Sbjct  448  TQTIEDPSYGSCEFPAVTL  466



>ref|XP_012085272.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Jatropha 
curcas]
Length=469

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNVVK+ T+K  +GTPARPG VIP+ IFA+YNENQK
Sbjct  270  ETGWPNNGDIDQIGANIYNAATYNRNVVKRLTAKPAIGTPARPGSVIPSFIFAMYNENQK  329

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTERHFG+LYPNG+ +Y IDLSG+  ESE+  PLP P  N PY GK+WCVVA  AN 
Sbjct  330  PGPGTERHFGLLYPNGSKVYDIDLSGEKTESEYTKPLPAPINNAPYTGKIWCVVAKGANR  389

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TA+ DAL YAC QGN+TC+PIQPG  C+ P+S++ HASYAFSS+WAQ R  G TCYFNGL
Sbjct  390  TALGDALGYACSQGNKTCDPIQPGKKCFKPDSVVWHASYAFSSFWAQMRQAGATCYFNGL  449

Query  250  AVKTINDPSYGACKYPSITL  191
            A +T  DPS+G CK+PS++L
Sbjct  450  ATQTTKDPSFGHCKFPSVSL  469



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNVVK+ T+K  +GTPARPG VIP+ IFA+YNENQK
Sbjct  265  ETGWPNNGDIDQIGANIYNAATYNRNVVKRLTAKPAIGTPARPGSVIPSFIFAMYNENQK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEF-PPLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTERHFG+LYPNG+ +Y IDLSG+  ESE+  PLP P  N PY GK+WCVVA  AN 
Sbjct  325  PGPGTERHFGLLYPNGSKVYDIDLSGEKTESEYTKPLPAPINNAPYTGKIWCVVAKGANR  384

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TA+ DAL YAC QGN+TC+PIQPG  C+ P+S++ HASYAFSS+WAQ R  G TCYFNGL
Sbjct  385  TALGDALGYACSQGNKTCDPIQPGKKCFKPDSVVWHASYAFSSFWAQMRQAGATCYFNGL  444

Query  250  AVKTINDPSYGACKYPSITL  191
            A +T  DPS+G CK+PS++L
Sbjct  445  ATQTTKDPSFGHCKFPSVSL  464



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 162/200 (81%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD +Q GA+ YNSATYNRNVVKK T+   +GTPARPGV IP  IF+LYNENQK
Sbjct  279  ETGWPNGGDFEQFGANTYNSATYNRNVVKKLTTIPAIGTPARPGVAIPAFIFSLYNENQK  338

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTERHFG+ YPNGT ++ IDLSGKTP S +  PLP PT N+PYKGK+WCVVA  AN 
Sbjct  339  PGPGTERHFGLYYPNGTEVFEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCVVAKEANR  398

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            +AV DAL++AC QGN+TC+ IQPG  CY P SL RHASYAFSSYWA+F+ +GG C FNGL
Sbjct  399  SAVKDALAWACSQGNKTCDEIQPGKECYKPVSLFRHASYAFSSYWAEFKKIGGVCSFNGL  458

Query  250  AVKTINDPSYGACKYPSITL  191
            A  T  DPS+G CK+PS+TL
Sbjct  459  ATTTFKDPSFGQCKFPSVTL  478



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRNVVKK T+K  +GTPARPG VIP+LIFALYNENQK
Sbjct  263  ETGWPNAGDIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVIPSLIFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+LYPNGT IY IDLSGKTP+S F PLPKP  N+PYKGK+WCV A   N T
Sbjct  323  PGPGTERHFGLLYPNGTKIYGIDLSGKTPDSCFEPLPKPDNNEPYKGKIWCVAAKGVNET  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A++ ALSYAC QGN+TC+PIQPG  C+ P+SL  HASYAFSSYW+Q R  G TCYFNGLA
Sbjct  383  ALSSALSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQSRKTGATCYFNGLA  442

Query  247  VKTINDPS  224
             +T  DPS
Sbjct  443  TQTAKDPS  450



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQIGA++YN+ATYNRN +KK T K  VGTPARPG ++P+ +FAL+NENQK
Sbjct  267  ETGWPNGGDLDQIGANVYNAATYNRNFIKKVTRKPRVGTPARPGSLLPSFLFALFNENQK  326

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ ++ IDLSGKTPES+F PLP P  N+ +KGK+WCV A   N+T
Sbjct  327  SGPGTERHFGLLHPNGSRVFDIDLSGKTPESDFQPLPAPENNEKFKGKIWCVAARRDNVT  386

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +A ALSYAC QGN TC+PIQ  G C+ P S+  HASYAFS+YWAQF+ +G TCYFNGLA
Sbjct  387  ELAAALSYACSQGNGTCDPIQTRGKCFKPGSVFWHASYAFSAYWAQFKKIGATCYFNGLA  446

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPSYG+CK+PS+TL
Sbjct  447  TQTAKDPSYGSCKFPSVTL  465



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   299 bits (765),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 167/201 (83%), Gaps = 4/201 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQIGA++YN+ATYNRN+V++  +K  VGTPA PGVV+PT IFAL+NENQK
Sbjct  266  ETGWPNGGDIDQIGANVYNAATYNRNLVQRLNAKPLVGTPAMPGVVLPTFIFALFNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPA--AN  434
             G GTERH+G+ YP   ++YPIDL+G+T  + +P LPKP  N+PYKGK+WCVVA A  AN
Sbjct  326  GGQGTERHWGLFYPTEAHVYPIDLTGETDLASYPALPKPKNNEPYKGKIWCVVAEAKGAN  385

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
            +TA+ DA++YACGQGN TC  IQP G CYNP SLI HA+YAFSSYWAQF+S G TC+FNG
Sbjct  386  MTALGDAVTYACGQGNGTCAAIQPKGLCYNPKSLIYHANYAFSSYWAQFKSQGATCFFNG  445

Query  253  LAVKTINDPSYGACKYPSITL  191
            LAV+T  DPS+G CKYPS+TL
Sbjct  446  LAVQTTKDPSHGKCKYPSVTL  466



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD DQIGA+I N+ATYNRNVVKKF +K  VGTPARPGVV P+ +FAL+NEN K
Sbjct  265  ETGWPSGGDYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGVVFPSFVFALFNENTK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GP TER+FG+LYPNG+++YPIDLSGKTP SE+PPLP    N+P KG +WC+VA  AN +
Sbjct  325  TGPSTERNFGLLYPNGSHVYPIDLSGKTPVSEYPPLPAAKNNKPXKGPIWCMVAKGANRS  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AVA ALSYAC QGN+TC+PIQPGG C+ P++L  HASYAFS+YWAQFR  GG+CYF GLA
Sbjct  385  AVASALSYACSQGNKTCDPIQPGGKCFKPDTLSWHASYAFSAYWAQFRKAGGSCYFGGLA  444

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG+CK+P   L
Sbjct  445  TQTIKDPSYGSCKFPGAKL  463



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD +Q+GA+IYNSATYNRNVVKK T+   +GTPA+PGVVIP  IF+LYNENQK
Sbjct  266  ETGWPNGGDFEQLGANIYNSATYNRNVVKKLTTIPAIGTPAQPGVVIPAFIFSLYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTER FG+ YPNGT ++ IDLSGKTP S +  PLP PT N+PYKGK+WC+VA  AN 
Sbjct  326  PGPGTERQFGLYYPNGTEVFEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANR  385

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            +AV DAL++AC QGN+TC+ IQPG  CY P SL  HASYAFSSYWA+F+ +GG C FNGL
Sbjct  386  SAVKDALAWACSQGNKTCDEIQPGKGCYKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGL  445

Query  250  AVKTINDPSYGACKYPSITL  191
            A  T+ DPS+G CK+PS+TL
Sbjct  446  ATTTVKDPSFGQCKFPSVTL  465



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   311 bits (796),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 167/199 (84%), Gaps = 5/199 (3%)
 Frame = -3

Query  781   ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
             ETGWPNGGD+DQIGA+IYN+ATYNRN VKK T K  VGTPARPG +IP+ IF+LYNEN K
Sbjct  1044  ETGWPNGGDLDQIGANIYNAATYNRNFVKKVTKKPSVGTPARPGSIIPSFIFSLYNENLK  1103

Query  607   PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             PG GTERHFG+LYPNG+++Y IDLSGKT  SEF PLP P   + YKGK WCVVA  AN T
Sbjct  1104  PGLGTERHFGLLYPNGSSVYEIDLSGKTLASEFKPLPPP---ENYKGKAWCVVAEGANET  1160

Query  427   AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             AVA+ALSYAC QGNRTC+P+QPG  C+ P S+I HASYAFSSYWAQFR++GGTC FNGLA
Sbjct  1161  AVAEALSYACSQGNRTCDPVQPGKPCFEPVSVIGHASYAFSSYWAQFRNVGGTCQFNGLA  1220

Query  247   VKTINDPSYGACKYPSITL  191
             ++   DPSYG+CKYPS+TL
Sbjct  1221  IQIAKDPSYGSCKYPSVTL  1239



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK T++  +GTPARPG+V+P+ IFALYNENQK
Sbjct  265  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLTAEPPIGTPARPGLVLPSFIFALYNENQK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  325  TGPGTERHFGLLHPNGSQVYEIELSGKTTEFK-DSLPAPENNELYKGKIWCVVAKGANWT  383

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA
Sbjct  384  QLRDALSYACSQGNNTCEPIQTGGLCHKPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLA  443

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  444  TQTIKDPSYGRCEFPSVTL  462



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ IFALYNENQK
Sbjct  304  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFIFALYNENQK  363

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  364  TGPGTERHFGLLHPNGSQVYEIELSGKTTEYK-EALPGPENNEGYKGKIWCVVAKGANWT  422

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA
Sbjct  423  QLGDALSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLA  482

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DP YG C++PS+TL
Sbjct  483  TQTIKDPGYGRCEFPSVTL  501



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  ++  VG+PARPG V+P+ IFALYNENQK
Sbjct  263  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGSPARPGKVLPSFIFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGPGTERHFGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA
Sbjct  382  QLGDALSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DP YG C++PS+TL
Sbjct  442  TQTIKDPGYGRCEFPSVTL  460



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  ++  VG+PARPG V+P+ IFALYNENQK
Sbjct  263  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGSPARPGKVLPSFIFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGPGTERHFGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PI+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA
Sbjct  382  QLGDALSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DP YG C++PS+TL
Sbjct  442  TQTIKDPGYGRCEFPSVTL  460



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK
Sbjct  264  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T
Sbjct  324  TGPGTERHFGLLHPNGTQVYGIDLSGKTTEYG-GALPAPENNEVYKGKIWCVVAKGANWT  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA
Sbjct  383  QLGEALSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLA  442

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  443  TQTIKDPSYGRCEFPSVTL  461



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 158/199 (79%), Gaps = 5/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+I+N+ TYNRN VKK T K  VGTPARPG ++P+ IFALYNEN K
Sbjct  188  ETGWPNDGDLDQIGANIHNAGTYNRNFVKKVTKKPPVGTPARPGSILPSFIFALYNENLK  247

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GTERHFG+LYPNG+ IY IDLSGKTPE E+ PLP P     YKGK WCVVA  AN T
Sbjct  248  TGLGTERHFGLLYPNGSRIYEIDLSGKTPEYEYKPLPPP---DDYKGKAWCVVAEGANKT  304

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AV +ALSYAC QGNRTC  +QPG  C+ P+S++ HASYAFSSYWAQFR +GGTC FNGLA
Sbjct  305  AVVEALSYACSQGNRTCELVQPGKPCFEPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLA  364

Query  247  VKTINDPSYGACKYPSITL  191
             +   DPSYG+CKYPS+ L
Sbjct  365  TQIAEDPSYGSCKYPSVIL  383



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 162/199 (81%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ IFALYNENQK
Sbjct  263  ETGWPNHGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFIFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGPGTERHFGLLHPNGSQVYEIELSGKTTEYK-ESLPAPENNEGYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+ I+PGG+C+ P+ ++ HASYAFSSYWA FR +GGTCYFNGLA
Sbjct  382  QLGDALSYACSQGNNTCDSIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DP YG C++PS+TL
Sbjct  442  TQTIKDPGYGRCEFPSVTL  460



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGA+IYN+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK
Sbjct  263  ETGWPNGGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GTERHFG+L+PNGT +Y IDLSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGQGTERHFGLLHPNGTQVYGIDLSGKTTEYK-ESLPAPENNEVYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN+TC+PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA
Sbjct  382  ELGEALSYACSQGNKTCDPIQSGGPCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  442  TQTIKDPSYGRCEFPSVTL  460



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+I+N+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK
Sbjct  264  ETGWPNNGDYDQIGANIFNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T
Sbjct  324  TGPGTERHFGLLHPNGTQVYGIDLSGKTTEYG-GELPAPENNEVYKGKIWCVVAKGANWT  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA
Sbjct  383  QLGEALSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLA  442

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  443  TQTIKDPSYGRCEFPSVTL  461



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA++YN+ATYNRNVVKK  ++  VGTPARPG V+P+ +FALYNENQK
Sbjct  264  ETGWPNNGDYDQIGANVYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYNENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y IDLSGKT E     LP P  N+ YKGK+WCVVA  AN T
Sbjct  324  TGPGTERHFGLLHPNGTQVYGIDLSGKTTEYG-GALPVPENNEVYKGKIWCVVAKGANWT  382

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC+PIQPGG+C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA
Sbjct  383  QLGEALSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCSFNGLA  442

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  443  TQTIKDPSYGRCEFPSVTL  461



>ref|XP_007134153.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
 gb|ESW06147.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
Length=335

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 162/199 (81%), Gaps = 5/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQ+GA+++N+ATYNRN+VK+ T    +GTPARPG V+P  IF+LYNEN K
Sbjct  140  ETGWPNGGDLDQVGANVHNAATYNRNIVKRLTRNPVLGTPARPGSVLPAFIFSLYNENLK  199

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG G+ERHFG+LYPNG+ +Y IDLSG TPESE  P+P P  +  YKGK WCVVA  AN+T
Sbjct  200  PGLGSERHFGLLYPNGSRVYDIDLSGNTPESELAPVP-PAMD--YKGKAWCVVAEGANVT  256

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             VA ALSY+C QGN TC+PIQPG  C+ P+S+  HA YAFS+YWAQFR +GGTCYFNGLA
Sbjct  257  EVAAALSYSCSQGNGTCDPIQPGHPCFKPDSVTSHADYAFSAYWAQFRRVGGTCYFNGLA  316

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPSYG+CK+PS+TL
Sbjct  317  TQTAKDPSYGSCKFPSVTL  335



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 158/199 (79%), Gaps = 5/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+I+N+ TYNRN VKK T K  VGTPARPG ++P+ IFALYNEN K
Sbjct  268  ETGWPNDGDLDQIGANIHNAGTYNRNFVKKVTKKPPVGTPARPGSILPSFIFALYNENLK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GTERHFG+LYPNG+ IY IDLSGKTPE E+ PLP P     YKGK WCVVA  AN T
Sbjct  328  TGLGTERHFGLLYPNGSRIYEIDLSGKTPEYEYKPLPPP---DDYKGKAWCVVAEGANKT  384

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AV +ALSYAC QGNRTC  +QPG  C+ P+S++ HASYAFSSYWAQFR +GGTC FNGLA
Sbjct  385  AVVEALSYACSQGNRTCELVQPGKPCFEPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLA  444

Query  247  VKTINDPSYGACKYPSITL  191
             +   DPSYG+CKYPS+ L
Sbjct  445  TQIAEDPSYGSCKYPSVIL  463



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNV+KKF ++  VGTPARPG V+P  IFALYNENQK
Sbjct  272  ETGWPNNGDYDQIGANIYNAATYNRNVIKKFAAEPPVGTPARPGEVLPAFIFALYNENQK  331

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  332  TGPGTERHFGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKGANWT  390

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PI+PGG C+ P+  I HASYAFSSYWA FR  G TC FNGLA
Sbjct  391  QLGDALSYACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSFNGLA  450

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  451  TQTIKDPSYGRCEFPSVTL  469



>ref|XP_010906169.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Elaeis 
guineensis]
Length=222

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 158/199 (79%), Gaps = 5/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  IFALYNENQK
Sbjct  23   ETGWPNAGDLDQIGANIYNAATYNRNLARRLSERPALGTPARPGAVMPVFIFALYNENQK  82

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAA  437
            PGPGTERH+G+LYPN T +Y +DL+G+ P+S + PLP P  N+PYKGK+WCV      + 
Sbjct  83   PGPGTERHWGLLYPNATRVYEVDLTGRLPDSAYGPLPLPDNNEPYKGKIWCVFGGGGKSV  142

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N TAV  A++YACGQG+ TCN IQPGG CY P SL   ASYAF+SYW QFR  GGTCYFN
Sbjct  143  NATAVGSAIAYACGQGSGTCNAIQPGGQCYRPGSLTARASYAFNSYWQQFRRSGGTCYFN  202

Query  256  GLAVKTINDPSYGACKYPS  200
            GLAV+T  DPSYG+CK+PS
Sbjct  203  GLAVQTAQDPSYGSCKFPS  221



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   290 bits (743),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK
Sbjct  263  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y IDLSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGPGTERHFGLLHPNGTQVYGIDLSGKTTEYK-ESLPAPENNEFYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PIQ GG C+ P+  + HASYAFSSYWAQFR  GGTC FNGLA
Sbjct  382  QLGDALSYACSQGNNTCDPIQRGGPCHKPDLTVLHASYAFSSYWAQFRKTGGTCSFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  442  TQTIKDPSYGRCEFPSVTL  460



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK
Sbjct  264  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y IDLSGKT   E   LP P  N  YKGK+WCVVA  AN T
Sbjct  324  TGPGTERHFGLLHPNGTQVYGIDLSGKTEYKE--SLPAPENNDLYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA
Sbjct  382  QLGDALSYACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  442  TQTIKDPSYGRCEFPSVTL  460



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD +Q GA+IYNSATYNRNVVKK  +   +GTPA+PGVVIP  IF+LYNENQK
Sbjct  266  ETGWPNGGDFEQFGANIYNSATYNRNVVKKLATIPVIGTPAQPGVVIPAFIFSLYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFP-PLPKPTTNQPYKGKVWCVVAPAANL  431
            PGPGTER FG+ YPNGT +  IDLSGKTP S +  PLP PT N+PYKGK+WC+VA  AN 
Sbjct  326  PGPGTERQFGLYYPNGTEVLEIDLSGKTPLSGYKKPLPLPTNNEPYKGKLWCIVAKEANR  385

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            +AV DAL++AC QGN TC+ IQPG  CY P SL  HASYAFSSYWA+F+ +GG C FNGL
Sbjct  386  SAVKDALAWACSQGNTTCDKIQPGKGCYKPVSLFWHASYAFSSYWAEFKKIGGVCSFNGL  445

Query  250  AVKTINDPSYGACKYPSIT  194
            A  T+ DPS+G CK+PS+T
Sbjct  446  ATTTVKDPSFGQCKFPSVT  464



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK
Sbjct  264  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y IDLSGK    E   LP P  N+ YKGK+WCVVA  AN T
Sbjct  324  TGPGTERHFGLLHPNGTQVYGIDLSGKMEYKE--SLPAPDNNELYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA
Sbjct  382  QLGDALSYACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  442  TQTIKDPSYGRCEFPSVTL  460



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 162/199 (81%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD+DQIGA+I+N+ATYNRN++++ TSK   GTPARPGVVIPT IFALYNENQK
Sbjct  266  ETGWPHAGDIDQIGANIFNAATYNRNLIRRMTSKPPAGTPARPGVVIPTFIFALYNENQK  325

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G++ P+GT +Y +DL+GK PE++F  LP P  N+ YKGK+WCVVA  AN T
Sbjct  326  GGPGTERHWGLMNPDGTPVYEVDLNGKRPENDFKSLPAPLNNELYKGKIWCVVADGANST  385

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  A+ +AC  GN TC+ I+PG  CY+P SL+ HASYAFSSYWAQF+  GGTCYFNGLA
Sbjct  386  ELESAIEFACRLGNNTCDAIRPGSECYHPVSLVSHASYAFSSYWAQFKQSGGTCYFNGLA  445

Query  247  VKTINDPSYGACKYPSITL  191
            V+T  DPS G+CK+PS+TL
Sbjct  446  VQTTEDPSNGSCKFPSVTL  464



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  682  KVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPP  503
            K+GTPARPGVV+P  IFALYNENQKPGPGTERHFG+LYPNGT +Y IDLSGKTPESE+ P
Sbjct  255  KIGTPARPGVVLPAFIFALYNENQKPGPGTERHFGLLYPNGTRVYEIDLSGKTPESEYEP  314

Query  502  LPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRH  323
            LPKPT N+PYKGK+WCVV   AN TA+A AL YACGQGN TC+PIQPGG CY PNSL+ H
Sbjct  315  LPKPTNNEPYKGKIWCVVGEGANRTALAAALGYACGQGNGTCDPIQPGGKCYEPNSLVHH  374

Query  322  ASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  191
            AS+AFSSYWAQFR +GGTCYF+GLA +TI DPSYG+CK+PS+TL
Sbjct  375  ASFAFSSYWAQFRKVGGTCYFSGLATQTIRDPSYGSCKFPSVTL  418



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+I+N+A YNRNVVKK T+   VGTPARPG V+P+ IF+LYNENQK
Sbjct  263  ETGWPNNGDYDQIGANIHNAAIYNRNVVKKLTADPPVGTPARPGRVLPSFIFSLYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+ +PNGT +Y IDLSGK  E E   LP+P  N+PYKG++WCVVA  AN T
Sbjct  323  PGPGTERHFGMYHPNGTRVYDIDLSGKRTEYE-DVLPEPENNEPYKGRIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC PI+PGG C  P+ ++ HASYAFSSYWAQ R  G TC+FNGLA
Sbjct  382  ELGEALSYACSQGNNTCAPIRPGGECSKPDLIVLHASYAFSSYWAQSRKSGATCFFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  442  TQTIKDPSYGRCEFPSVTL  460



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   286 bits (732),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 160/202 (79%), Gaps = 6/202 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+++N+A YNRN+ ++  ++  VGTPARPG V+P  +F+LYNENQK
Sbjct  272  ETGWPNAGDLDQIGANVHNAAIYNRNLARRLAARPAVGTPARPGAVMPVFVFSLYNENQK  331

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PA  440
            PGPGTERH+G+LYPNG+ +Y +DLSG+ P   +PPLP P  N+PYKGK+WCV       A
Sbjct  332  PGPGTERHWGLLYPNGSKVYEVDLSGRRPLDSYPPLPPPDNNEPYKGKIWCVFGGDRKAA  391

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            AN T V  AL+YACGQGN TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F
Sbjct  392  ANATTVGAALAYACGQGNGTCDAIRPGGPCYKPNTLLAHASYAFNSYWQQFRQAGGTCFF  451

Query  259  NGLAVKTINDPSYGACKYPSIT  194
            +GLAV+T  DPSYG CKY S+T
Sbjct  452  DGLAVQTKTDPSYGTCKYASLT  473



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNV+KKF ++  VGTPARPG V+P  IFALYNENQK
Sbjct  272  ETGWPNNGDYDQIGANIYNAATYNRNVIKKFAAEPPVGTPARPGEVLPAFIFALYNENQK  331

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y I+LSGKT E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  332  TGPGTERHFGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKGANWT  390

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + DALSYAC QGN TC+PI+PGG C+ P+  I HASYAFSSYWA FR  G TC FNGLA
Sbjct  391  QLGDALSYACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSFNGLA  450

Query  247  VKTINDPS-YGACKYPSITL  191
             +TI DP+ YG C++PS+TL
Sbjct  451  TQTIKDPTGYGRCEFPSVTL  470



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA++YN+ATYNRNVVKK +++  VGTPARPG V+P+ IFAL+NENQK
Sbjct  263  ETGWPNNGDYDQIGANVYNAATYNRNVVKKLSAEPPVGTPARPGKVLPSFIFALFNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGPGTERHFGLLHPNGSRVYEIELSGETTEYK-ETLPAPENNEVYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC+PI+PGG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA
Sbjct  382  QLGEALSYACSQGNNTCDPIKPGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPS+G C++PS+TL
Sbjct  442  TQTIKDPSFGRCEFPSVTL  460



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 166/199 (83%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQIGA+I+N+ATYNRN +KK T K  +GTPARPG  +P+ +FAL+NENQK
Sbjct  269  ETGWPNGGDLDQIGANIFNAATYNRNFIKKVTRKPWLGTPARPGSALPSFLFALFNENQK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+L+PNG+ +Y +DLSG+TPE+ F PLP P  N+ +KG++WCV A   N T
Sbjct  329  PGPGTERHFGLLHPNGSRVYDVDLSGETPEAGFRPLPVPENNEKFKGEIWCVAARPHNAT  388

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+A AL+YAC QGN TC+PIQP G C+ P+S+  HASYAFS+YWAQFR +GGTCYFNGLA
Sbjct  389  ALAAALAYACSQGNGTCDPIQPKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLA  448

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPSYG+CK+PS+TL
Sbjct  449  TQTAKDPSYGSCKFPSVTL  467



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   283 bits (724),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 163/199 (82%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQIGA+ YN+ATYNRN +KK T K  VGTPARPG  +P+ +FAL+NENQK
Sbjct  269  ETGWPNGGDLDQIGANTYNAATYNRNFIKKVTKKPRVGTPARPGSALPSFLFALFNENQK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGP TERHFG+L+PNG+ +Y +DLSG+TPE+EF PLP P  N+ +KG++WCV A   N T
Sbjct  329  PGPSTERHFGLLHPNGSRVYDVDLSGETPEAEFRPLPVPENNEKFKGRIWCVAARRDNAT  388

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  AL+YAC QGN TC+PIQ  G C+ P+S+  HASYAFS+YWAQFR +GGTCYFNGLA
Sbjct  389  ALTAALAYACSQGNGTCDPIQSKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLA  448

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPSYG+CK+PS+TL
Sbjct  449  TQTAKDPSYGSCKFPSVTL  467



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 158/199 (79%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+I+N+ATYNRNVVKK T    VGTPARPG V+P  IF+LYNENQK
Sbjct  263  ETGWPNNGDYDQIGANIFNAATYNRNVVKKLTIDPPVGTPARPGRVLPAFIFSLYNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERHFG+  PNG  +Y +DLSGKT E E   LP+P  N+PYKGK+WCVVA  AN T
Sbjct  323  PGPGTERHFGLYNPNGNPVYDMDLSGKTTEYE-DVLPEPGNNEPYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC+PI+PGG C  P  ++ HAS+AFSSYWA+FR  G TC+FNGLA
Sbjct  382  ELGEALSYACSQGNNTCDPIRPGGPCNKPEFILTHASFAFSSYWAEFRKSGATCHFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +T+ DPSYG C++PS+TL
Sbjct  442  TQTVKDPSYGRCEFPSVTL  460



>ref|XP_008792941.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X3 [Phoenix dactylifera]
Length=389

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  +FALYNENQK
Sbjct  190  ETGWPNAGDLDQIGANIYNAATYNRNLARRLSKRPALGTPARPGAVMPVFVFALYNENQK  249

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAA  437
            PGPGTERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       A
Sbjct  250  PGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGA  309

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N T V  A++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFN
Sbjct  310  NATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFN  369

Query  256  GLAVKTINDPSYGACKYPS  200
            GLAV+T  DPS+G+CKYPS
Sbjct  370  GLAVQTAQDPSHGSCKYPS  388



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 159/199 (80%), Gaps = 8/199 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD +QIGA+I+N+ATYNRNVVKKF +K   GTPARP  VIP++IFALYNENQK
Sbjct  267  ETGWPSGGDPNQIGANIHNAATYNRNVVKKFMAKPPYGTPARPYTVIPSMIFALYNENQK  326

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTER+FG+LYPNG+N+YPIDLSGKT +S +PPLP P        K+WCV    ANL 
Sbjct  327  PGQGTERNFGLLYPNGSNVYPIDLSGKTRDSRYPPLPNPNR------KLWCVAVKGANLR  380

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  A+SYAC QGNRTC+PIQPGG C+NPNSL  HASYAFSSYWAQ    G TC+F+GLA
Sbjct  381  AMGGAMSYACSQGNRTCDPIQPGGKCFNPNSLAVHASYAFSSYWAQLWKEGATCFFDGLA  440

Query  247  VKTINDPSYGACKYPSITL  191
              T  DPS+G+CK+PSI +
Sbjct  441  FMTSKDPSFGSCKFPSIDI  459



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 159/199 (80%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA++YN+ATYNRNVVKK ++   VGTPARPG V+P+ IFAL+NENQK
Sbjct  263  ETGWPNNGDYDQIGANVYNAATYNRNVVKKLSAVPPVGTPARPGKVLPSFIFALFNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGPGTERHFGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEVYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC+PI+ GG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA
Sbjct  382  QLGEALSYACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLA  441

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPS+G C++PS+TL
Sbjct  442  TQTIKDPSFGRCEFPSVTL  460



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  +FALYNENQK
Sbjct  268  ETGWPNAGDLDQIGANIYNAATYNRNLARRLSKRPALGTPARPGAVMPVFVFALYNENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAA  437
            PGPGTERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       A
Sbjct  328  PGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGA  387

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N T V  A++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFN
Sbjct  388  NATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFN  447

Query  256  GLAVKTINDPSYGACKYPS  200
            GLAV+T  DPS+G+CKYPS
Sbjct  448  GLAVQTAQDPSHGSCKYPS  466



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+IYN+ATYNRN+ ++ + +  +GTPARPG V+P  +FALYNENQK
Sbjct  271  ETGWPNAGDLDQIGANIYNAATYNRNLARRLSKRPALGTPARPGAVMPVFVFALYNENQK  330

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAA  437
            PGPGTERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV       A
Sbjct  331  PGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGA  390

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N T V  A++YACGQG  TC+ IQPGG CY P S   HASYAF+SYW QFR  GGTCYFN
Sbjct  391  NATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFN  450

Query  256  GLAVKTINDPSYGACKYPS  200
            GLAV+T  DPS+G+CKYPS
Sbjct  451  GLAVQTAQDPSHGSCKYPS  469



>ref|XP_006830552.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Amborella 
trichopoda]
Length=450

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GD+DQIGA++YN+A YNRN V+K  S +GTP RP   I   IF+LYNEN K G
Sbjct  253  ETGWPNAGDLDQIGANVYNAAHYNRNFVRKLRSNMGTPMRPNQTIFAYIFSLYNENLKGG  312

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            PGTERH+G+LYPNG+ +Y +DL+G+TP S++ PLP+P  N+ YKGK+WCVV P AN+TA+
Sbjct  313  PGTERHWGLLYPNGSRVYEVDLTGRTPNSKYAPLPEPKNNEQYKGKIWCVVVPGANVTAL  372

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              ALSYAC Q N TCN IQ G  C+ PN+L+ HASYAF+SYW  FR  GGTC+FNGLAV+
Sbjct  373  GPALSYACSQANDTCNAIQRGKKCFMPNTLVSHASYAFNSYWQMFRGTGGTCFFNGLAVQ  432

Query  241  TINDPSYGACKYPSIT  194
            T  +PSYG+CK+P+++
Sbjct  433  TAINPSYGSCKFPTLS  448



>gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GD+DQIGA++YN+A YNRN V+K  S +GTP RP   I   IF+LYNEN K G
Sbjct  267  ETGWPNAGDLDQIGANVYNAAHYNRNFVRKLRSNMGTPMRPNQTIFAYIFSLYNENLKGG  326

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            PGTERH+G+LYPNG+ +Y +DL+G+TP S++ PLP+P  N+ YKGK+WCVV P AN+TA+
Sbjct  327  PGTERHWGLLYPNGSRVYEVDLTGRTPNSKYAPLPEPKNNEQYKGKIWCVVVPGANVTAL  386

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              ALSYAC Q N TCN IQ G  C+ PN+L+ HASYAF+SYW  FR  GGTC+FNGLAV+
Sbjct  387  GPALSYACSQANDTCNAIQRGKKCFMPNTLVSHASYAFNSYWQMFRGTGGTCFFNGLAVQ  446

Query  241  TINDPSYGACKYPSIT  194
            T  +PSYG+CK+P+++
Sbjct  447  TAINPSYGSCKFPTLS  462



>ref|XP_006492526.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=389

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRN++KK TSK  +GTPARPG +IPT IF+LY+ENQK
Sbjct  191  ETGWPNAGDFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTFIFSLYDENQK  250

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA +A+L 
Sbjct  251  TGPGTERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARSADLL  310

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  AL YACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA
Sbjct  311  ALTSALGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLA  370

Query  247  VKTINDPSYGACKYPSITL  191
             +TI +PS G C++PS+TL
Sbjct  371  QQTIINPSRGNCRFPSVTL  389



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 152/199 (76%), Gaps = 22/199 (11%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD+DQIGA+IYN+ATYNRNVVKKFT+    GTPARPGV I   IFALYNENQK
Sbjct  268  ETGWPNGGDIDQIGANIYNAATYNRNVVKKFTAMPSAGTPARPGVNISVNIFALYNENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERHFG+LYPNGT++Y IDLSG TP+S + PLP+PT N+PYKGK+WCV        
Sbjct  328  PGAGTERHFGLLYPNGTSVYDIDLSGHTPDSTYSPLPQPTNNKPYKGKLWCV--------  379

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
                         NRTC  I+PGG CY PN L+ HASYAFS+YWAQFRS G TC+FNGLA
Sbjct  380  ------------DNRTCEAIRPGGKCYKPNWLVLHASYAFSAYWAQFRSSGATCFFNGLA  427

Query  247  VKTINDPSYGACKYPSITL  191
            V+T  DPSY +C++PS+ L
Sbjct  428  VQTTKDPSYLSCQFPSVNL  446



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 156/202 (77%), Gaps = 6/202 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+++N+ATYNRN+ ++   +   GTPARPG  +P  IF+LYNE++K
Sbjct  253  ETGWPNAGDLDQIGANVHNAATYNRNLARRMAVRPAAGTPARPGAAMPVFIFSLYNEDRK  312

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVV----APA  440
            PGPGTERH+G+L P+G  +Y +DLSG+ P   +PPLP P  + PY GK+WCV+       
Sbjct  313  PGPGTERHWGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCVLDAEGKAT  372

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            AN TAV  AL+YACGQG  TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F
Sbjct  373  ANTTAVGAALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFRQAGGTCFF  432

Query  259  NGLAVKTINDPSYGACKYPSIT  194
            +GLAV+T  DPSYG+CKYPS+T
Sbjct  433  DGLAVQTKADPSYGSCKYPSLT  454



>ref|XP_012078455.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Jatropha 
curcas]
 gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+GGD+DQ GA+I+N+ATYNRN+VKK T+   +GTPARPG +IPT IF+LYNEN+K
Sbjct  281  ETGWPSGGDIDQAGANIHNAATYNRNLVKKMTANPPMGTPARPGTMIPTFIFSLYNENRK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+GV   NG  IY IDLSG+  ESE+ PLP+   N+PYKGK+WCVV   A L 
Sbjct  341  DGPGTERHWGVFNENGKAIYDIDLSGQRQESEYEPLPEGINNRPYKGKLWCVVRREAGLM  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             V   LS  C QGN TC  + PG  CY P S+I HASYAFSSYWAQFRS G +CYFNGLA
Sbjct  401  EVERELSTVCSQGNETCEALAPGNDCYEPISVIWHASYAFSSYWAQFRSQGASCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS+G+CK+PS+T+
Sbjct  461  KQTTTDPSHGSCKFPSVTV  479



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 156/202 (77%), Gaps = 6/202 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+++N+ATYNRN+ ++   +   GTPARPG  +P  IF+LYNE++K
Sbjct  267  ETGWPNAGDLDQIGANVHNAATYNRNLARRMAVRPAAGTPARPGAAMPVFIFSLYNEDRK  326

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVV----APA  440
            PGPGTERH+G+L P+G  +Y +DLSG+ P   +PPLP P  + PY GK+WCV+       
Sbjct  327  PGPGTERHWGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCVLDAEGKAT  386

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            AN TAV  AL+YACGQG  TC+ I+PGG CY PN+L+ HASYAF+SYW QFR  GGTC+F
Sbjct  387  ANTTAVGAALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFRQAGGTCFF  446

Query  259  NGLAVKTINDPSYGACKYPSIT  194
            +GLAV+T  DPSYG+CKYPS+T
Sbjct  447  DGLAVQTKADPSYGSCKYPSLT  468



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GDVDQ+GA+IYN+ATYNRN+++K T+K  +GTPARPG+VIPT IF+LY ENQK
Sbjct  354  ETGWPTAGDVDQVGANIYNAATYNRNLIRKMTAKPPLGTPARPGLVIPTFIFSLYEENQK  413

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+ NGT IY IDL+GK   S++ PLP    N PYKGKVWC VAP ANL 
Sbjct  414  TGPGTERHWGLLHSNGTAIYDIDLTGKRLASDYKPLPPAQNNVPYKGKVWCEVAPGANLM  473

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             ++ AL+YAC Q N+TC  + PG  CY P S+  H+SYAFSSYWA+FRS G TCYF+GLA
Sbjct  474  NLSSALTYACSQDNQTCAALSPGKECYEPISVFWHSSYAFSSYWAKFRSQGATCYFSGLA  533

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +PS G CK+PS+ L
Sbjct  534  RQTTVNPSRGRCKFPSVIL  552



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 156/200 (78%), Gaps = 7/200 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN G+ DQ+GA+IYN+ATYNRN VKKF++   VG P+RPG VIP  IFAL+NEN+K
Sbjct  258  ETGWPNAGNPDQLGANIYNAATYNRNAVKKFSANPPVGIPSRPGAVIPATIFALFNENKK  317

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA-NL  431
            PGPGTERHFG LYP+G  +YPIDLSGKTP S +PPL KP +N    G++WCVVA    N 
Sbjct  318  PGPGTERHFGQLYPDGKFVYPIDLSGKTPISAYPPLRKPASN----GRLWCVVANGVRNA  373

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            T++  AL+YACG GN TC+ I+PGG C+ P+SLIRHASY FSSYWAQF + G TC FNGL
Sbjct  374  TSLTAALTYACGNGNGTCDGIRPGGKCFRPDSLIRHASYGFSSYWAQFSAQGATCSFNGL  433

Query  250  AVKTINDPSYGACKYPSITL  191
            A  T  DPSYG CKYPS+ L
Sbjct  434  ATLTSKDPSYGYCKYPSVNL  453



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GASIYN+ATYNRN+V K T +  +GTPARPG+ IP  IF+LY+ENQK
Sbjct  268  ETGWPNAGDIGETGASIYNAATYNRNLVTKMTGQPLIGTPARPGLFIPAFIFSLYDENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+PNGT+IY IDL+GK   S++ PLP    + PY+GK WCV  P  NLT
Sbjct  328  TGPGTERHWGLLHPNGTSIYQIDLTGKRASSDYEPLPATHNDMPYEGKSWCVATPDVNLT  387

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++AC QGN TC  + PG  CY P S+I HAS+AFSSYWA+FRS G  CYFNGLA
Sbjct  388  ELERALTFACSQGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAKFRSQGANCYFNGLA  447

Query  247  VKTINDPSYGACKYPSITL  191
            V+T +DPS G C++PS+T+
Sbjct  448  VQTTSDPSRGLCQFPSVTI  466



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 158/201 (79%), Gaps = 6/201 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+++N+ATYNRN+V++  ++   GTPARPG ++P  IF+LYNENQK
Sbjct  273  ETGWPNAGDLDQIGANVHNAATYNRNLVQRMAARPAAGTPARPGALMPVFIFSLYNENQK  332

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PA  440
            PGPGTERH+G+LYP+G   Y +DLSG+ P + +P LP P  N+PYKG++WCV       A
Sbjct  333  PGPGTERHWGLLYPHGKMAYDVDLSGRRPLASYPSLPPPENNEPYKGRIWCVFGGGRRAA  392

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            +N TAV  AL+YACGQGN TC+ I+PGG C+ PN+++ HASYAF+SYW  FR  G TC+F
Sbjct  393  SNATAVGAALAYACGQGNGTCDGIRPGGPCHKPNTIVSHASYAFNSYWQLFRRAGATCFF  452

Query  259  NGLAVKTINDPSYGACKYPSI  197
            +GLA++T  DPSYG+CKY S+
Sbjct  453  DGLALQTKTDPSYGSCKYRSL  473



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 158/201 (79%), Gaps = 6/201 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQIGA+++N+ATYNRN+V++  ++   GTPARPG ++P  IF+LYNENQK
Sbjct  274  ETGWPNAGDLDQIGANVHNAATYNRNLVQRMAARPAAGTPARPGALMPVFIFSLYNENQK  333

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PA  440
            PGPGTERH+G+LYP+G   Y +DLSG+ P + +P LP P  N+PYKG++WCV       A
Sbjct  334  PGPGTERHWGLLYPHGKMAYDVDLSGRRPLASYPSLPPPENNEPYKGRIWCVFGGGRRAA  393

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            +N TAV  AL+YACGQGN TC+ I+PGG C+ PN+++ HASYAF+SYW  FR  G TC+F
Sbjct  394  SNATAVGAALAYACGQGNGTCDGIRPGGPCHKPNTIVSHASYAFNSYWQLFRRAGATCFF  453

Query  259  NGLAVKTINDPSYGACKYPSI  197
            +GLA++T  DPSYG+CKY S+
Sbjct  454  DGLALQTKTDPSYGSCKYRSL  474



>ref|XP_011620347.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Amborella 
trichopoda]
Length=456

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GDVDQIGA+IYN+A YNRN+++K TS+ GTP RP   + T IF+LYNE+QKPG
Sbjct  262  ETGWPNAGDVDQIGANIYNAAHYNRNLIRKLTSREGTPMRPNQTMFTYIFSLYNEDQKPG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
             GTERH+G+LYPNG+ ++ IDL+G+  +SE+ PLP+P  N+ +KGK+WCVV   AN++AV
Sbjct  322  RGTERHWGLLYPNGSRVFEIDLNGRKLDSEYEPLPEPVNNEEFKGKIWCVVVHGANVSAV  381

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              AL +AC QGN TC+ I+ G  CY PN+++ HASYAF++YW +FR  GGTCYF+GLA +
Sbjct  382  GPALDHACAQGNGTCDAIKSGRECYEPNTIVGHASYAFNAYWQRFRKSGGTCYFDGLAEQ  441

Query  241  TINDPSYGACKYPS  200
            T  DPS+G+C YP+
Sbjct  442  TAVDPSHGSCNYPA  455



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN+V+K T+    GTPARPG +IPT IFALY+EN+K
Sbjct  218  ETGWPNAGDIDEAGANIKNAATYNRNLVRKMTASNPTGTPARPGSLIPTFIFALYDENRK  277

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+PNGT+IY IDL+GK   S++  LP    N PYKGK+WC+ AP  NLT
Sbjct  278  TGPGTERHWGLLHPNGTSIYQIDLTGKRASSDYETLPPAQNNVPYKGKLWCIAAPEVNLT  337

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++AC QGN TC+ + PG  CY P S+  HASYAFSSYWA+FRS G  CYFNGLA
Sbjct  338  ELESALTFACNQGNGTCDSLTPGKECYEPLSVTWHASYAFSSYWAKFRSQGANCYFNGLA  397

Query  247  VKTINDPSYGACKYPSITL  191
             +T ++PS G+C++PS+T+
Sbjct  398  QQTTSNPSRGSCQFPSVTI  416



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GASIYN+ATYNRN+V K T +  +GTPARPG+ IP  IF+LY+ENQK
Sbjct  268  ETGWPNAGDIGETGASIYNAATYNRNLVTKMTGRPQIGTPARPGLFIPAFIFSLYDENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+PNGT+IY IDL+GK   S++ PLP    + PY+GK WCV AP  NLT
Sbjct  328  TGPGTERHWGLLHPNGTSIYQIDLTGKRASSDYEPLPATQNDMPYEGKSWCVAAPDVNLT  387

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++AC +GN TC  + PG  CY P S+I HAS+AFSSYWA+FRS G  CYFNGLA
Sbjct  388  ELERALNFACSKGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAKFRSQGANCYFNGLA  447

Query  247  VKTINDPSYGACKYPSITL  191
            V+T  +PS G C++PS+T+
Sbjct  448  VQTTRNPSRGLCQFPSVTI  466



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN+V+K T+    GTPARPG +IPT IFALY+EN K
Sbjct  277  ETGWPNAGDIDEAGANIKNAATYNRNLVRKMTASNPTGTPARPGALIPTFIFALYDENTK  336

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+PNGT+IY IDL+GK   S++  LP    N PYKGK+WC+ AP  NLT
Sbjct  337  TGPGTERHWGLLHPNGTSIYQIDLTGKRASSDYETLPPAHNNVPYKGKLWCIAAPEVNLT  396

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++AC QGN TC+ + PG  CY P S+  HASYAFSSYWA+FRS G  CYFNGLA
Sbjct  397  ELERALTFACNQGNGTCDSLTPGKECYEPLSVTWHASYAFSSYWAKFRSQGANCYFNGLA  456

Query  247  VKTINDPSYGACKYPSITL  191
             +T ++PS G+C++PS+T+
Sbjct  457  QQTTSNPSRGSCQFPSVTI  475



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGGD DQIGA++ N+A YNRN+  +     GTPARPG  +P  +F+LYNEN KPG
Sbjct  288  ETGWPNGGDYDQIGANVRNAAVYNRNLAARMARNPGTPARPGARMPVFVFSLYNENLKPG  347

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ YPNGT +Y +DL+G+ P   +PPLP P  + PYKG++WCV+A  A    N
Sbjct  348  PGTERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWCVLAAHAGRKLN  407

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV DAL+YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR  G TCYFN 
Sbjct  408  ETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNN  467

Query  253  LAVKTINDPSYGACKYPS  200
            LA +TI DPS+G+CK+ S
Sbjct  468  LAEQTIKDPSHGSCKFRS  485



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GDVDQ GA++YN+A  N+N++KK T+K  VGTPARPG+ IPT IFALYNENQK
Sbjct  277  ETGWPNAGDVDQPGANVYNAALXNQNLIKKMTAKPAVGTPARPGMTIPTFIFALYNENQK  336

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L  NG  +Y +DL+G+  ES    LP P  N+PY+GK+WCVVA   N  
Sbjct  337  RGPGTERHWGLLDCNGKPVYGVDLTGEL-ESNDDQLPMPQNNKPYQGKIWCVVASEVNPE  395

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL YAC QGN TC+ + PG  CY P SL+ HASYAFSSYWA+FRSLG  CYFNGLA
Sbjct  396  QLVSALIYACSQGNGTCDALMPGKECYEPFSLLSHASYAFSSYWAKFRSLGANCYFNGLA  455

Query  247  VKTINDPSYGACKYPSITL  191
            V+T  DPS G+CK+P++TL
Sbjct  456  VQTTEDPSRGSCKFPTVTL  474



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GD+DQIGA+I N+ATYNR +V+K T+K  +GTPARPG VIPT IF+LY+ENQK
Sbjct  264  ETGWPTTGDIDQIGANINNAATYNRKLVQKMTAKPPLGTPARPGSVIPTFIFSLYDENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GP TERH+G+L  NGT+IY IDL+GK P S + PLP    N PYKGK+WC VAP A+  
Sbjct  324  TGPTTERHWGLLRSNGTSIYEIDLTGKRPLSSYKPLPAARNNVPYKGKIWCEVAPGADAM  383

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             ++ ALSYACGQGN+TC  + PG  CY P S+  HASYAFSSYWA+FR  G TC FNGLA
Sbjct  384  NLSLALSYACGQGNQTCAALNPGKQCYEPVSVFWHASYAFSSYWARFRKQGATCNFNGLA  443

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +PS G C +PS+TL
Sbjct  444  RQTRANPSRGHCSFPSVTL  462



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 152/199 (76%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD+DQ GA+ YN+ATYNRN+V K TS   +GTPARPG+ I T IF+LY+ENQK
Sbjct  270  ETGWPHAGDIDQPGANAYNAATYNRNLVMKMTSNPPLGTPARPGIEILTFIFSLYDENQK  329

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERH+G+L  NG   Y +DL+G  PE+ +  LPKP+ N PYKGK+WCV    A+LT
Sbjct  330  PGPGTERHWGLLSNNGKPTYEVDLTGTRPETSYAILPKPSNNHPYKGKLWCVADSRASLT  389

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACGQGN TCN + PG  CY P S+  HASYAFSSYWA+FR+ G  CYF+GLA
Sbjct  390  DLGPALDFACGQGNGTCNELAPGKGCYQPVSISAHASYAFSSYWAKFRNAGAVCYFDGLA  449

Query  247  VKTINDPSYGACKYPSITL  191
            V+T  DPS+G+C++PS+ L
Sbjct  450  VQTTTDPSHGSCQFPSVLL  468



>gb|ACR37660.1| unknown [Zea mays]
Length=225

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNG D +QIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPG
Sbjct  23   ETGWPNGCDYNQIGGNVHNAAIYNRNLAARMAKNPGTPVRPGAKMPVFVFSLYNEDLKPG  82

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N
Sbjct  83   PGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLN  142

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV +ALSYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN 
Sbjct  143  ETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNN  202

Query  253  LAVKTINDPSYGACKYPS  200
            LA +TI DPS+G+C++PS
Sbjct  203  LAEQTIKDPSHGSCRFPS  220



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRN++KK TSK  +GTPARPG +IPT IF+LY+ENQK
Sbjct  270  ETGWPNAGDFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTFIFSLYDENQK  329

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA  A+L 
Sbjct  330  TGPGTERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARGADLL  389

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  AL YACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA
Sbjct  390  ALTSALGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLA  449

Query  247  VKTINDPS  224
             +TI +PS
Sbjct  450  QQTIINPS  457



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 146/197 (74%), Gaps = 3/197 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGGD DQIG +  N+A YNRN+  +     GTPARPG  +P  +F+LYNEN KPG
Sbjct  278  ETGWPNGGDYDQIGGNARNAAVYNRNLAARMARNPGTPARPGAKMPVFVFSLYNENLKPG  337

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NL  431
            PGTERH+G+ YP+GT +Y IDL+G+ P   +PPLP P  N PYKG +WCV+A      N 
Sbjct  338  PGTERHWGLYYPDGTEVYQIDLTGRRPLWAYPPLPAPENNTPYKGPIWCVLATHGRKLNE  397

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TAV DAL+YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR +G TCYFN L
Sbjct  398  TAVGDALTYACGQGNGTCDAVQPGGECFQPNTGEAHASYAFNSYWQQFRKIGATCYFNNL  457

Query  250  AVKTINDPSYGACKYPS  200
            A +TI DPS+G+CK+ S
Sbjct  458  AEQTIKDPSHGSCKFHS  474



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 149/188 (79%), Gaps = 3/188 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA++YN+ATYNRNVVKK ++   VGTPARPG V+P+ IFAL+NENQK
Sbjct  263  ETGWPNNGDYDQIGANVYNAATYNRNVVKKLSAVPPVGTPARPGKVLPSFIFALFNENQK  322

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNG+ +Y I+LSG+T E +   LP P  N+ YKGK+WCVVA  AN T
Sbjct  323  TGPGTERHFGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEVYKGKIWCVVAKGANWT  381

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +ALSYAC QGN TC+PI+ GG C+ P+  + HASYAFSSYWA FR  GGTC FNGLA
Sbjct  382  QLGEALSYACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSFNGLA  441

Query  247  VKTINDPS  224
             +TI DPS
Sbjct  442  TQTIKDPS  449



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK  ++   GTPARPGVVIPT IF+LY+ENQK
Sbjct  243  ETGWPNSGDIDEPGANINNAATYNRNLIKKMMAEPPAGTPARPGVVIPTFIFSLYDENQK  302

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+ NG  +Y IDL+ K P S + PLP PT N+PYKGK+WCV    AN+T
Sbjct  303  AGPGTERHWGLLHANGDAVYEIDLTEKRPASTYGPLPLPTNNRPYKGKLWCVARIDANVT  362

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  ALS AC + N  C+ + PG  C+ P S  RHASYAFS+YWA+FRS G TCYF+GLA
Sbjct  363  DLGSALSSAC-RVNGMCDILMPGRECHEPASTFRHASYAFSAYWARFRSRGATCYFDGLA  421

Query  247  VKTINDPSYGACKYPSITL  191
             +T+ DPS G+CK+PS+TL
Sbjct  422  EQTVGDPSRGSCKFPSVTL  440



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNG D DQIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPG
Sbjct  281  ETGWPNGCDYDQIGGNVHNAAIYNRNLAARMVKNPGTPVRPGAKMPVFVFSLYNEDLKPG  340

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WC+++ AA    N
Sbjct  341  PGTERHWGLYYANGTAVYEIDLTGRRPLWSYPPLPAPENNTPYKGPIWCLLSAAASNKLN  400

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV +AL+YACGQGN TC+ IQPG  CY PN+ + HASYAF+SYW QFR +G TCYFN 
Sbjct  401  ETAVGNALTYACGQGNGTCDAIQPGKNCYMPNTTVAHASYAFNSYWQQFRKIGATCYFNN  460

Query  253  LAVKTINDPSYGACKYPS  200
            LA +TI DPS+G+CK+PS
Sbjct  461  LAEQTIKDPSHGSCKFPS  478



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRN++KK TSK  +GTPARPG +IPT IF+LY+ENQK
Sbjct  270  ETGWPNAGDFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTFIFSLYDENQK  329

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+ NG  IY IDLSG    S++ PLP    N PYKGKVWCVVA  A+L 
Sbjct  330  TGPGTERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVWCVVARGADLL  389

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  AL YACGQGN TC+ + PG  CY P SL  HASYAFSSYWA+F   G TCYFNGLA
Sbjct  390  ALTSALGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGKGATCYFNGLA  449

Query  247  VKTINDP  227
             +TI +P
Sbjct  450  QQTIINP  456



>gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GDVDQIGA+IYN+A YNRN+++K TS+ GTP RP   + T IF+LYNE+QKPG
Sbjct  274  ETGWPNAGDVDQIGANIYNAAHYNRNLIRKLTSREGTPMRPNQTMFTYIFSLYNEDQKPG  333

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
             GTERH+G+LYPNG+ ++ IDL+G+  +SE+ PLP+P  N+ +KGK+WCVV   AN++AV
Sbjct  334  RGTERHWGLLYPNGSRVFEIDLNGRKLDSEYEPLPEPVNNEEFKGKIWCVVVHGANVSAV  393

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              AL +AC QGN TC+ I+ G  CY PN+++ HASYAF++YW +FR  GGTCYF+GLA +
Sbjct  394  GPALDHACAQGNGTCDAIKSGRECYEPNTIVGHASYAFNAYWQRFRKSGGTCYFDGLAEQ  453

Query  241  TINDPSYGACKYPS  200
            T  DPS  +  YP+
Sbjct  454  TAVDPSEFSNLYPT  467



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 157/201 (78%), Gaps = 5/201 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD D+IGA+IYN+ATYNRN++++  SK  +GTPARPG+ IPT IF+LY+ENQK
Sbjct  271  ETGWPNGGDYDEIGANIYNAATYNRNLIRRVVSKPPIGTPARPGLTIPTFIFSLYDENQK  330

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA--PAAN  434
             GPGTERH+G+L+PNG  +Y IDL+G+T +SEF  LP+PT N P+ GK+WCVV      N
Sbjct  331  EGPGTERHWGMLHPNGRPMYDIDLTGQTLDSEFIDLPQPTNNGPFHGKLWCVVTNDHTMN  390

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
               +  AL +AC + N TC+ I PG +CY P S++ HA+YAFSSYWA+++  G TCYFNG
Sbjct  391  EMDLGQALEFAC-RRNETCDEISPGKSCYQPVSIVSHANYAFSSYWAKYKEDGETCYFNG  449

Query  253  LAVKTINDPSYGACKYPSITL  191
            LAV+T  DPS+G+CK+P ++L
Sbjct  450  LAVQTNVDPSHGSCKFPYVSL  470



>gb|ACN28576.1| unknown [Zea mays]
Length=335

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNG D +QIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPG
Sbjct  133  ETGWPNGCDYNQIGGNVHNAAIYNRNLAARMAKNPGTPVRPGAKMPVFVFSLYNEDLKPG  192

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N
Sbjct  193  PGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLN  252

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV +ALSYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN 
Sbjct  253  ETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNN  312

Query  253  LAVKTINDPSYGACKYPS  200
            LA +TI DPS+G+C++PS
Sbjct  313  LAEQTIKDPSHGSCRFPS  330



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 156/200 (78%), Gaps = 4/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD D+IGA+IYN+ATYNRN++++  SK  +GTPARPG+ IPT IF+LY+ENQK
Sbjct  265  ETGWPNGGDYDEIGANIYNAATYNRNLIRRIVSKPAIGTPARPGLAIPTFIFSLYDENQK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA-PAANL  431
             GPGTERH+G+L PNG  +Y IDL+G+T ++EF  LP+PT N PY GK+WCVV     N 
Sbjct  325  EGPGTERHWGMLNPNGRPMYDIDLTGQTLDTEFIDLPQPTNNGPYHGKLWCVVTNDTMNE  384

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
              +  AL +AC + N TC+ I PG +CY P S++ HA+YAFSSYWA++R  G TCYFNGL
Sbjct  385  MDLGQALEFAC-RRNETCDDISPGKSCYQPVSIVSHANYAFSSYWAKYREDGETCYFNGL  443

Query  250  AVKTINDPSYGACKYPSITL  191
            AV+T  DPS+G+CK+P ++L
Sbjct  444  AVQTNVDPSHGSCKFPYVSL  463



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+++ GA+IYN+ATYNRN++++ T+K  +GTPARPGV I T +F+L++ENQK
Sbjct  264  ETGWPNSGDIEETGANIYNAATYNRNLIQRMTAKPPIGTPARPGVPITTFLFSLFDENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERH+G+L+ +GT IY +DL+GK   +++ PL  P  N PYKGKVWCV A  AN  
Sbjct  324  PGPGTERHWGLLHTDGTPIYDLDLTGKKTNTDYAPLQAPKNNVPYKGKVWCVAAEGANEI  383

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +A AL+YAC   N TC+ + PG  CY P S+  HASY FS+YWAQF+S G TCYFNGLA
Sbjct  384  ELAAALTYACNVANMTCDALSPGNECYEPVSIPLHASYVFSTYWAQFKSSGATCYFNGLA  443

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS  +CK+PS+ L
Sbjct  444  TETTKDPSRNSCKFPSVIL  462



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 152/201 (76%), Gaps = 4/201 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK
Sbjct  277  ETGWPNSGDIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQK  336

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+ +GT IY IDL+GK    ++ PLP+   N PYKG VWCVVA   N  
Sbjct  337  TGPGTERHWGLLHADGTPIYDIDLAGKRRLEDYEPLPEANNNSPYKGSVWCVVAKGVNND  396

Query  427  AVADALSYAC--GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             +  AL+  C  G GN TC+ + PG  CY P S I HASYAFSSYWA+FRS G TCYFNG
Sbjct  397  ELGSALTNLCNSGAGNGTCDALSPGKECYEPVSEILHASYAFSSYWAKFRSHGATCYFNG  456

Query  253  LAVKTINDPSYGACKYPSITL  191
            LA +T  DPS+G+CK+PS+TL
Sbjct  457  LAEQTTVDPSHGSCKFPSVTL  477



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+++ GA+I+N+ TYNRN++++ T+K  +GTPARPGV IPT IF+L+NENQK
Sbjct  264  ETGWPNSGDIEEPGANIFNAPTYNRNLIQRMTTKPPIGTPARPGVTIPTFIFSLFNENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERH+G+L  +GT IY +DL+GK   ++F  LP P  N P+KGKVWCV A  AN  
Sbjct  324  PGPGTERHWGLLETDGTPIYDLDLTGKKHITDFASLPAPENNVPFKGKVWCVAAKGANEI  383

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +A ALSYAC + N TC  + PG  CY P S+  HASY FS++WA+F++ G TCYFNGLA
Sbjct  384  ELASALSYACNEVNMTCEALSPGNECYEPVSVTDHASYVFSTFWAKFKTTGATCYFNGLA  443

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS   CK+PS+T+
Sbjct  444  EQTTKDPSRPFCKFPSVTI  462



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   253 bits (647),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 142/199 (71%), Gaps = 24/199 (12%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD DQIGA+IYN+ATYNRNVVKK  +   VGTPARPG V+P  +FALYNENQK
Sbjct  264  ETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFALYNENQK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERHFG+L+PNGT +Y IDLSGKT   E   LP P  N  YKGK+WCV        
Sbjct  324  TGPGTERHFGLLHPNGTQVYGIDLSGKTEYKE--SLPAPENNDLYKGKIWCV--------  373

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
                        GN TC+PIQ GG C  P+  + HASYAFSSYWAQFR +GGTC FNGLA
Sbjct  374  ------------GNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTCSFNGLA  421

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPSYG C++PS+TL
Sbjct  422  TQTIKDPSYGRCEFPSVTL  440



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNG D +QIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ KPG
Sbjct  277  ETGWPNGCDYNQIGGNVHNAAIYNRNLAARMAKNPGTPVRPGAKMPVFVFSLYNEDLKPG  336

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ Y NGT +Y IDL+G+ P   +PPLP P  N PYKG +WCV++ AA    N
Sbjct  337  PGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWCVLSAAASNKLN  396

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV +ALSYACGQGN TC+ IQPG  CY PN+   HASYAF+SYW QF   G TCYFN 
Sbjct  397  ETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQFEKTGATCYFNN  456

Query  253  LAVKTINDPSYGACKYPS  200
            LA +TI DPS+G+C++PS
Sbjct  457  LAEQTIKDPSHGSCRFPS  474



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 149/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+IGAS++N+ATYNRN++K+ T+   VGTPARPG+ IPT +F+L++EN+K
Sbjct  282  ETGWPNSGDIDEIGASVHNAATYNRNLIKRMTANPPVGTPARPGLSIPTFVFSLFDENRK  341

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERH+G+L P+GT +Y +D +GK   S + PLP P  N PYKG VWCV    A++ 
Sbjct  342  PGPGTERHWGILRPSGTPVYEVDFTGKKQVSGYGPLPAPDNNVPYKGNVWCVANEGADMA  401

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+ +AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFRS    CYF+GLA
Sbjct  402  ALGEALRFACGRSNDTCQALAPGRECYEPVSVTWHASYAFSSYWAQFRSQNARCYFDGLA  461

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  462  RETTTNPGNDRCKFPSVTL  480



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 143/193 (74%), Gaps = 4/193 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGGD DQIGA++ N+A YNRN+  +     GTPARPG  +P  +F+LYNEN KPG
Sbjct  336  ETGWPNGGDYDQIGANVRNAAVYNRNLAARMARNPGTPARPGARMPVFVFSLYNENLKPG  395

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ YPNGT +Y +DL+G+ P   +PPLP P  + PYKG++WCV+A  A    N
Sbjct  396  PGTERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWCVLAAHAGRKLN  455

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV DAL+YACGQGN TC+ +QPGG C+ PN+   HASYAF+SYW QFR  G TCYFN 
Sbjct  456  ETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNN  515

Query  253  LAVKTINDPSYGA  215
            LA +TI DPS  A
Sbjct  516  LAEQTIKDPSKHA  528



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 152/200 (76%), Gaps = 4/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGA+IYN+ATYNRN+V++ TS+  +GTPARP   IPT IF+LY+ENQK
Sbjct  242  ETGWPNGGDYDQIGANIYNAATYNRNLVRRLTSQPLIGTPARPESTIPTFIFSLYDENQK  301

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANL  431
             GPGTERH+G+L PNG  IY IDL+G+  E+EF  LP P  N P+ GK+WCV+A    N 
Sbjct  302  EGPGTERHWGLLLPNGKPIYDIDLTGEISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNE  361

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
              +  AL +AC + +  C+ + PG +CY P S++ HA+YAFSSYWA+FR  G TC+FNGL
Sbjct  362  MDLGQALEFACKR-DGICDELSPGKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGL  420

Query  250  AVKTINDPSYGACKYPSITL  191
            AV+T  DPS+G+CK+P ++L
Sbjct  421  AVQTTVDPSHGSCKFPYVSL  440



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 151/200 (76%), Gaps = 4/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGA+IYN+ATYNRN+V++ TS+  +GTPARPG  IPT IF+LY+ENQK
Sbjct  272  ETGWPNGGDYDQIGANIYNAATYNRNLVRRLTSQPPIGTPARPGSTIPTFIFSLYDENQK  331

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANL  431
             GPGTERH+G+L PNG  IY IDL+G+  ESE   LP P  N P+ GK+WCV+A    N 
Sbjct  332  EGPGTERHWGLLQPNGKAIYDIDLTGEISESELSKLPVPKNNGPFHGKLWCVLAKDIVNE  391

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
              +  AL +AC + +  C+ + P  +CY P S++ HA+YAFSSYWA+FR  G TC+FNGL
Sbjct  392  KDLGQALEFACKR-DGICDELSPEKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGL  450

Query  250  AVKTINDPSYGACKYPSITL  191
            AV+T  DPS+G+CK+P ++L
Sbjct  451  AVQTTLDPSHGSCKFPYVSL  470



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 152/200 (76%), Gaps = 4/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPNGGD DQIGA+IYN+ATYNRN+V++ TS+  +GTPARP   IPT IF+LY+ENQK
Sbjct  272  ETGWPNGGDYDQIGANIYNAATYNRNLVRRLTSQPLIGTPARPESTIPTFIFSLYDENQK  331

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP-AANL  431
             GPGTERH+G+L PNG  IY IDL+G+  E+EF  LP P  N P+ GK+WCV+A    N 
Sbjct  332  EGPGTERHWGLLLPNGKPIYDIDLTGEISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNE  391

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
              +  AL +AC + +  C+ + PG +CY P S++ HA+YAFSSYWA+FR  G TC+FNGL
Sbjct  392  MDLGQALEFACKR-DGICDELSPGKSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGL  450

Query  250  AVKTINDPSYGACKYPSITL  191
            AV+T  DPS+G+CK+P ++L
Sbjct  451  AVQTTVDPSHGSCKFPYVSL  470



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 143/197 (73%), Gaps = 3/197 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGGD +QIG +++N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPG
Sbjct  322  ETGWPNGGDYEQIGGNVHNAAIYNRNLAARMAKNPGTPARPGAKMPVFVFSLYNEDLKPG  381

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA---NL  431
            PGTERH+G+ Y NGT +YPIDL+G  P   +PPLP P  + PYKG VWCV+A      NL
Sbjct  382  PGTERHWGLYYANGTAVYPIDLTGARPLWSYPPLPPPENDTPYKGPVWCVLADRGGKLNL  441

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TAV DAL+YACGQGN TC  IQPG  C+ PN+   HASYAF+SYW Q R  G TCYFN L
Sbjct  442  TAVGDALAYACGQGNGTCATIQPGRECFQPNTTAAHASYAFNSYWQQLRKNGATCYFNNL  501

Query  250  AVKTINDPSYGACKYPS  200
            A +T  DPS+G+CK+ S
Sbjct  502  AEETTKDPSHGSCKFHS  518



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I+N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNSGDIDETGANIFNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L PNGT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T
Sbjct  338  PGSGTERHWGILNPNGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANET  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNEQCKFPSVTL  476



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK
Sbjct  252  ETGWPNSGDIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQK  311

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L+ +GT IY IDL+GK    ++ PLP+   N PYKG VWCVVA   N  
Sbjct  312  TGPGTERHWGLLHADGTPIYDIDLTGKRRLEDYKPLPEANNNSPYKGMVWCVVAKGVNND  371

Query  427  AVADALSYAC--GQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             +  AL+  C    GN TC+ + PG  CY P S I HASYAFSSYWA+F S G TCYF+G
Sbjct  372  ELDSALNNLCSSSSGNGTCDALSPGKECYEPVSEILHASYAFSSYWAKFWSHGATCYFDG  431

Query  253  LAVKTINDPSYGACKYPSITL  191
            LA +T  DPS+G+CK+PS+TL
Sbjct  432  LAEQTTVDPSHGSCKFPSVTL  452



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGGD +QIG + +N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPG
Sbjct  277  ETGWPNGGDYEQIGCNAHNAAIYNRNLAARMARSPGTPARPGAKMPVFVFSLYNEDLKPG  336

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAAN  434
            PGTERH+G+ Y NGT +YP+DL+G  P   +P LP P  + PYKG VWCV+A       N
Sbjct  337  PGTERHWGLYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKGPVWCVLAGRRGEKLN  396

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV DAL+YACGQGN TC+ IQPGG C+ PN+   HASYAF+SYW Q R  G TCYFN 
Sbjct  397  ETAVGDALAYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSYWQQLRKTGATCYFNN  456

Query  253  LAVKTINDPSYGACKYPS  200
            LA +T  DPS+G+CK+ S
Sbjct  457  LAEETTKDPSHGSCKFHS  474



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQK
Sbjct  280  ETGWPNSGDIDETGANILNAATYNRNLIKKMTANPPLGTPARPGLPIPTFLFSLFNENQK  339

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+  
Sbjct  340  PGSGTERHWGILNPDGTQIYDIDFSGTKPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEE  399

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  400  ELGQALDFACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  459

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  460  RETTTNPGNERCKFPSVTL  478



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGGD +QIG + +N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPG
Sbjct  280  ETGWPNGGDYEQIGCNAHNAAIYNRNLAARMARSPGTPARPGAKMPVFVFSLYNEDLKPG  339

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA----PAAN  434
            PGTERH+G+ Y NGT +YP+DL+G  P   +P LP P  + PYKG VWCV+A       N
Sbjct  340  PGTERHWGLYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKGPVWCVLAGRRGEKLN  399

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV DAL+YACGQGN TC+ IQPGG C+ PN+   HASYAF+SYW Q R  G TCYFN 
Sbjct  400  ETAVGDALAYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSYWQQLRKTGATCYFNN  459

Query  253  LAVKTINDPSYGACKYPS  200
            LA +T  DPS+G+CK+ S
Sbjct  460  LAEETTKDPSHGSCKFHS  477



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQK
Sbjct  280  ETGWPNSGDIDETGANILNAATYNRNLIKKMTANPPLGTPARPGLPIPTFLFSLFNENQK  339

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+  
Sbjct  340  PGSGTERHWGILNPDGTQIYEIDFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEE  399

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  400  ELGQALDFACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  459

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  460  RETTTNPGNERCKFPSVTL  478



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+IGA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+K
Sbjct  281  ETGWPNSGDIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVFSLFNENKK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T
Sbjct  341  PGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANET  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA
Sbjct  401  ELEEALRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+IGA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+K
Sbjct  276  ETGWPNSGDIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVFSLFNENKK  335

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T
Sbjct  336  PGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANET  395

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA
Sbjct  396  ELEEALRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLA  455

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  456  HETTTNPGNDRCKFPSVTL  474



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQ GA+I+N+A YNRN+V+K T+   +GTPA+PGVVIPT IF+LY+EN+K
Sbjct  271  ETGWPNAGDIDQPGANIHNAAIYNRNLVRKVTATPPIGTPAQPGVVIPTFIFSLYDENRK  330

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GTERH+G+L PNG   Y IDL+G   ES +P LP+PT N+P+KGK+WCVVAP + +T
Sbjct  331  FGRGTERHWGLLQPNGLPNYEIDLTGVQSESNYPTLPQPTNNKPFKGKIWCVVAPGSRIT  390

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR-SLGGTCYFNGL  251
             +   L+  C + N  C+ + PG  CY P SL+ HASYA SSYWA+ R S G TCYFNG 
Sbjct  391  DLGPVLNSVCKEDNGACDALAPGKECYEPVSLVAHASYALSSYWAKHRDSAGATCYFNGF  450

Query  250  AVKTINDPSYGACKYPSITL  191
            A +T  DPS+G CK+PS++L
Sbjct  451  AEQTTRDPSHGPCKFPSVSL  470



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQK
Sbjct  281  ETGWPNFGDIDETGANILNAATYNRNLIKKMTANPPIGTPARPGLPIPTFVFSLFNENQK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T
Sbjct  341  SGSGTQRHWGLLHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANET  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  ACGQ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEEALRLACGQSNTTCAALAPGRECYEPVSIYWHASYAVSSYWAQFRTQDVRCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTINPGNDRCKFPSVTL  479



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NENQK
Sbjct  276  ETGWPNSGDIDETGANILNAATYNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQK  335

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG  P S    LPKP+ N P+KG VWCVV   A+  
Sbjct  336  PGSGTERHWGILNPDGTQIYDIDFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEE  395

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  396  ELGQALDFACGRSNETCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  455

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  456  RETTTNPGNERCKFPSVTL  474



>emb|CDY67322.1| BnaA03g57600D [Brassica napus]
Length=221

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NENQK
Sbjct  23   ETGWPNSGDIDETGANILNAATYNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQK  82

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+  
Sbjct  83   PGSGTERHWGILNPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEA  142

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  143  ELQQALNFACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLA  202

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    C +PS+TL
Sbjct  203  RETTTNPGNEHCTFPSVTL  221



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD+D+ GA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+K
Sbjct  281  ETGWPHSGDIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVFSLFNENKK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN T
Sbjct  341  PGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANET  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA
Sbjct  401  ELEEALRMACARSNTTCAALAPGRECYEPVSVYWHASYALNSYWAQFRSQNVQCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>gb|EMT13087.1| Putative glucan endo-1,3-beta-glucosidase A6 [Aegilops tauschii]
Length=362

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 137/189 (72%), Gaps = 4/189 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGG  DQ+GA++ N+A YNRN+  +     GTPARPG  +P  +F+LYNE+ KPG
Sbjct  136  ETGWPNGGAYDQVGANVRNAAVYNRNLAARMARNPGTPARPGARMPVFVFSLYNEDLKPG  195

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ Y NGT +YP+DL+G+ P   +PPLP    + PYKG +WCV+A  A    N
Sbjct  196  PGTERHWGLYYANGTAVYPVDLTGRRPLWAYPPLPAADNDTPYKGPIWCVLAAHAGRKLN  255

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV DAL+YACGQGN TC  IQPGG C+ PN+   HASYAF+SYW QFR  G TCYFN 
Sbjct  256  ETAVGDALTYACGQGNGTCGAIQPGGECFQPNTGAAHASYAFNSYWQQFRKTGATCYFNN  315

Query  253  LAVKTINDP  227
            LA +TI DP
Sbjct  316  LAEQTIKDP  324



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I+N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NEN+K
Sbjct  278  ETGWPNSGDIDETGANIFNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENRK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T
Sbjct  338  PGSGTERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANET  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNEQCKFPSVTL  476



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNG D DQIG +++N+A YNRN+  +     GTP RPG  +P  +F+LYNE+ K G
Sbjct  282  ETGWPNGCDYDQIGGNVHNAAIYNRNLAARMAKNPGTPLRPGAKMPVFVFSLYNEDLKGG  341

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA----N  434
            PGTERH+G+ Y NGT +YPIDL+G+ P   +PPLP    N PYKG +WCV++ AA    N
Sbjct  342  PGTERHWGLYYANGTAVYPIDLTGRRPLWSYPPLPALENNTPYKGPIWCVLSAAASKKLN  401

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV +AL+YACGQGN TC  IQPG  CY PN+ + HASYAF+SYW QFR  G TCYFN 
Sbjct  402  ETAVGNALAYACGQGNGTCAAIQPGEKCYLPNTTVAHASYAFNSYWQQFRKTGATCYFNN  461

Query  253  LAVKTINDPSYGACKYPS  200
            LA +TI +PS+G+CK+ S
Sbjct  462  LAEQTIKNPSHGSCKFRS  479



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I+N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NEN+K
Sbjct  278  ETGWPNSGDIDETGANIFNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENRK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T
Sbjct  338  PGSGTERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANET  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNEQCKFPSVTL  476



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQK
Sbjct  280  ETGWPNFGDIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQK  339

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGT+RH+G+L+P+G+ IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T
Sbjct  340  SGPGTQRHWGILHPDGSPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANET  399

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + + L  AC Q N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  400  ELEETLRMACAQSNTTCAALAPGRECYEPVSIYWHASYALSSYWAQFRNQSIQCYFNGLA  459

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  460  HETTTNPGNDRCKFPSVTL  478



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD+D+ GA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+K
Sbjct  281  ETGWPHSGDIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVFSLFNENKK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN  
Sbjct  341  PGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEA  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS    CYFNGLA
Sbjct  401  ELEEALRMACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRSQNVQCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 153/203 (75%), Gaps = 6/203 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK
Sbjct  267  ETGWPSSGDIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQK  326

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP--AAN  434
             GPGTERH+G+L+ +GT IY +DL+GK P  ++ PLP+   N+PYKG VWCVVA   + N
Sbjct  327  TGPGTERHWGLLHADGTPIYDVDLTGKRPLEDYEPLPEEQNNRPYKGAVWCVVAKGVSVN  386

Query  433  LTAVADALSYACGQGNR--TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
               +  A++ AC  GN   TC+ + PG  CY P SL  HASYAFSSYWA+FRS G TC+F
Sbjct  387  DEELGSAVNNACIAGNATGTCDALSPGKECYEPVSLTWHASYAFSSYWAKFRSQGATCHF  446

Query  259  NGLAVKTINDPSYGACKYPSITL  191
            NGLA +T  DPS+G+CK+PS+  
Sbjct  447  NGLAEQTSLDPSHGSCKFPSVIF  469



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQK
Sbjct  281  ETGWPNSGDIDETGANVLNAATYNRNLIKKMTASPPIGTPARPGLPIPTFVFSLFNENQK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+GVL+P+GT IY ID +G+   + F PLPKPT N PYKG+VWCV    AN T
Sbjct  341  PGSGTQRHWGVLHPDGTPIYDIDFTGQKNLTGFNPLPKPTNNVPYKGQVWCVPVEGANET  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + + L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEETLRIACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAQFRNESIQCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GD++Q GA++ N+ATYNRN+VK+ T+K  VGTPARPGVVIPT IFAL++ENQK
Sbjct  269  ETGWPTAGDIEQPGANLLNAATYNRNLVKRITAKPTVGTPARPGVVIPTFIFALFDENQK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L 
Sbjct  329  PGSGTERHWGLLRSDGSPNYQIDLTGKESSVEYDPLPVVENNAPFRGRLWCVAARGVDLM  388

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  A+   CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA
Sbjct  389  ELEAAVDDVCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLA  448

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS G+C++PS+T 
Sbjct  449  EQTTVDPSNGSCRFPSVTF  467



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQK
Sbjct  281  ETGWPNSGDIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN  
Sbjct  341  PGSGTQRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEA  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + D L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEDTLRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARP + IPT +F+L+NENQK
Sbjct  281  ETGWPNSGDIDETGANILNAATYNRNLIKKMTAIPPIGTPARPALPIPTFVFSLFNENQK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN  
Sbjct  341  SGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEA  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  ACG+ N TC  + PG  CY+P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEEALRIACGRSNTTCAALAPGKECYDPVSIYWHASYAVSSYWAQFRTQNVGCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             ++  +P    CK+PS+TL
Sbjct  461  HESTINPGNDRCKFPSVTL  479



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA++ N+ATYNRN+++K T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  276  ETGWPNSGDIDETGANVLNAATYNRNLIRKMTANPPLGTPARRGSPIPTFLFSLFNENQK  335

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG  P + F  LPKP+ N P+KG VWCVVA  A+  
Sbjct  336  PGSGTERHWGILNPDGTPIYEIDFSGTRPVNSFGSLPKPSNNVPFKGNVWCVVAEGASEA  395

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  396  ELGQALNFACGESNATCAALAPGRECYEPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLA  455

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+T+
Sbjct  456  RETTTNPGNERCKFPSVTM  474



>emb|CDP15107.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD+DQ GA+ YN+ATYNRN+V++ +++  +GTPARP V IPT I+AL++E+Q 
Sbjct  132  ETGWPHAGDIDQPGANRYNAATYNRNLVRRMSAEPPIGTPARPSVFIPTFIYALFDEDQI  191

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT RHFG+L  N   +Y +DL+GK  E ++PPLP P+ N+P+KG +WCVVA  AN+ 
Sbjct  192  PGRGTARHFGILQANSWPVYDLDLTGKLGEGDYPPLPLPSNNEPFKGNLWCVVASEANIM  251

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +   L   C  GN  C+ + PG  CY P ++  HASYAFSSYW +FRS G  C+FNGLA
Sbjct  252  ELVPQLESVCSLGNGICDALSPGNDCYEPVTIRAHASYAFSSYWVKFRSRGAACHFNGLA  311

Query  247  VKTINDPSYGACKYPSI  197
            V +  DPS+G+CK+PS+
Sbjct  312  VLSTTDPSHGSCKFPSV  328



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I+N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQK
Sbjct  281  ETGWPNFGDIDETGANIFNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN  
Sbjct  341  PGSGTQRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEA  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + + L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEETLRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQK
Sbjct  281  ETGWPNSGDIDETGANILNAATYNRNLIKKMTTSPPIGTPSRPGLPIPTFVFSLFNENQK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+++P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN  
Sbjct  341  PGSGTQRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCVPVEGANEA  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + + L  ACG+ N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEETLRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVRCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK ++   +GTP+RPG+ IPT +F+L+NENQK
Sbjct  280  ETGWPNFGDIDETGANILNAATYNRNLIKKMSASPPIGTPSRPGLPIPTFVFSLFNENQK  339

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+G+ IY +D +G+TP + F PLPKPT N PYKG+VWCV    AN T
Sbjct  340  SGSGTQRHWGILHPDGSPIYDVDFTGQTPLTGFNPLPKPTNNVPYKGQVWCVPVEGANET  399

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + + L  AC Q N TC  + PG  CY P S+  HASYA +SYWAQFR+    C+FNGLA
Sbjct  400  ELEETLRMACAQSNTTCAALAPGRECYEPVSIYWHASYALNSYWAQFRNQSIQCFFNGLA  459

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  460  HETTTNPGNDRCKFPSVTL  478



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 152/203 (75%), Gaps = 6/203 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD++Q GA+I+N+ATYNRN++ +  +K  +GTPARPGVVIPT IF+L++ENQK
Sbjct  267  ETGWPSSGDIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQK  326

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP--AAN  434
             GPGTERH+G+L+ +GT IY +DL+GK    ++ PLP+   N+PYKG VWCVVA   + N
Sbjct  327  TGPGTERHWGLLHADGTPIYDVDLTGKRVLEDYEPLPEEQNNRPYKGAVWCVVAKGVSVN  386

Query  433  LTAVADALSYACGQGNR--TCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
               +  A++ AC  GN   TC+ + PG  CY P SL  HAS+AFSSYWA+FRS G TC+F
Sbjct  387  DEELGSAVNNACIAGNASGTCDALSPGKECYEPVSLTWHASFAFSSYWAKFRSQGATCHF  446

Query  259  NGLAVKTINDPSYGACKYPSITL  191
            NGLA +T  DPS+G+CK+PS+  
Sbjct  447  NGLAEQTSLDPSHGSCKFPSVIF  469



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NENQK
Sbjct  281  ETGWPNSGDIDETGANILNAATYNRNLIKKMTAIPPIGTPARPGLPIPTFVFSLFNENQK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG++WCV    A   
Sbjct  341  SGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEA  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  ACG+ N TC  + PG  CY P S+  HA YA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEEALRMACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NENQK
Sbjct  282  ETGWPNSGDIDETGANILNAATYNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQK  341

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+  
Sbjct  342  PGSGTERHWGILKPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEA  401

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  402  ELQQALNFACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLA  461

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    C +PS+TL
Sbjct  462  RETTTNPGNEHCTFPSVTL  480



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 148/199 (74%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD D+ GA+ YN+ATY  N+V K TS   +GTPA+PG+ IPT +F+LY+ENQK
Sbjct  274  ETGWPHDGDFDEPGANAYNAATYVSNLVAKVTSDPPIGTPAKPGIEIPTFVFSLYDENQK  333

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGPGTERH+G+L   G+ IY +DL+G + E+    L +P+ N PY GK+WCVVA  A+  
Sbjct  334  PGPGTERHWGLLSNTGSPIYEVDLTGTSHENN-TKLSEPSNNGPYNGKIWCVVASTASPD  392

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +AC QGN TC+ + PG  CY P S++ HASYAFSS+WAQFRS G +CYF GLA
Sbjct  393  DLGPALEFACRQGNGTCDQLAPGKECYEPISIVSHASYAFSSFWAQFRSAGASCYFGGLA  452

Query  247  VKTINDPSYGACKYPSITL  191
            V+TI DP +G+C++PS+ L
Sbjct  453  VQTITDPGHGSCEFPSVLL  471



>gb|KJB37880.1| hypothetical protein B456_006G224700 [Gossypium raimondii]
Length=462

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
             TGWP  GD+DQ+GA+IYN+ATYNRN+++K TSK  +G+P  PG++IPT I +LY+EN+K
Sbjct  264  RTGWPTAGDIDQVGANIYNAATYNRNLIRKMTSKQPLGSPKSPGLIIPTFISSLYDENRK  323

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GP TERH+G+L+ NGT +Y IDL+G    SE+ PLP    N PYKGK+WC VAP  N  
Sbjct  324  IGPETERHWGMLHTNGTPVYEIDLTGNRKISEYKPLPPAVNNVPYKGKLWCEVAPWVNEM  383

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            ++  ALS  C   N TC  + PG  CY P S++ HASYAFSSYWA+FRS G  C FNGLA
Sbjct  384  SLPAALSNVCSIDNETCAALAPGKDCYEPVSVVWHASYAFSSYWAKFRSQGAICSFNGLA  443

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS G C +PS+T+
Sbjct  444  RETTVDPSRGRCNFPSVTV  462



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 140/199 (70%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTP RPG  IPT +F+L+NENQK
Sbjct  282  ETGWPNSGDIDETGANILNAATYNRNLIKKMTANPPIGTPVRPGSPIPTFLFSLFNENQK  341

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG  P      LPKP+ N P+KG VWCV    A+  
Sbjct  342  PGSGTERHWGILNPDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEA  401

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACGQ N TC  + PG  CY P SL  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  402  ELQQALNFACGQSNATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLA  461

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    C +PS+TL
Sbjct  462  RETTTNPGNEHCTFPSVTL  480



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNDGDIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG+   S F  LPKP+ N P+KG VWCV    A+  
Sbjct  338  PGSGTERHWGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEA  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNERCKFPSVTL  476



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNDGDIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG+   S F  LPKP+ N P+KG VWCV    A+  
Sbjct  338  PGSGTERHWGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEA  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNERCKFPSVTL  476



>ref|XP_011651104.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
sativus]
Length=467

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GD++Q GA++ N+ATYNRN+VK+ T+K  VGTPARP VVIPT IF+L++ENQK
Sbjct  269  ETGWPTAGDMEQPGANLLNAATYNRNLVKRITAKPTVGTPARPKVVIPTFIFSLFDENQK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L 
Sbjct  329  PGSGTERHWGLLSSDGSPNYQIDLTGKESSVEYDPLPVVENNMPFRGRLWCVAARGVDLM  388

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +   +   CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA
Sbjct  389  ELGATVDDVCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLA  448

Query  247  VKTINDPSYGACKYPSITL  191
             +T  DPS G+C++PS+T 
Sbjct  449  EQTTTDPSNGSCRFPSVTF  467



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ +IGA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNSGDIHEIGANILNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG    S F  LPKP+ N P+KG VWCV    A+  
Sbjct  338  PGSGTERHWGILNPDGTPIYDIDFSGTRSVSSFGTLPKPSNNVPFKGNVWCVAVDGADEA  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGLALNFACGRNNETCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTINPGNERCKFPSVTL  476



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L+NEN+K
Sbjct  281  ETGWPNSGDIDETGANILNAATYNRNLIKKMTAIPPIGTPARPGLPIPTFVFSLFNENKK  340

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG++WCV    A   
Sbjct  341  SGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCVPVEGAKEA  400

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  ACG+ N TC  + PG  CY P S+  HA YA SSYWAQFR+    CYFNGLA
Sbjct  401  ELEEALRMACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNVGCYFNGLA  460

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  461  HETTTNPGNDRCKFPSVTL  479



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GD  Q GA++ N+A YNR++ ++  + VGTPARP   +P  +F+LYNEN KPG
Sbjct  275  ETGWPNAGDPGQAGANVRNAALYNRHLARRMHNNVGTPARPRSNMPVFVFSLYNENLKPG  334

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPA---ANL  431
             GTERH+G+ YPNGT +Y IDL+G+     +PPLP P  N+  K + WCV+A      N 
Sbjct  335  AGTERHWGMFYPNGTWVYQIDLTGRRTARSYPPLPPPD-NKTAKLE-WCVLAGGGKPVNE  392

Query  430  TAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
            TAVADAL+YAC QG  TC  IQPGGACY PN+L  HASYAF++YW QF+  GG+CYFNGL
Sbjct  393  TAVADALNYACQQGTGTCAAIQPGGACYEPNTLDAHASYAFNAYWQQFKGTGGSCYFNGL  452

Query  250  AVKTINDPSYGACKYPS  200
            AVKT  DPSYG+CK+PS
Sbjct  453  AVKTNKDPSYGSCKFPS  469



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA+I N+ATYNRN++KK T+   +GTP+RPG+ IPT +F+L+NENQK
Sbjct  280  ETGWPNSGDIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVFSLFNENQK  339

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+G  IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN++
Sbjct  340  SGSGTQRHWGILHPDGIPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVDGANVS  399

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + + L   C + N TC  + PG  CY P S+  HASYA SSYWAQFR+    CYFNGLA
Sbjct  400  ELEETLRTTCSRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNVQCYFNGLA  459

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  460  HETTTNPGNDRCKFPSVTL  478



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNDGDIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG    S F  LPKP+ N P+KG VWCV    A+  
Sbjct  338  PGSGTERHWGILNPDGTPIYDIDFSGTRSFSGFDSLPKPSNNVPFKGNVWCVAVDGADEA  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PGG CY P ++  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNERCKFPSVTL  476



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 141/199 (71%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GA++ N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNSGDIHETGANVLNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID +G  P S F  LPKP  N P+KG VWCV    A+  
Sbjct  338  PGSGTERHWGILNPDGTPIYEIDFTGTRPVSSFGELPKPDNNVPFKGNVWCVAIDGASEA  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALNFACGRSNETCAALAPGKECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNERCKFPSVTL  476



>ref|XP_004973968.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=389

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 143/200 (72%), Gaps = 10/200 (5%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  + GA++ N+ATYNRN+  + +   GTPARPG  +P  +F+LYNE+QKPG
Sbjct  191  ETGWPSAGDAGESGANVRNAATYNRNLAARMSKNPGTPARPGAKMPVFLFSLYNEDQKPG  250

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP--KPTTNQPYKGKVWCVVA----PA  440
            PGTERH+G+ YPN T +Y +DL+G+ P   +PPLP    T + P     WCV+A     A
Sbjct  251  PGTERHWGLYYPNQTRVYEVDLTGQRPSRSYPPLPPAGDTDSSP----AWCVLASGEGKA  306

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            AN TAV  AL YAC QG+ TC  IQPGGAC+ P++L  HASYAF+SYW QFR+ GGTC+F
Sbjct  307  ANETAVQAALEYACQQGSGTCAAIQPGGACHEPDTLDAHASYAFNSYWQQFRNAGGTCFF  366

Query  259  NGLAVKTINDPSYGACKYPS  200
            NGLA  T  DPS+G+CK+ S
Sbjct  367  NGLAEATTKDPSHGSCKFQS  386



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA++ N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  276  ETGWPNAGDIDETGANVPNAATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQK  335

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY ID SG    + F  +PKP+ N P+KG VWCVV   A+  
Sbjct  336  PGSGTERHWGILNPDGTRIYEIDFSGTRQVNSFGSMPKPSNNVPFKGNVWCVVVEGASEA  395

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  396  ELGQALEFACGRSNVTCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLA  455

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS++L
Sbjct  456  RETTTNPGNERCKFPSVSL  474



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   237 bits (605),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L++E+QK
Sbjct  282  ETGWPNSGDIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLAIPTFVFSLFDEDQK  341

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG VWCV    A+  
Sbjct  342  SGSGTQRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEA  401

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA
Sbjct  402  QLEEALRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLA  461

Query  247  VKTINDPSYGACKYPSITL  191
              T  +P    CK+P +TL
Sbjct  462  RMTTVNPGNDRCKFPGVTL  480



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L++ENQK
Sbjct  282  ETGWPNSGDIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLAIPTFVFSLFDENQK  341

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+GT IY ID +G+ P + F PLPKP  N PYKG VWCV    A+  
Sbjct  342  SGSGTQRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPKNNVPYKGIVWCVPVEGASEA  401

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA
Sbjct  402  QLEEALRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLA  461

Query  247  VKTINDPSYGACKYPSITL  191
              T  +P    CK+P +TL
Sbjct  462  RMTTINPGNDRCKFPGVTL  480



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+ GA++ N+ATYNRN++KK T+   +GTPARPG+ IPT +F+L++E+QK
Sbjct  282  ETGWPNSGDIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLSIPTFVFSLFDEDQK  341

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG VWCV    A+  
Sbjct  342  SGSGTQRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVPVVGASEA  401

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL  ACG+ N TC  + PG  CY P S+  HASYA SSYWA+FR+    CYFNGLA
Sbjct  402  QLEEALRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVRCYFNGLA  461

Query  247  VKTINDPSYGACKYPSITL  191
              T  +P    CK+P +TL
Sbjct  462  RMTTVNPGNDRCKFPGVTL  480



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (70%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNAGDIHETGANILNAATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A   
Sbjct  338  PGSGTERHWGILDHDGTPIYEIDFSGTRSVSSFDKLPKPSNNVPFKGNVWCVAVDGAGEA  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  398  ELGQALNFACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLA  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNERCKFPSVTL  476



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 144/203 (71%), Gaps = 7/203 (3%)
 Frame = -3

Query  778  TGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQKP  605
            TGWPN GD+D+IGAS+ N+ATYNRN++KK T+   +GTPARPG VIPT +F+L++EN+KP
Sbjct  287  TGWPNSGDIDEIGASVRNAATYNRNLIKKMTADPPIGTPARPGSVIPTFVFSLFDENRKP  346

Query  604  GPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP-----YKGKVWCVVAPA  440
            GPGTERH+G+L P+GT +Y ID +G+ P S + P  KP           K + WCVV   
Sbjct  347  GPGTERHWGILRPSGTPVYEIDFTGRKPVSGYGPPAKPGNGGVGVAPCKKRRAWCVVKEG  406

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            A++ A+  AL +ACG+ N TC+ + PG  CY P ++  HASYAFSSYWAQFRS    CYF
Sbjct  407  ADVAALGQALGFACGRSNETCSALAPGRECYQPVTITWHASYAFSSYWAQFRSQNARCYF  466

Query  259  NGLAVKTINDPSYGACKYPSITL  191
            NGLA +T  DP  G CK+PS+ L
Sbjct  467  NGLARETTVDPGNGRCKFPSVAL  489



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 144/195 (74%), Gaps = 4/195 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD++Q+GA+I+N+A YNR ++++  +   +GTP RP   IPT IF+L+NENQK
Sbjct  268  ETGWPNAGDLNQLGANIFNAAHYNRRIIRRMLADPPLGTPRRPNQFIPTYIFSLFNENQK  327

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             G GTERH+G+LYPNG+ +Y IDL+G+  +SE+ P   P    PYKGK+WCVV   AN++
Sbjct  328  TGLGTERHWGLLYPNGSRLYEIDLTGELQDSEYKP--LPPPPPPYKGKLWCVVDANANVS  385

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            A+  A++YAC QGN TC  IQPG  CY PN++I HASYAF+SYW QF++ GGTCYFNG A
Sbjct  386  ALPSAITYACSQGNNTCVAIQPGKPCYQPNTVIDHASYAFNSYWQQFKNSGGTCYFNGAA  445

Query  247  VKTINDPSYGACKYP  203
                 DPS   C+YP
Sbjct  446  TLVTKDPSSKICRYP  460



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 139/199 (70%), Gaps = 2/199 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNAGDILETGANILNAATYNRNLIKKLTANPPLGTPARRGAPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A   
Sbjct  338  PGSGTERHWGILNHDGTPIYEIDFSGTRSVSSFDKLPKPSNNVPFKGSVWCVAVDGAGEA  397

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGL+
Sbjct  398  ELGQALNFACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLS  457

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  458  RETTTNPGNERCKFPSVTL  476



>ref|NP_001168659.1| uncharacterized protein LOC100382447 [Zea mays]
 gb|ACN29077.1| unknown [Zea mays]
Length=384

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 144/196 (73%), Gaps = 11/196 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+GGD  + GA++ N+ATYNRN+  + ++  GTPARPG  +P  +F+LYNE++KPG
Sbjct  191  ETGWPSGGDAGEAGANVRNAATYNRNLALRMSNSPGTPARPGAEVPVFLFSLYNEDRKPG  250

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP----AAN  434
            PG+ERH+G+ YPNG+ +Y +DL+G+   S +PPLP   +        WCV+A     AAN
Sbjct  251  PGSERHWGLYYPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVLASGGGKAAN  303

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV+ A++YAC  G+RTC  IQPGGAC+ P++L  HASYAF++YW QFRS GGTC+F+G
Sbjct  304  ETAVSAAVAYACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRSAGGTCFFDG  363

Query  253  LAVKTINDPSYGACKY  206
            LA  T  DPS+G CK+
Sbjct  364  LAETTTEDPSHGLCKF  379



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+ + GA+I N+ATYNRN++KK T+   +GTPAR G  IPT +F+L+NENQK
Sbjct  278  ETGWPNAGDILETGANILNAATYNRNLIKKLTANPPLGTPARRGAPIPTFLFSLFNENQK  337

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L  +GT IY ID SG    S F  LPKP+ N P+KG VWCV    A   
Sbjct  338  PGSGTERHWGILNHDGTPIYEIDFSGTI--SSFDKLPKPSNNVPFKGNVWCVAVDGAGEA  395

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL++ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  396  ELGQALNFACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLA  455

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  456  RETTTNPGNERCKFPSVTL  474



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 144/196 (73%), Gaps = 11/196 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+GGD  + GA++ N+ATYNRN+  + ++  GTPARPG  +P  +F+LYNE++KPG
Sbjct  289  ETGWPSGGDAGEAGANVRNAATYNRNLALRMSNSPGTPARPGAEVPVFLFSLYNEDRKPG  348

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAP----AAN  434
            PG+ERH+G+ YPNG+ +Y +DL+G+   S +PPLP   +        WCV+A     AAN
Sbjct  349  PGSERHWGLYYPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVLASGGGKAAN  401

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAV+ A++YAC  G+RTC  IQPGGAC+ P++L  HASYAF++YW QFRS GGTC+F+G
Sbjct  402  ETAVSAAVAYACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRSAGGTCFFDG  461

Query  253  LAVKTINDPSYGACKY  206
            LA  T  DPS+G CK+
Sbjct  462  LAETTTEDPSHGLCKF  477



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 144/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQ GA++YN+A YNRN+V+K  +   +GTPARPG +IPT +F+LYNE+ K
Sbjct  276  ETGWPNEGDLDQPGANVYNAAIYNRNLVQKVLADPPLGTPARPGTIIPTFLFSLYNEDLK  335

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GP TERH+G+L P+GT +YPIDL+G   ++ F PL +P  N  YKGKVWCVV   AN+T
Sbjct  336  DGPKTERHWGLLKPDGTPVYPIDLTGA--QTNFGPLRQPENNMGYKGKVWCVVDKMANIT  393

Query  427  AVADALSYACGQGNRTCN-PIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGL  251
             +  AL   C + N TC   + PG  CY P S++ HAS+AF++YWA+FR  G  CYF GL
Sbjct  394  ELGPALRRTCSRLNETCELSLGPGKHCYEPVSVVWHASFAFNAYWAKFRDSGEICYFGGL  453

Query  250  AVKTINDPSYGACKYPSITL  191
            A  T  +PS+G+C +PS+T+
Sbjct  454  ASLTTRNPSHGSCHFPSVTI  473



>ref|XP_008669802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Zea 
mays]
 tpg|DAA38972.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=472

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP  GD+DQ GA++ N+ATYNRN+ ++  S  GTP RPGV +P ++FAL+NE+ K G
Sbjct  271  ETGWPTAGDLDQFGANVRNAATYNRNLARRLASGAGTPRRPGVPVPAMVFALFNEDLKWG  330

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAA-NLTA  425
            P TERH+G+ YPNG+ +Y +DL+G+ P + +PPLP  T +QPY+G +WCVV  A  N TA
Sbjct  331  PDTERHWGLFYPNGSAVYEVDLTGRRPLASYPPLPPATNDQPYRGPLWCVVRTAGINETA  390

Query  424  VADALSYACGQG---NRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
            V + ++  C      +  C+P++PGGAC+ PN++  HASY FS++W +F    G CYF+G
Sbjct  391  VREQVAAVCDDDEAEDALCDPVRPGGACFLPNTVAAHASYVFSAHWNRFSEDYGACYFDG  450

Query  253  LAVKTINDPSYGACKYPSITL  191
              ++T  DPS+G+CK+PSI L
Sbjct  451  WGMETTIDPSHGSCKFPSIHL  471



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVV-IPTLIFALYNENQKP  605
            ETGWPN GD+DQ GA++ N+ATYNRNV +   S  GTP RPG++ +P  +FAL+NE+ K 
Sbjct  273  ETGWPNAGDLDQFGANVRNAATYNRNVARHLASGAGTPRRPGMMRMPAFVFALFNEDLKG  332

Query  604  GPGTERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            GPGTERH+G+ YPN + +Y +DLSG+ T  S +PPLP  T + PY GK+WC+    AN T
Sbjct  333  GPGTERHWGLFYPNSSAVYEVDLSGRRTAASSYPPLPPATNDAPYPGKLWCMTKKLANGT  392

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQF-RSLGGTCYFNGL  251
            AV + ++ AC      C+P++PGG C+ P+++  HASY FS++W +F +  GG CYF GL
Sbjct  393  AVREQVAAACKDEAALCDPVRPGGRCHLPDTVAAHASYVFSAHWNRFSKQYGGWCYFAGL  452

Query  250  AVKTINDPSYGACKYPSI  197
            AV+T  DPS+G+C+YPS+
Sbjct  453  AVETTIDPSHGSCRYPSV  470



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GD++Q GA++ N+ATYNRN+VK+ T+K  VGTPARP VVIPT IF+L++ENQK
Sbjct  269  ETGWPTAGDMEQPGANLLNAATYNRNLVKRITAKPTVGTPARPKVVIPTFIFSLFDENQK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L  +G+  Y IDL+GK    E+ PLP    N P++G++WCV A   +L 
Sbjct  329  PGSGTERHWGLLSSDGSPNYQIDLTGKESSVEYDPLPVVENNMPFRGRLWCVAARGVDLM  388

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +   +   CG+G+ TC  + PG  CY P S+  HASYAFSSYW++FRS G +CYFNGLA
Sbjct  389  ELGATVDDVCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQGASCYFNGLA  448

Query  247  VKTINDPS  224
             +T  DP+
Sbjct  449  EQTTTDPN  456



>emb|CBI39414.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = -3

Query  703  VVKKFTSK--VGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSG  530
            ++   T+K  VGTPARPG+ IPT IFALYNENQK GPGTERH+G+L  NG  +Y +DL+G
Sbjct  204  MLDSMTAKPAVGTPARPGMTIPTFIFALYNENQKRGPGTERHWGLLDCNGKPVYGVDLTG  263

Query  529  KTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGAC  350
            +  ES    LP P  N+PY+GK+WCVVA   N   +  AL YAC QGN TC+ + PG  C
Sbjct  264  EL-ESNDDQLPMPQNNKPYQGKIWCVVASEVNPEQLVSALIYACSQGNGTCDALMPGKEC  322

Query  349  YNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVKTINDPSYGACKYPSITL  191
            Y P SL+ HASYAFSSYWA+FRSLG  CYFNGLAV+T  DPS G+CK+P++TL
Sbjct  323  YEPFSLLSHASYAFSSYWAKFRSLGANCYFNGLAVQTTEDPSRGSCKFPTVTL  375



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 129/169 (76%), Gaps = 2/169 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+D+IGA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+K
Sbjct  228  ETGWPNSGDIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVFSLFNENKK  287

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV    AN T
Sbjct  288  PGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANET  347

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  281
             + +AL  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS
Sbjct  348  ELEEALRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRS  396



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 128/169 (76%), Gaps = 2/169 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD+D+ GA+++N+ATYNRN++KK T+   +GTPARPG  IPT +F+L+NEN+K
Sbjct  228  ETGWPHSGDIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVFSLFNENKK  287

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GT+RH+G+L+P+GT IY ID +G+ P + F PLPKPT N PYKG+VWCV+   AN  
Sbjct  288  PGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEA  347

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  281
             + +AL  AC + N TC  + PG  CY P S+  HASYA +SYWAQFRS
Sbjct  348  ELEEALRMACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRS  396



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GD+DQ GA+  N+ATYNRN+ +   S  GTP RPG+ +P  +FAL+NE+ K G
Sbjct  274  ETGWPNAGDLDQFGANARNAATYNRNMARHLASGAGTPRRPGMRMPAFVFALFNEDLKTG  333

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLT  428
            P TERH+G+ +PNG+ +Y +DL+G+ P + +PPLP P TN  PY GK+WCVV A AAN T
Sbjct  334  PATERHWGLFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGKLWCVVGAAAANET  393

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGL  251
            AV + +  AC      C P++ GG CY PN++  HASY FS++W +F  + GG CYF GL
Sbjct  394  AVREQMEAACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGL  453

Query  250  AVKTINDPSYGACKYPSIT  194
            A++T  DPS+G+CK+PS+T
Sbjct  454  AMETTTDPSHGSCKFPSVT  472



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GD+DQ GA+  N+ATYNRN+ +   S  GTP RPG+ +P  +FAL+NE+ K G
Sbjct  274  ETGWPNAGDLDQFGANARNAATYNRNMARHLASGAGTPRRPGMRMPAFVFALFNEDLKTG  333

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLT  428
            P TERH+G+ +PNG+ +Y +DL+G+ P + +PPLP P TN  PY GK+WCVV A AAN T
Sbjct  334  PATERHWGLFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGKLWCVVGAAAANET  393

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGL  251
            AV + +  AC      C P++ GG CY PN++  HASY FS++W +F  + GG CYF GL
Sbjct  394  AVREQMEAACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGL  453

Query  250  AVKTINDPSYGACKYPSIT  194
            A++T  DPS+G+CK+PS+T
Sbjct  454  AMETTTDPSHGSCKFPSVT  472



>ref|XP_001777261.1| predicted protein [Physcomitrella patens]
 gb|EDQ57916.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 138/208 (66%), Gaps = 14/208 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKF--TSKVGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD +Q+G ++ N+ATYNR +V+K   TSKVGTP +PGV IPT IFAL+NENQK
Sbjct  245  ETGWPSAGDANQLGCNLANAATYNRRLVRKMVSTSKVGTPLKPGVYIPTFIFALFNENQK  304

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPK------------PTTNQPYKGK  464
             G GTE+H+G+LYPNGTN+Y ID++G   + ++ PL              P  N P    
Sbjct  305  TGQGTEKHWGLLYPNGTNVYSIDMTGTLSDGQYTPLSDNPIFTTAPPPTLPPGNVPSTTG  364

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
             WCV  P  N   +  AL +ACG G   C P+Q GG+CYNP++++ H+SYAF+SY+ + +
Sbjct  365  TWCVAKPGMNPPMLQAALDFACGPGGADCQPLQVGGSCYNPDTILDHSSYAFNSYYQRTK  424

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
            + GG+C F G A  T  DPS+  CK+P+
Sbjct  425  AAGGSCNFGGAATLTTTDPSHDTCKFPT  452



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 144/198 (73%), Gaps = 10/198 (5%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+GGD  + GA++ N+ATYNRN+  + +   GTPARPG  +P  +F+LYNE+QKPG
Sbjct  290  ETGWPSGGDAGEAGANVRNAATYNRNLAARMSKNPGTPARPGAKVPVFLFSLYNEDQKPG  349

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP--KPTTNQPYKGKVWCVVAP--AAN  434
             G+ERH+G+ YPNG+ +Y +DL+G+   S +PPLP    T + P     WCV+    AAN
Sbjct  350  AGSERHWGLYYPNGSRVYEVDLTGR--RSSYPPLPPADDTDSAP----AWCVLGSKAAAN  403

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             TAVA A++YAC QG+ TC  IQPGGAC+ P+ +  HASYAF++YW QFR  GGTC+F+G
Sbjct  404  ETAVAAAVAYACQQGSGTCAAIQPGGACHEPDMMDAHASYAFNAYWQQFRGAGGTCFFDG  463

Query  253  LAVKTINDPSYGACKYPS  200
            LAV T  DPS+G+CK+ S
Sbjct  464  LAVTTTKDPSHGSCKFAS  481



>dbj|BAE80092.1| glycosyl hydrolase family 17 [Silene latifolia]
Length=439

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 128/177 (72%), Gaps = 5/177 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD+DQ GA++YN+ATYNRN++KK  ++  +GTPARPG +IP  +F+LY+EN K
Sbjct  265  ETGWPSKGDLDQPGANVYNAATYNRNLIKKIVAEPPLGTPARPGTIIPAFLFSLYDENLK  324

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GP TERH+G++ PNGT +Y IDL+G   ++EF PLP  T N PYKG+VWCVV  +AN+T
Sbjct  325  DGPETERHWGLVKPNGTPVYQIDLTGT--QTEFDPLPNATNNMPYKGEVWCVVQRSANMT  382

Query  427  AVADALSYACGQGNRTCN-PIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
             +   ++  C + N TC   I PG  CY P S++ HASY FS+YWAQFR  G  C F
Sbjct  383  ELGSMVTNLCSRLNGTCEAAIGPGNDCYQPVSILWHASYTFSAYWAQFRRHGTYCQF  439



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWPN GD+DQ GA+IYN+ATYNRN++KK T+K  +GTPARPGVVIPT IF+LYNEN+K
Sbjct  269  ETGWPNAGDLDQPGANIYNAATYNRNLIKKMTAKPPIGTPARPGVVIPTFIFSLYNENRK  328

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
             GPGTERH+G+L  NGT IY IDLSGK  +SE+  LP+P  N+PYKGK+WC+ A  A+LT
Sbjct  329  TGPGTERHWGLLNANGTAIYEIDLSGKQADSEYRALPQPNNNKPYKGKLWCIAAQGADLT  388

Query  427  AVADALSYACGQGNRTCNPIQPGGAC  350
             +  A+++AC QGN TC+ + PGG  
Sbjct  389  ELGTAVTFACSQGNGTCDALAPGGKV  414



>ref|XP_001780045.1| predicted protein [Physcomitrella patens]
 gb|EDQ55148.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 134/207 (65%), Gaps = 14/207 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTS--KVGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GD +Q G ++ N+ATYNR +V+K  S   VGTP RPGV IPT IFAL+NE+QK
Sbjct  245  ETGWPTAGDANQAGCNLANAATYNRRLVRKMVSPTNVGTPMRPGVYIPTFIFALFNEDQK  304

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPL---------PKPTTN---QPYKGK  464
             G GTE+H+G+LYPNGTN+Y ID++G   + ++ PL         P PT +    P    
Sbjct  305  TGQGTEKHWGLLYPNGTNVYSIDMTGMLSDGQYSPLSDNPVFTSAPPPTFSPGLVPSTSG  364

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
             WCV         +  AL +ACG G   C P+Q GG+C+NPN++  H+SYAF+SY+ + +
Sbjct  365  TWCVAKSGIGQEMLQGALDFACGAGGADCQPLQAGGSCFNPNTIHDHSSYAFNSYYQKTK  424

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYP  203
            + GG+C F G A+ +  DPS+G CK+P
Sbjct  425  AAGGSCNFGGAAMLSTTDPSHGTCKFP  451



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 135/202 (67%), Gaps = 5/202 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARP-GVVIPTLIFALYNENQKP  605
            ETGWP  GD+DQ GA++ N+ATYNRN+ +   S  GTP RP   V P ++FAL+NE+ K 
Sbjct  281  ETGWPTAGDLDQFGANVRNAATYNRNLARHLASGAGTPRRPRARVAPAMVFALFNEDLKW  340

Query  604  GPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTN-QPYKGKVWCVVAPA---A  437
            GPGTERH+G+ YPNG+ +Y +DL+G+       P   P +N +PY G +WCVVA      
Sbjct  341  GPGTERHWGLFYPNGSAVYEVDLTGRRRSLPSYPPLPPASNDRPYPGPLWCVVATDKGPV  400

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N TAV   ++ AC      C+P++PGGAC+ P+++  HASY FS++W +F    G CYF 
Sbjct  401  NETAVRAQVAAACADVPGLCDPVRPGGACFLPDTVSAHASYVFSAHWNRFSEDYGGCYFA  460

Query  256  GLAVKTINDPSYGACKYPSITL  191
            G AV+T  DPS+G+CK+PSI L
Sbjct  461  GFAVETTVDPSHGSCKFPSILL  482



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 131/198 (66%), Gaps = 9/198 (5%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPNGG     GAS+ N+A YNRN+  +  +  GTP RPG  +P  +F+LYNE++KPG
Sbjct  287  ETGWPNGGGP---GASVGNAAIYNRNLAARMATSPGTPLRPGEKMPVFVFSLYNEDKKPG  343

Query  601  PGTERHFGVLYPNGTNIYPIDLSGK------TPESEFPPLPKPTTNQPYKGKVWCVVAPA  440
             GTERH+G+ YPNGT +Y +DL G+       P     P P    + P +  +WCV+ P 
Sbjct  344  AGTERHWGLFYPNGTAVYQVDLGGRRRSYPPLPSPPPSPSPSTPPSPPAEQGLWCVLLPG  403

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
             +  AVA AL+YACGQG+ TC  IQPG  C+ PN+L  HASYAF+SYW QFR  G +C F
Sbjct  404  KDEKAVAAALNYACGQGSGTCAAIQPGAVCFEPNTLDAHASYAFNSYWQQFRKSGASCSF  463

Query  259  NGLAVKTINDPSYGACKY  206
            NGLA  T  DPS+G+CK+
Sbjct  464  NGLATTTTTDPSHGSCKF  481


 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -3

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
            VWCV+AP  +  AV  AL+YACGQG  TC  IQPGGAC+ PN+L  HASYAF+SYW QFR
Sbjct  500  VWCVLAPGKDEKAVEAALNYACGQGQGTCAAIQPGGACFEPNTLDAHASYAFNSYWQQFR  559

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
              GG+C FNGLAV T  DPS+G+CK+PS
Sbjct  560  KTGGSCSFNGLAVTTTADPSHGSCKFPS  587



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP  GD D++GA+++N+ATYNRN+  +     GTPARPG  IP  +F+LYNEN+KPG
Sbjct  277  ETGWPTAGDADELGANVHNAATYNRNLAARMAKNPGTPARPGAEIPVFLFSLYNENRKPG  336

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVA----PAA  437
            PGTERH+G+ YPN T +Y +DL+G+ P + +PPL          G  VWCV+A     AA
Sbjct  337  PGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAA  396

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N TAVA A+ YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFN
Sbjct  397  NETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFN  456

Query  256  GLAVKTINDPS  224
            GLA KT  DPS
Sbjct  457  GLAEKTTIDPS  467



>emb|CAK18899.1| glucan 1,3-beta glucosidase [Cocos nucifera]
Length=179

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -3

Query  598  GTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVA---PAANLT  428
            GTERH+G+LYPN T +Y +DL+G+ P++ + PLP P  N+PYKGK+WCV      + N T
Sbjct  4    GTERHWGLLYPNATRVYEVDLTGRLPDAGYGPLPPPGNNKPYKGKIWCVFGRRGKSVNAT  63

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
            AV  A+SYACGQG  TC+ IQPGG CY P+SL  HASYAF+SYW QFR  GGTCYFNGLA
Sbjct  64   AVGSAISYACGQGKGTCDAIQPGGPCYRPDSLTAHASYAFNSYWQQFRRSGGTCYFNGLA  123

Query  247  VKTINDPSYGACKYPSI  197
            V+   DPSYG+CK+PSI
Sbjct  124  VQAAQDPSYGSCKFPSI  140



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP  GD D++GA+++N+ATYNRN+  +     GTPARPG  IP  +F+LYNEN+KPG
Sbjct  277  ETGWPTAGDADELGANVHNAATYNRNLAARMAKNPGTPARPGAEIPVFLFSLYNENRKPG  336

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVA----PAA  437
            PGTERH+G+ YPN T +Y +DL+G+ P + +PPL          G  VWCV+A     AA
Sbjct  337  PGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAA  396

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N TAVA A+ YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFN
Sbjct  397  NETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFN  456

Query  256  GLAVKTINDPS  224
            GLA KT  DP+
Sbjct  457  GLAEKTTIDPT  467



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 124/199 (62%), Gaps = 43/199 (22%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP                      +KK T++  VGTPARP   +   IFAL+NENQK
Sbjct  261  ETGWP----------------------IKKLTARPPVGTPARPRRAMQGFIFALFNENQK  298

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PGP TERHFG+LYPNG+ +Y IDL GKT  S + PLP+PT N+ YKG ++          
Sbjct  299  PGPTTERHFGLLYPNGSKVYQIDLRGKTTSSGYEPLPEPTNNKQYKGPMY----------  348

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
                     C QGN TC  I+PG AC+NP+  + HA+YAFSSYWA+FR+ G +C+ NGLA
Sbjct  349  ---------CSQGNNTCEAIRPGKACHNPDLSLFHANYAFSSYWAEFRNSGASCFLNGLA  399

Query  247  VKTINDPSYGACKYPSITL  191
             +TI DPS+G+CK+PS+ L
Sbjct  400  TQTIKDPSHGSCKFPSVAL  418



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 133/193 (69%), Gaps = 5/193 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP  GD D++GA+++N+ATYNRN+  +     GTPARPG  IP  +F+LYNEN+KPG
Sbjct  277  ETGWPTAGDADELGANVHNAATYNRNLAARMAKNPGTPARPGAEIPVFLFSLYNENRKPG  336

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGK-VWCVVA----PAA  437
            PGTERH+G+ YPN T +Y +DL+G+ P + +PPL          G  VWCV+A     AA
Sbjct  337  PGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVLAGGGGEAA  396

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            N TAVA A+ YAC Q + TC  I+ GG C  P++L  HASYAF++YW  FR  GGTCYFN
Sbjct  397  NETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRKAGGTCYFN  456

Query  256  GLAVKTINDPSYG  218
            GLA KT  DP++ 
Sbjct  457  GLAEKTTIDPTFA  469



>ref|XP_001784285.1| predicted protein [Physcomitrella patens]
 gb|EDQ50891.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 134/199 (67%), Gaps = 6/199 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKF--TSKVGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GDV+Q GA++ N+A YNR +V K   T+ VGTPARPGV+IPT IF+L+NEN K
Sbjct  238  ETGWPTAGDVNQTGATVDNAALYNRRLVLKVLSTTHVGTPARPGVIIPTYIFSLFNENLK  297

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPP----LPKPTTNQPYKGKVWCVVAPA  440
            PG G+ER++G+LYP+ T +Y +DL+G+  + ++ P       P++        WCV + A
Sbjct  298  PGVGSERNWGLLYPDLTPVYAVDLTGQLLDHQYAPNSVSTGPPSSPSSAGSGSWCVSSAA  357

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
            A+   + + L+YAC      C  +QPG +C+ PN++  HAS+AF+SYW ++RS GG+C F
Sbjct  358  ADPVTLENGLNYACNANEEFCAALQPGQSCHLPNTVASHASWAFNSYWQKYRSAGGSCSF  417

Query  259  NGLAVKTINDPSYGACKYP  203
            +G A  T  DPS+G C +P
Sbjct  418  DGAATLTSIDPSFGTCLFP  436



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 122/198 (62%), Gaps = 8/198 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GD ++ GA+  N+ATYNR +V+K     GTP RP   I T IFALYNEN KPG
Sbjct  269  ETGWPNAGDENERGATRSNAATYNRRLVRKVIEGRGTPKRPNSAIATFIFALYNENLKPG  328

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTT----NQPYKGKVWCVVAPAAN  434
            PGTERH+G+LYP+G  +Y IDL+G+  +S++  +P+P +    N       WCV  P A+
Sbjct  329  PGTERHWGLLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAVVNSSSSSSSWCVARPDAD  388

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             +++   L   C Q    C  IQ G +C+ PN++I HASYAF+  W +       C F+ 
Sbjct  389  TSSLQRELDRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAFNRRWIR----ENQCSFSS  444

Query  253  LAVKTINDPSYGACKYPS  200
             A  T  +PSYG+C +PS
Sbjct  445  TAALTKINPSYGSCIFPS  462



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A+YN N+VK+  S  GTP +P   +   +FAL+NENQK G
Sbjct  263  ETGWPSAGDSNEIGASPDNAASYNGNLVKRVLSGSGTPLKPNESLDVFLFALFNENQKTG  322

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTP-----ESEFPPLPKPTTNQPYKGKVWCVVAPAA  437
            P +ER++G+ YP+   +Y I L+ + P     +S+ P     TT+   KG+ WCV    +
Sbjct  323  PTSERNYGLFYPSQKKVYDIQLTAEAPPSGVGKSQVPVSGDVTTSS--KGQTWCVANGGS  380

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
            +   + +AL+YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTCYF 
Sbjct  381  SEKKLQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARASGTCYFG  440

Query  256  GLAVKTINDPSYGACKYPS  200
            G A      P YG C++P+
Sbjct  441  GTAYVVTQPPKYGNCEFPT  459



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 121/198 (61%), Gaps = 8/198 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWPN GD ++ GA+  N+ATYNR +V+K     GTP RP   I T IFALYNEN KPG
Sbjct  269  ETGWPNAGDENERGATRSNAATYNRRLVRKVVEGRGTPKRPNSAIETFIFALYNENLKPG  328

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTT----NQPYKGKVWCVVAPAAN  434
            PG ERH+G+LYP+G  +Y IDL+G+  +S++  +P+P +    N       WCV  P A+
Sbjct  329  PGIERHWGLLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAVVNSSSSSSSWCVARPDAD  388

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
             +++   L   C Q    C  IQ G +C+ PN++I HASYAF+  W +       C F+ 
Sbjct  389  TSSLQRELDRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAFNRRWIR----ENQCSFSS  444

Query  253  LAVKTINDPSYGACKYPS  200
             A  T  +PSYG+C +PS
Sbjct  445  TAALTKINPSYGSCIFPS  462



>gb|KHG21190.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=470

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 125/206 (61%), Gaps = 13/206 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  ++GAS  N+A YN N+V++  +  GTP RP   +   IFAL+NENQKPG
Sbjct  264  ETGWPSAGDAGEVGASQDNAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPG  323

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVW  458
            P +ER++G+ YPN   +Y I LS K       P P    NQ               G+ W
Sbjct  324  PTSERNYGLFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNGGGVSKATSGQTW  382

Query  457  CVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL  278
            C+ +P A    + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   +
Sbjct  383  CMASPNAEAEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARV  442

Query  277  GGTCYFNGLAVKTINDPSYGACKYPS  200
             G+C+F+G A  +   PS+G C++P+
Sbjct  443  SGSCFFSGTAYVSTQRPSFGNCQFPT  468



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 127/208 (61%), Gaps = 19/208 (9%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK------VGTPARPGVVIPTLIFALYN  620
            ETGWP+ G V   GAS+ N+A YNR +V +   K       GTP RPG +I T IFAL+N
Sbjct  243  ETGWPSRGSV---GASLANAADYNRRLVLRILGKNRKNKNHGTPRRPGRLIDTYIFALFN  299

Query  619  ENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKP----TTNQPYKGKVWCV  452
            E+QKPG  TER++G+LYPNG+ +Y IDL+GKTP    P    P    T N   +G+ WCV
Sbjct  300  EDQKPGAATERNWGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSRQGQ-WCV  358

Query  451  V-APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLG  275
              A   +   V DA+ YACG G   C  IQPG ACY PN +  HASYAF+SYW + +  G
Sbjct  359  AKADYVSTADVQDAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYWQKMKRSG  418

Query  274  GTCYFNGLAVKTINDPSYGACKYPSITL  191
            GTC FNG A  T  DPS    K+ S +L
Sbjct  419  GTCAFNGFAKLTSVDPS----KFRSFSL  442



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 127/208 (61%), Gaps = 19/208 (9%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK------VGTPARPGVVIPTLIFALYN  620
            ETGWP+ G V   GAS+ N+A YNR +V +   K       GTP RPG +I T IFAL+N
Sbjct  243  ETGWPSRGSV---GASLANAADYNRRLVLRILGKNRKNKNHGTPRRPGRLIDTYIFALFN  299

Query  619  ENQKPGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKP----TTNQPYKGKVWCV  452
            E+QKPG  TER++G+LYPNG+ +Y IDL+GKTP    P    P    T N   +G+ WCV
Sbjct  300  EDQKPGAATERNWGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSRQGQ-WCV  358

Query  451  V-APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLG  275
              A   +   V DA+ YACG G   C  IQPG ACY PN +  HASYAF+SYW + +  G
Sbjct  359  AKADYVSTADVQDAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYWQKMKRSG  418

Query  274  GTCYFNGLAVKTINDPSYGACKYPSITL  191
            GTC FNG A  T  DPS    K+ S +L
Sbjct  419  GTCAFNGFAKLTSVDPS----KFRSFSL  442



>gb|KJB13749.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
 gb|KJB13750.1| hypothetical protein B456_002G092600 [Gossypium raimondii]
Length=470

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 125/206 (61%), Gaps = 13/206 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  ++GAS  N+A YN N+V++  +  GTP RP   +   IFAL+NENQKPG
Sbjct  264  ETGWPSAGDAAEVGASQDNAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPG  323

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVW  458
            P +ER++G+ YPN   +Y I LS K       P P    NQ               G+ W
Sbjct  324  PTSERNYGLFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNWGGVSKATSGQTW  382

Query  457  CVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL  278
            C+ +P A    + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   +
Sbjct  383  CMASPNAEAEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARV  442

Query  277  GGTCYFNGLAVKTINDPSYGACKYPS  200
             G+C+F+G A  +   PS+G C++P+
Sbjct  443  SGSCFFSGTAYVSTQPPSFGNCQFPT  468



>gb|EEC76518.1| hypothetical protein OsI_14304 [Oryza sativa Indica Group]
Length=175

 Score =   173 bits (438),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = -3

Query  703  VVKKFTSKVGTPARPGVVIPTLIFALYNENQKPGPGTERHFGVLYPNGTNIYPIDLSGKT  524
            + +   S  GTP RPG+ +P  +FAL+NE+ K GP TERH+G+ +PNG+ +Y +DL+G+ 
Sbjct  1    MARHLASGAGTPRRPGMRMPAFVFALFNEDLKTGPATERHWGLFHPNGSAVYEVDLTGRR  60

Query  523  PESEFPPLPKPTTNQ-PYKGKVWCVV-APAANLTAVADALSYACGQGNRTCNPIQPGGAC  350
            P + +PPLP P TN  PY GK+WCVV A AAN TAV + +  AC      C P++ GG C
Sbjct  61   PPASYPPLPPPATNDAPYPGKLWCVVGAAAANETAVREQMEAACADEAALCAPVRAGGEC  120

Query  349  YNPNSLIRHASYAFSSYWAQFRSL-GGTCYFNGLAVKTINDPSYGACKYPSIT  194
            Y PN++  HASY FS++W +F  + GG CYF GLA++T  DPS+G+CK+PS+T
Sbjct  121  YLPNTVAAHASYVFSAHWNKFSKVYGGWCYFAGLAMETTTDPSHGSCKFPSVT  173



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 128/203 (63%), Gaps = 9/203 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+IGAS  N+A+YN N+V+K  +  GTP RP   +   +FAL+NEN+KPG
Sbjct  265  ETGWPSMGDEDEIGASESNAASYNGNLVRKVLTGNGTPLRPQDPLNVYLFALFNENKKPG  324

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVV  449
            P +ER++G+ YPN   +Y I L+ +  ++ +  P+   T+  P  G+V        WCV 
Sbjct  325  PTSERNYGLFYPNEQKVYNIPLTKEEAKTGQSTPVNSNTSQVPVAGEVSKAKVGQTWCVA  384

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
               A+   +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +   + GT
Sbjct  385  NGKADEKKLQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRVTGT  444

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F G A      P+YG+C++P+
Sbjct  445  CEFGGAAYVVSQRPTYGSCEFPT  467



>gb|KJB62900.1| hypothetical protein B456_009G442700 [Gossypium raimondii]
Length=469

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 126/203 (62%), Gaps = 9/203 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+ GAS  N+A+YN N+V+K  +  GTP RP   +   +FAL+NENQKPG
Sbjct  265  ETGWPSMGDQDEKGASESNAASYNGNLVRKVLTGNGTPLRPQDPLNVYLFALFNENQKPG  324

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPES-EFPPL-----PKPTTNQPYKGKV---WCVV  449
            P +ER++G+ YPN   +Y I L+ +  ++ E  P+     P P   +  K KV   WCV 
Sbjct  325  PTSERNYGLFYPNEQKVYTIPLTKEEVKTGESTPVNTNTSPAPVAGEVSKAKVGQTWCVA  384

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
               A+   +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +     GT
Sbjct  385  NEKADEKKLQAALDYACGEGEADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRATGT  444

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F+G A      P+YG C++P+
Sbjct  445  CEFDGAAYVVTQRPTYGNCEFPT  467



>ref|XP_006595830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 126/211 (60%), Gaps = 17/211 (8%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPG
Sbjct  259  ETGWPSKGDSNEVGASVENAAAYNGNLVRKILTAAGTPLRPKADLTVYLFALFNENQKPG  318

Query  601  PGTERHFGVLYPNGTNIYPIDLS----------------GKTPESEFP-PLPKPTTNQPY  473
            P +ER+FG+ YP+   +Y + L+                G   + E P P+     ++  
Sbjct  319  PTSERNFGLFYPDERRVYNVPLTVEELKDYHDRPSAPVNGGGQKKETPAPVVSGGVSKST  378

Query  472  KGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWA  293
             G  WCV  P A+   +  AL +ACG+G   C PIQ G  CY+PN+L+ HAS+AF+SY+ 
Sbjct  379  TGNTWCVANPDADKVKLQAALDFACGEGGSDCGPIQRGATCYDPNTLVAHASFAFNSYYQ  438

Query  292  QFRSLGGTCYFNGLAVKTINDPSYGACKYPS  200
            +    GG+CYF G +     +P YG+C++P+
Sbjct  439  KQSRKGGSCYFGGTSYVVTQEPRYGSCEFPT  469



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 126/203 (62%), Gaps = 9/203 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+IGA+  N+A+YN N+V+K  +  GTP RP   +   +FAL+NENQKPG
Sbjct  265  ETGWPSMGDEDEIGANESNAASYNGNLVRKVLTGNGTPLRPQDPLNVYLFALFNENQKPG  324

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVV  449
            P +ER++G+ YPN   +Y I L+ +  ++ E  P+   T+  P  G+V        WCV 
Sbjct  325  PTSERNYGLFYPNEQKVYNIPLTKEEAKTGESTPVNSNTSQVPVAGEVSKAKVGQTWCVA  384

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
               A+   +  AL YACG+G   C+PIQPG  CYNPN+L  HASYAF+SY+ +     GT
Sbjct  385  NGKADEKKLQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNSYYQKNTRATGT  444

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F G A      P+YG C++P+
Sbjct  445  CEFGGAAYVVSQRPTYGNCEFPT  467



>ref|XP_004491104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Cicer arietinum]
Length=475

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 128/213 (60%), Gaps = 20/213 (9%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPG
Sbjct  262  ETGWPSKGDNNEVGASVENAAAYNGNLVRKILTGSGTPLRPKADLTVYLFALFNENQKPG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPT------TNQPY-----------  473
            P +ER+FG+ YP+   +Y I L+ +  ++ +   P P       TNQP            
Sbjct  322  PTSERNFGLFYPSEEKVYDIPLTVEALKN-YHDNPSPVAPVSGNTNQPTPAVSPVGGVSK  380

Query  472  --KGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSY  299
               G  WCV  P A+   +  AL +ACG+G   C  IQPG  CYNPN+L+ HAS+AF+SY
Sbjct  381  STTGDTWCVANPDADKNKLQLALDFACGEGGADCRTIQPGATCYNPNTLVAHASFAFNSY  440

Query  298  WAQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  200
            + +    GG+C+F G +     +P YG+C++P+
Sbjct  441  YQKQARAGGSCFFGGTSYVVTQEPKYGSCEFPT  473



>ref|XP_006575581.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=472

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 126/212 (59%), Gaps = 18/212 (8%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPG
Sbjct  259  ETGWPSKGDSNEVGASVDNAAAYNGNLVRKILTAGGTPLRPKADLIVFLFALFNENQKPG  318

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTP--------------ESEFPPLPKPTTN----QP  476
            P +ER+FG+ YP+   +Y + L+ +                + +  P P P  +    + 
Sbjct  319  PTSERNFGLFYPDERRVYNVPLTTEELKDYHDRPAPVSGGGQQKGTPAPAPVVSGGVSKS  378

Query  475  YKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYW  296
              G  WCV  P A+   +  AL +ACG+G   C PIQ G  CY+PN+L+ HAS+AF+SY+
Sbjct  379  TTGNTWCVANPDADKVKLQAALDFACGEGGADCRPIQRGSTCYDPNTLVAHASFAFNSYY  438

Query  295  AQFRSLGGTCYFNGLAVKTINDPSYGACKYPS  200
             +    GG+CYF G +     +P YG+C++P+
Sbjct  439  QKQSRKGGSCYFGGTSYVVTQEPKYGSCEFPT  470



>ref|XP_001781801.1| predicted protein [Physcomitrella patens]
 gb|EDQ53355.1| predicted protein, partial [Physcomitrella patens]
Length=450

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 127/188 (68%), Gaps = 3/188 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKF--TSKVGTPARPGVVIPTLIFALYNENQK  608
            ETGWP+ GD  ++ A+I N+A YNR +V+K   T+++GTPARPGV IPT IFAL+NEN K
Sbjct  239  ETGWPSAGDSTEVAATIDNAANYNRRLVRKILSTTQIGTPARPGVFIPTYIFALFNENLK  298

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG  +ER++G+L+PN + +Y IDL+G+  +S++ P    +  Q   G  WC+    ++  
Sbjct  299  PGVSSERNWGLLHPNLSPVYAIDLTGQIYDSQYSPNSNSSPLQTGSGT-WCISNENSDPV  357

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + + L++ACG     C  IQP  +CY P++++ HA++AF++YW +++  GG+C F+G  
Sbjct  358  TLENGLNFACGADVEFCKAIQPSASCYLPSTIVSHAAWAFNNYWQKYKGAGGSCSFSGAG  417

Query  247  VKTINDPS  224
            V T  DPS
Sbjct  418  VLTSTDPS  425



>ref|XP_003616906.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES99864.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=470

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 126/207 (61%), Gaps = 14/207 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPG
Sbjct  263  ETGWPSKGDGNEVGASVENAAAYNANLVRKILTSKGTPLRPKADLTVFLFALFNENQKPG  322

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTT-------------NQPYKGKV  461
            P +ER+FG+ YP+   +Y + L+ +  ++ +   P P +             ++   G  
Sbjct  323  PTSERNFGLFYPDEKKVYNVPLTVEALKN-YHDDPSPASPVSGGGGSGGGGVSKSTTGNT  381

Query  460  WCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  281
            WCV  P A+   + DAL +ACG+G   C PIQ    C++PN+L+ HAS+AF+SY+ +   
Sbjct  382  WCVANPYADKNKLQDALDFACGEGGADCRPIQNNATCFDPNTLVAHASFAFNSYYQKQAR  441

Query  280  LGGTCYFNGLAVKTINDPSYGACKYPS  200
             GG+CYF G +     +P YG C++P+
Sbjct  442  AGGSCYFGGTSYVVTQEPKYGKCEFPT  468



>emb|CAA49515.1| beta-1,3-glucanase homologue [Brassica napus]
Length=139

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = -3

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            PG GTERH+G+L P+GT IY IDLSG  P S    LPKP  N P+KG VWCV    AN T
Sbjct  1    PGSGTERHWGILNPDGTQIYDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANET  60

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL +ACG+ N TC  + PG  CY P S+  HASYAFSSYWAQFR+    CYFNGLA
Sbjct  61   ELGQALDFACGRSNATCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLA  120

Query  247  VKTINDPSYGACKYPSITL  191
             +T  +P    CK+PS+TL
Sbjct  121  RETTTNPGNEQCKFPSVTL  139



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 124/204 (61%), Gaps = 13/204 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSK--VGTPARPGVVIPTLIFALYNENQK  608
            ETGWP  GD +Q G ++ N+  YN+ +V+K  +    GTP RPG  IPT IF+L+NE+QK
Sbjct  289  ETGWPTKGDENQQGTNVPNATRYNQQLVQKVLADPPRGTPRRPGAFIPTFIFSLFNEDQK  348

Query  607  PGPGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKV------WCVVA  446
            PGP TER++G+ YP+GT +YPI LS   P      +P                  WCVV+
Sbjct  349  PGPNTERNWGLFYPDGTPVYPIVLSNDAPALSHISVPSQNNGPLPASPPSPVSPQWCVVS  408

Query  445  PAA----NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL  278
            P A    + T++  AL YACG G   C+ I+PG  CY PN+L+ HASYAF+SYW + ++ 
Sbjct  409  PVAVAQVDETSLQAALDYACGAG-ADCSLIEPGEPCYLPNTLVSHASYAFNSYWQKTKAA  467

Query  277  GGTCYFNGLAVKTINDPSYGACKY  206
              TC F+G AV T +DPS G C +
Sbjct  468  DATCDFHGAAVLTSSDPSVGDCVF  491



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 123/198 (62%), Gaps = 8/198 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A+YN N+VK+  S  GTP +P   +   +FAL+NENQK G
Sbjct  263  ETGWPSAGDSNEIGASPDNAASYNGNLVKRVLSGSGTPLKPNESLDVFLFALFNENQKTG  322

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTP----ESEFPPLPKPTTNQPYKGKVWCVVAPAAN  434
            P +ER++G+ YP    +Y  D +   P    +S+ P     TT+   KG+ WCV    ++
Sbjct  323  PTSERNYGLFYPTEKKVY--DTAEAPPSGVGKSQVPVSGDVTTSS--KGQTWCVANGGSS  378

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
               + +AL+YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GTCYF G
Sbjct  379  EKKLQNALNYACGEGGADCTPIQPGATCYDPNTLEAHASYAFNSYYQKMARASGTCYFGG  438

Query  253  LAVKTINDPSYGACKYPS  200
             A      P YG C++P+
Sbjct  439  TAYVVTQPPKYGNCEFPT  456



>ref|XP_011085458.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=464

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 120/198 (61%), Gaps = 6/198 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A YN N+V++  +  GTP RP   +   +FAL+NEN+KPG
Sbjct  265  ETGWPSKGDSNEVGASVENAAAYNGNLVRRVLAGGGTPLRPHANLTVYLFALFNENKKPG  324

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-----GKVWCVVAPAA  437
            P +ER+FG+ YPN   +Y I L+ +  +S +  +  P T    +     G+ WCV    A
Sbjct  325  PTSERNFGLFYPNQKKVYDIPLTAEGLKS-YRDIQSPVTGGEQRVSTANGQTWCVAKEEA  383

Query  436  NLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFN  257
                 +  L YACG+G   C+PIQPG  C++PN+L  HAS+AF+SY+ +     GTCYF 
Sbjct  384  GKEKQSSGLDYACGEGGADCHPIQPGSTCFDPNTLEAHASFAFNSYYQKKGRAIGTCYFG  443

Query  256  GLAVKTINDPSYGACKYP  203
            G A      P YG C +P
Sbjct  444  GAAYIVTQQPKYGKCDFP  461



>gb|KHN38251.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=381

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 117/194 (60%), Gaps = 0/194 (0%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A+YN N+VK+  S  GTP +    +   +FAL+NENQK G
Sbjct  186  ETGWPSAGDSNEIGASPDNAASYNGNLVKRVLSGSGTPLKQNESLDVFLFALFNENQKTG  245

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            P +ER++G+ YP    +Y I L          P+    +    KG+ WCV +  ++   +
Sbjct  246  PTSERNYGLFYPTEKKVYDIPLPPSGVGKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKL  305

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
             +AL+YACG+G   C PIQPG  CYNPN+L  HASYAF+SY+ +     GTC F G A  
Sbjct  306  QNALNYACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGTCDFGGTAYV  365

Query  241  TINDPSYGACKYPS  200
                P YG C++P+
Sbjct  366  VTQPPKYGNCEFPT  379



>ref|XP_008449141.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis melo]
Length=454

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 116/194 (60%), Gaps = 2/194 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ G+ ++IGAS  N+A YN N+VK+  +  GTP RP   +   +FAL+NENQKPG
Sbjct  262  ETGWPSQGEENEIGASTENAAAYNGNLVKRVLTGSGTPLRPKDPLNVYLFALFNENQKPG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            P +ER++G+ YPN   +Y I L+G    +  PP    +  +   G+ WCV         +
Sbjct  322  PTSERNYGLFYPNEEKVYEISLTGDVVGAT-PPDSNGSKVE-VTGQTWCVANENVGAEKL  379

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
               L YACG+G   C  IQ GGACY+PNSL  HASYAF+SY+ + +   GTC F G A  
Sbjct  380  QAGLDYACGEGQADCRSIQQGGACYDPNSLQAHASYAFNSYYQKMKRAAGTCDFGGAAYI  439

Query  241  TINDPSYGACKYPS  200
                P YG C +PS
Sbjct  440  VTQPPQYGKCDFPS  453



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 121/202 (60%), Gaps = 8/202 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A+YN N+VK+  S  GTP +    +   +FAL+NENQK G
Sbjct  269  ETGWPSAGDSNEIGASPDNAASYNGNLVKRVMSGSGTPLKQNESLDVFLFALFNENQKTG  328

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFP--------PLPKPTTNQPYKGKVWCVVA  446
            P +ER++G+ YP    +Y I L+ +  +   P        P+    +    KG+ WCV +
Sbjct  329  PTSERNYGLFYPTEKKVYDIPLTAEEIKEAPPSGVGKSQVPVSGEVSTTTSKGQTWCVAS  388

Query  445  PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTC  266
              ++   + +AL+YACG+G   C PIQPG  CYNPN+L  HASYAF+SY+ +     GTC
Sbjct  389  GGSSEKKLQNALNYACGEGGADCTPIQPGATCYNPNTLEAHASYAFNSYYQKKARASGTC  448

Query  265  YFNGLAVKTINDPSYGACKYPS  200
             F G A      P YG C++P+
Sbjct  449  DFGGTAYVVTQPPKYGNCEFPT  470



>gb|KFK29190.1| hypothetical protein AALP_AA7G101400 [Arabis alpina]
Length=461

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 122/201 (61%), Gaps = 9/201 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GDV+++GAS  N+A YN  +VK+  +  GTP RP   +   +FAL+NENQKPG
Sbjct  261  ETGWPSAGDVNEVGASQSNAAAYNGGLVKRVLTGKGTPLRPRDPLNVYLFALFNENQKPG  320

Query  601  PGTERHFGVLYPNGTNIYPID-LSGKTPESEFP------PLPKPTTNQPYKGKVWCVVAP  443
            P +ER++G+ YPN   +Y +  ++GK  +S         P+P P      +G+ WCV   
Sbjct  321  PTSERNYGLFYPNEAKVYDVPFVAGKKRKSPLKGNRGHAPVPVPAVAD--EGEKWCVSNG  378

Query  442  AANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCY  263
             A +  +  AL YACG+G   C+PIQPG  C+NP SL  HASYAF+SY+ +     GTC+
Sbjct  379  EAGMEKLQAALDYACGEGGADCSPIQPGATCFNPESLEAHASYAFNSYYQKNARRVGTCF  438

Query  262  FNGLAVKTINDPSYGACKYPS  200
            F G A      P YG C +P+
Sbjct  439  FGGAAHVVTQPPRYGKCDFPT  459



>emb|CDX92794.1| BnaC07g40520D [Brassica napus]
Length=451

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 115/196 (59%), Gaps = 14/196 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GDV++IGAS  N+A YN  +VK+  +  GTP R    +   +F+L+NENQKPG
Sbjct  266  ETGWPSAGDVNEIGASEANAAAYNGGLVKRVLNGNGTPLRRNEPLNVFLFSLFNENQKPG  325

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLT  428
            P +ER++G+ YPN   +Y +            P P  T   P  ++G+ WCV    A   
Sbjct  326  PTSERNYGLFYPNERRVYAV------------PFPATTEQAPVAHEGESWCVSNGDAAKE  373

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL YACG+G   C PIQPG  CYNP SL  HAS+AF+SY+ +     GTCYF G A
Sbjct  374  KLQAALDYACGEGGADCRPIQPGATCYNPKSLEAHASFAFNSYYQKNARRVGTCYFGGTA  433

Query  247  VKTINDPSYGACKYPS  200
                  P YG CK+P+
Sbjct  434  HVVTQHPRYGKCKFPT  449



>ref|XP_009137621.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=465

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 117/196 (60%), Gaps = 6/196 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A YN  +VK+  +  GTP RP   +   +FAL+NENQKPG
Sbjct  272  ETGWPSAGDGNEIGASESNAAAYNGGLVKRVLNGNGTPLRPKEPLNVFLFALFNENQKPG  331

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLT  428
            P +ER++G+ YPN   +Y +  +  T      P+ +     P  ++G+ WCV    A   
Sbjct  332  PTSERNYGLFYPNERKVYAVPFAATTST----PVNRNKEQAPVAHEGETWCVSNGDAAKE  387

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL YACG+G   C PIQPG  CY+P SL  HAS+AF+SY+ +     GTCYF G A
Sbjct  388  KLQAALDYACGEGGADCRPIQPGATCYHPKSLEAHASFAFNSYYQKNARRDGTCYFGGTA  447

Query  247  VKTINDPSYGACKYPS  200
                  P YG CK+P+
Sbjct  448  HVVTQHPRYGKCKFPT  463



>ref|XP_004140121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Cucumis sativus]
 gb|KGN47963.1| hypothetical protein Csa_6G421570 [Cucumis sativus]
Length=476

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 121/211 (57%), Gaps = 17/211 (8%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS+ N+A YN N+V++  S  GTP RP   +   +FAL+NEN+K G
Sbjct  264  ETGWPSKGDENEIGASVENAAAYNGNLVRRILSGGGTPLRPKADLTVYLFALFNENKKNG  323

Query  601  PGTERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTT----------------NQPY  473
            P +ER++G+ YPN   +Y I  + +   + E  P PKP +                ++  
Sbjct  324  PTSERNYGLFYPNEEKVYDIPFTTEGLKDFEDKPSPKPVSGGNAPTAPPASGDGGVSKSQ  383

Query  472  KGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWA  293
             G  WCV +  A    +   L YACG+G   C PIQ G  CYNPN+L  HASYAF+SY+ 
Sbjct  384  TGNTWCVASGEAGKEKLQSGLDYACGEGGADCRPIQVGATCYNPNTLEAHASYAFNSYYQ  443

Query  292  QFRSLGGTCYFNGLAVKTINDPSYGACKYPS  200
            +     GTCYF G A      P YG+C++P+
Sbjct  444  KNSRKVGTCYFGGAAYVVTQPPKYGSCEFPT  474



>ref|XP_004149346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Cucumis sativus]
 gb|KGN56102.1| hypothetical protein Csa_3G073920 [Cucumis sativus]
Length=458

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 116/195 (59%), Gaps = 1/195 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGASI N+A YN N+VK+  +  GTP RP   +   +FAL+NEN+K G
Sbjct  262  ETGWPSKGDENEIGASIENAAAYNGNLVKRVLTGSGTPLRPKEPLNAYLFALFNENKKQG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK-GKVWCVVAPAANLTA  425
            P +ER++G+ YPN   +Y I L+    E      P    ++  K G+ WCV         
Sbjct  322  PTSERNYGLFYPNEEKVYEIPLTSADVEGGVGSTPAVNGSKVIKNGQTWCVANGKVAPEK  381

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            +   L YACG+G   C+ IQPG  CYNPNSL  HASYAF+SY+ + +   GTC F G A 
Sbjct  382  LQAGLDYACGEGGADCSSIQPGATCYNPNSLEAHASYAFNSYYQKMKRAVGTCDFGGAAY  441

Query  244  KTINDPSYGACKYPS  200
                 P YG C++P+
Sbjct  442  VVTQPPQYGQCEFPT  456



>gb|KHG21189.1| hypothetical protein F383_01641 [Gossypium arboreum]
Length=489

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 118/199 (59%), Gaps = 13/199 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  ++GAS  N+A YN N+V++  +  GTP RP   +   IFAL+NENQKPG
Sbjct  264  ETGWPSAGDAGEVGASQDNAAAYNGNLVRRVLTGNGTPLRPNDPLNVYIFALFNENQKPG  323

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQ------------PYKGKVW  458
            P +ER++G+ YPN   +Y I LS K       P P    NQ               G+ W
Sbjct  324  PTSERNYGLFYPNEQRVYNIPLSQKGLNGNQSP-PASNVNQTAPVNNGGGVSKATSGQTW  382

Query  457  CVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL  278
            C+ +P A    + + L YACG+G   C PIQP GACYNPNSL+ HASYA++SY+ +   +
Sbjct  383  CMASPNAEAEELQEGLDYACGEGGADCGPIQPNGACYNPNSLVAHASYAYNSYYQKKARV  442

Query  277  GGTCYFNGLAVKTINDPSY  221
             G+C+F+G A  +   P +
Sbjct  443  SGSCFFSGTAYVSTQRPFF  461



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 122/203 (60%), Gaps = 9/203 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A+YN N+V++  S  GTP RP   +   +FAL+NENQK G
Sbjct  271  ETGWPSMGDENEIGASEANAASYNGNLVRRVLSGNGTPLRPQDPLNVYLFALFNENQKSG  330

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPES-EFPPLPKPTTNQPYKGKV--------WCVV  449
            P +ER++G+ YPN   +Y I L+ +  ES +  P+   T+  P  G+V        WCV 
Sbjct  331  PTSERNYGLFYPNEQKVYNIPLTKEELESGQSTPVNGNTSQVPATGEVSKTSVGQTWCVA  390

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
               A    +  AL YACG+G   C PIQPG  CY+PN+L  HASYAF+SY+ +     GT
Sbjct  391  NKNAGEKTLQAALDYACGEGGADCKPIQPGATCYSPNTLDAHASYAFNSYYQKKTRGTGT  450

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F G A      P YG C++P+
Sbjct  451  CDFGGAAYVVSQPPRYGNCEFPT  473



>ref|XP_004243515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Solanum lycopersicum]
Length=468

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 119/202 (59%), Gaps = 8/202 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  +IGAS+ N+A+YN N+V++     GTP RP   +   +FAL+NEN+KPG
Sbjct  265  ETGWPSKGDDTEIGASVDNAASYNGNLVRRILIGGGTPLRPKEDLTVFLFALFNENKKPG  324

Query  601  PGTERHFGVLYPNGTNIY--PIDLSGKTP--ESEFPPLPKPTTNQPYK----GKVWCVVA  446
            P +ER+FG+ YPN   +Y  P+ + G     +   P   +  T +  K    G+ WCV +
Sbjct  325  PTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPSAGEQRTQKGGKVNVSGQTWCVAS  384

Query  445  PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTC  266
              A    +  AL YACG+G   C  IQPG  CYNPN+L  HAS+AF+SY+ +     G+C
Sbjct  385  GEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSYYQKKGRAMGSC  444

Query  265  YFNGLAVKTINDPSYGACKYPS  200
            YF G A      P YG C+ P+
Sbjct  445  YFGGAAFIVHQQPKYGHCELPT  466



>ref|XP_006357966.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Solanum tuberosum]
Length=468

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 117/202 (58%), Gaps = 8/202 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  +IGA++ N+A+YN N+V++     GTP RP   +   +FAL+NEN+KPG
Sbjct  265  ETGWPSKGDDTEIGATVDNAASYNGNLVRRILIGGGTPLRPKEDLTVFLFALFNENKKPG  324

Query  601  PGTERHFGVLYPNGTNIY--PIDLSG-KTPESEFPPLPKPTTNQP-----YKGKVWCVVA  446
            P +ER+FG+ YPN   +Y  P+ + G K       P+      Q        G+ WCV +
Sbjct  325  PTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPVAGDQRTQKGGKVNVSGQTWCVAS  384

Query  445  PAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTC  266
              A    +  AL YACG+G   C  IQPG  CYNPN+L  HAS+AF+SY+ +     G+C
Sbjct  385  GEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSYYQKKSRAMGSC  444

Query  265  YFNGLAVKTINDPSYGACKYPS  200
            YF G A      P YG C+ P+
Sbjct  445  YFGGAAFIVHQQPKYGHCELPT  466



>ref|XP_010063042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Eucalyptus 
grandis]
 gb|KCW70222.1| hypothetical protein EUGRSUZ_F03495 [Eucalyptus grandis]
Length=456

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 113/194 (58%), Gaps = 0/194 (0%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GA   N+A YN N+V++  +  GTP RP   +   +FAL+NENQK G
Sbjct  261  ETGWPSKGDANEVGAGTQNAAAYNGNLVRRALTGTGTPLRPNNTVDVYLFALFNENQKTG  320

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            P +ER++G+ YP+   +Y I L+ +   S+     K        G+ WCV    A    +
Sbjct  321  PTSERNYGLFYPDEQKVYSIPLTLEQLASDPNNASKAQVPTAPVGQTWCVANGKAGAKKL  380

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              AL YACG+G   C PIQ G ACYNPN+L  HASYAF+SY+ +     GTC F G A  
Sbjct  381  QAALDYACGKGGADCQPIQQGSACYNPNTLEAHASYAFNSYYQKNARGAGTCNFGGAAFV  440

Query  241  TINDPSYGACKYPS  200
                P YG C +P+
Sbjct  441  VTQVPEYGECDFPT  454



>ref|XP_006447645.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
 gb|ESR60885.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
Length=480

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 120/208 (58%), Gaps = 14/208 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++ GAS+ N+A YN N+V++  +  GTP RP   +   +FAL+NE+QKPG
Sbjct  271  ETGWPSKGDENENGASVENAAAYNGNLVRRILTGGGTPLRPKADLTVYLFALFNEDQKPG  330

Query  601  PGTERHFGVLYPNGTNIY--PIDLSG-------KTPESEFPPLPKPT-----TNQPYKGK  464
            P +ER++G+ YPN   +Y  P  + G       ++P +  P +  P       ++   G 
Sbjct  331  PTSERNYGLFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRSPTVRAPVNGGGGVSKSTSGN  390

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
             WCV         +   L YACG+G   C PIQPG  CY+PN+L  HAS+AF+SY+ +  
Sbjct  391  TWCVANAEVGKEKLQRGLDYACGEGGADCRPIQPGATCYSPNTLEAHASFAFNSYYQKQS  450

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
              GG+CYF G A      P YG C++P+
Sbjct  451  RAGGSCYFGGAAYVVTQPPRYGVCEFPT  478



>ref|XP_007141644.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
 gb|ESW13638.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
Length=473

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 123/210 (59%), Gaps = 16/210 (8%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A +N N+V+K  +  GTP RP   +   +FAL+NENQK G
Sbjct  262  ETGWPSKGDNNEVGASVENAAAFNGNLVRKILTGGGTPLRPKADLTVYLFALFNENQKSG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKT-PESEFPPLPKPTTNQPYK---------------  470
            P +ER+FG+ YP+   +Y +  + +   +    P+   + NQ  +               
Sbjct  322  PTSERNFGLFYPDEKRVYNVPFTAEELKDYHDSPVKGGSHNQTTQAPAPNVSGGVSKSTT  381

Query  469  GKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQ  290
            G  WCV  P A+   +  AL +ACG+G   C PIQ G  CY+PN+++ HAS+AF+SY+ +
Sbjct  382  GNTWCVANPDADKVKLQAALDFACGEGGADCAPIQHGATCYDPNTIVAHASFAFNSYYQK  441

Query  289  FRSLGGTCYFNGLAVKTINDPSYGACKYPS  200
                GG+CYF G +     +P YG C++P+
Sbjct  442  QARKGGSCYFGGTSYVVTQEPRYGNCEFPT  471



>dbj|BAF01977.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=314

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 116/196 (59%), Gaps = 6/196 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A YN  +VK+  +  GTP RP   +   +FAL+NENQKPG
Sbjct  121  ETGWPSVGDENEIGASESNAAAYNAGLVKRVLTGKGTPLRPTEPLNVYLFALFNENQKPG  180

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQP--YKGKVWCVVAPAANLT  428
            P +ER++G+ YPN   +Y +  + K+      P+       P  ++G  WCV        
Sbjct  181  PTSERNYGLFYPNEGKVYNVPFTKKSTT----PVNGNRGKVPVTHEGHTWCVSNGEVAKE  236

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             + +AL YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC+F G A
Sbjct  237  KLQEALDYACGEGGADCRPIQPGATCYHPESLEAHASYAFNSYYQKNSRRVGTCFFGGAA  296

Query  247  VKTINDPSYGACKYPS  200
                  P YG C++P+
Sbjct  297  HVVTQPPRYGKCEFPT  312



>ref|XP_008449478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Cucumis melo]
Length=474

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 119/209 (57%), Gaps = 15/209 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS+ N+A YN N+V +  S  GTP RP   +   +FAL+NEN+K G
Sbjct  264  ETGWPSKGDENEIGASVENAAAYNGNLVHRILSGGGTPLRPKADLTVYLFALFNENKKNG  323

Query  601  PGTERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTT--------------NQPYKG  467
            P +ER++G+ YPN   +Y I  + +   E +  P  KP +              ++   G
Sbjct  324  PTSERNYGLFYPNEEKVYDIPFTAEGLKEYKDKPSRKPISAPTGAPVSGGDGGVSKSQTG  383

Query  466  KVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQF  287
              WCV +  A    +   L YACG+G   C PIQ G  CYNPN+L  HASYAF+SY+ + 
Sbjct  384  NTWCVASGEAGREKLQAGLDYACGEGGADCRPIQVGATCYNPNTLEAHASYAFNSYYQKN  443

Query  286  RSLGGTCYFNGLAVKTINDPSYGACKYPS  200
                GTCYF G A      P YG+C++P+
Sbjct  444  NRKVGTCYFGGAAYVVTQPPKYGSCEFPT  472



>ref|XP_011047200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Populus euphratica]
Length=470

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 122/207 (59%), Gaps = 13/207 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+ATYN N+V++  +  GTP +P   +   +FAL+NEN+K G
Sbjct  262  ETGWPSKGDENEVGASVENAATYNGNLVRRILTGGGTPLKPHADLTVYLFALFNENEKDG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLS----------GKTPESEFPPLPKPT---TNQPYKGKV  461
            P +ER++G+ YP+   +Y I  +           ++P S   P+  P     ++   G  
Sbjct  322  PTSERNYGLFYPDQQKVYDIPFTVEGLKNYKAPSRSPVSGGQPVSAPVRGGVSKSTTGNT  381

Query  460  WCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  281
            WCV  P A    +  AL +ACG+G   C PIQP   CYNPN+L+ H+S+AF+SY+ +   
Sbjct  382  WCVANPDAGKEKLQAALDFACGEGGADCRPIQPEATCYNPNTLVAHSSFAFNSYYQKKGR  441

Query  280  LGGTCYFNGLAVKTINDPSYGACKYPS  200
              G CYF G A     +P +G C++P+
Sbjct  442  GMGDCYFGGAAFVVTQEPKFGECEFPT  468



>gb|KDP39185.1| hypothetical protein JCGZ_00942 [Jatropha curcas]
Length=463

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 117/203 (58%), Gaps = 9/203 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+IGA   N+A+YN N+VK+  +  GTP RP   +   +FAL+NENQKPG
Sbjct  259  ETGWPSMGDEDEIGAGEENAASYNGNLVKRVLTGNGTPLRPQDPLNVYLFALFNENQKPG  318

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKT-PESEFPPLPKPTTNQPYKGKV--------WCVV  449
            P +ER++G+ YPN   +Y I L+ K    S+  P+    +  P  G+V        WCV 
Sbjct  319  PTSERNYGLFYPNEQKVYDIPLTQKELVNSQSTPVSGNKSQVPVTGEVSKTSVGQTWCVA  378

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
               +    +   L YACG G   C PIQ G  CYNPN+L  HASYAF+SY+ +     GT
Sbjct  379  NGNSGKERLQAGLDYACGDGAADCRPIQEGATCYNPNTLEAHASYAFNSYYQKKARAAGT  438

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F G A      P YG C++P+
Sbjct  439  CSFGGAAYVVTQPPRYGNCEFPT  461



>ref|XP_010675772.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 119/198 (60%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS  N+A YN N+ K+  +  GTP RP   +   +FAL+NENQKPG
Sbjct  264  ETGWPSQGDENEVGASGPNAAAYNGNLAKRVLTGGGTPLRPNDPLDVYLFALFNENQKPG  323

Query  601  PGTERHFGVLYPNGTNIYPIDLSG-KTPESEFPPLPKPTTNQ---PYKGKVWCVVAPAAN  434
            P +ER++G+ YPN   +Y + L+  +  ++   P      ++   P  G+ WCV    A 
Sbjct  324  PTSERNYGLFYPNEQKVYNVPLTAAQIGDAAVAPASANNGSKVVVPPTGQTWCVANEQAG  383

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
               + D L++ACG+G   C PIQPG  CYNP +L+ HASYAF+SY+       GTC F G
Sbjct  384  EEKLQDGLNWACGEGKADCRPIQPGATCYNPGTLVAHASYAFNSYYQMKARSTGTCDFGG  443

Query  253  LAVKTINDPSYGACKYPS  200
             A      P +G+CK+P+
Sbjct  444  AAHVVTQSPQFGSCKFPT  461



>ref|XP_010482941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=460

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 120/200 (60%), Gaps = 9/200 (5%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGA   N+A YN  +VK+  +  GTP +P   +   +FAL+NENQK G
Sbjct  262  ETGWPSAGDENEIGAGSANAAAYNGGLVKRVLTGNGTPLKPKEPLNVYLFALFNENQKTG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLS-GKTP-----ESEFPPLPKPTTNQPYKGKVWCVVAPA  440
            P +ER++G+ YPN   +Y + LS GK+      + + PP+ KP++   + G+ WCV    
Sbjct  322  PTSERNYGLFYPNENKVYDVSLSSGKSTPVEDNKEKVPPVVKPSS---HVGQTWCVANGK  378

Query  439  ANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYF  260
                 + + L YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F
Sbjct  379  TTKEKLQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYAFNSYYQKNARGVGTCDF  438

Query  259  NGLAVKTINDPSYGACKYPS  200
             G A      P YG C++P+
Sbjct  439  KGAAYVVSQPPKYGKCEFPT  458



>ref|XP_012070897.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Jatropha 
curcas]
Length=472

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 117/203 (58%), Gaps = 9/203 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+IGA   N+A+YN N+VK+  +  GTP RP   +   +FAL+NENQKPG
Sbjct  268  ETGWPSMGDEDEIGAGEENAASYNGNLVKRVLTGNGTPLRPQDPLNVYLFALFNENQKPG  327

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKT-PESEFPPLPKPTTNQPYKGKV--------WCVV  449
            P +ER++G+ YPN   +Y I L+ K    S+  P+    +  P  G+V        WCV 
Sbjct  328  PTSERNYGLFYPNEQKVYDIPLTQKELVNSQSTPVSGNKSQVPVTGEVSKTSVGQTWCVA  387

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
               +    +   L YACG G   C PIQ G  CYNPN+L  HASYAF+SY+ +     GT
Sbjct  388  NGNSGKERLQAGLDYACGDGAADCRPIQEGATCYNPNTLEAHASYAFNSYYQKKARAAGT  447

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F G A      P YG C++P+
Sbjct  448  CSFGGAAYVVTQPPRYGNCEFPT  470



>ref|XP_004491103.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X1 
[Cicer arietinum]
Length=477

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 121/205 (59%), Gaps = 20/205 (10%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A YN N+V+K  +  GTP RP   +   +FAL+NENQKPG
Sbjct  262  ETGWPSKGDNNEVGASVENAAAYNGNLVRKILTGSGTPLRPKADLTVYLFALFNENQKPG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPT------TNQP------------  476
            P +ER+FG+ YP+   +Y I L+ +  ++ +   P P       TNQP            
Sbjct  322  PTSERNFGLFYPSEEKVYDIPLTVEALKN-YHDNPSPVAPVSGNTNQPTPAVSPVGGVSK  380

Query  475  -YKGKVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSY  299
               G  WCV  P A+   +  AL +ACG+G   C  IQPG  CYNPN+L+ HAS+AF+SY
Sbjct  381  STTGDTWCVANPDADKNKLQLALDFACGEGGADCRTIQPGATCYNPNTLVAHASFAFNSY  440

Query  298  WAQFRSLGGTCYFNGLAVKTINDPS  224
            + +    GG+C+F G +     +PS
Sbjct  441  YQKQARAGGSCFFGGTSYVVTQEPS  465



>ref|XP_007142328.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
 gb|ESW14322.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
Length=466

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 120/203 (59%), Gaps = 10/203 (5%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGA   N+A YN N+V++   + GTP RP   +   +FAL+NENQK G
Sbjct  263  ETGWPSAGDSNEIGAGPENAAEYNGNLVRRVLGQSGTPLRPNDSLDVFLFALFNENQKTG  322

Query  601  PGTERHFGVLYPNGTNIYPIDL---------SGKTPESEFPPLPKPTTNQPYKGKVWCVV  449
            P +ER++G+ YP+   +Y I L         S    +S+ P   + +T     G+ WCV 
Sbjct  323  PTSERNYGLFYPSEKKVYDIPLKAEGVTEAPSSGVEKSQVPASGEVSTTS-RDGQTWCVA  381

Query  448  APAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGT  269
               A+   + + L+YACG+G   C+ IQP   CYNPN+L  HASYAF+SY+ +     GT
Sbjct  382  NGGASEEKLQNGLNYACGEGGADCSAIQPDATCYNPNTLEAHASYAFNSYYQKKARAAGT  441

Query  268  CYFNGLAVKTINDPSYGACKYPS  200
            C F G A    + P YG+C++PS
Sbjct  442  CDFGGTAYVVTHPPKYGSCEFPS  464



>gb|ACN39797.1| unknown [Picea sitchensis]
Length=474

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 117/208 (56%), Gaps = 14/208 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+ G  + N+A YN N+VK   S  GTP RP   + T +FAL+NEN+KPG
Sbjct  265  ETGWPSKGDEDETGVGLDNAAAYNGNLVKHVMSNSGTPLRPKASLDTFLFALFNENKKPG  324

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK--------------GK  464
            P +ER++G+ YP+   +Y I L+     +  P     +++ P                 +
Sbjct  325  PTSERNYGLFYPSEQRVYDIALTPSAVNNPAPASGNSSSSTPAVSAHHHSSGTTPAGGSE  384

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
             WCV    ++ + +  AL YACG+G+  C  IQPG  CYNPN+L  HASYAF+SY+ +  
Sbjct  385  TWCVANSKSDTSKLQAALDYACGEGDADCQQIQPGAPCYNPNTLEAHASYAFNSYYQKNS  444

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
               GTC F G A      P YG CK+P+
Sbjct  445  RKIGTCDFAGAAYVVTQSPKYGDCKFPT  472



>emb|CDP14397.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 119/209 (57%), Gaps = 15/209 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS  N+A YN N+V++  +  GTP RP   +   +FAL+NENQK G
Sbjct  280  ETGWPSKGDENEVGASQQNAAAYNGNLVRRVLTSGGTPLRPDEPLNVYLFALFNENQKTG  339

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYK---------------G  467
            P +ER++G+ YP+   +Y + L+ +   S     P  T+    K               G
Sbjct  340  PTSERNYGLFYPSEQKVYDVPLTLEALASAPTASPSNTSRVVTKPPSTSSSGDFFPSTAG  399

Query  466  KVWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQF  287
            + WCV +       +  AL YACG+G   C PIQPG  CYNPN+L+ HASYAF+SY+ + 
Sbjct  400  QTWCVASGDVGEEKLKAALDYACGEGAADCRPIQPGATCYNPNTLVAHASYAFNSYYQKN  459

Query  286  RSLGGTCYFNGLAVKTINDPSYGACKYPS  200
                G+CYF G A      P YG+C YP+
Sbjct  460  ARRSGSCYFGGAAYVVSQLPKYGSCDYPT  488



>emb|CDY46679.1| BnaA03g48290D [Brassica napus]
Length=446

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 114/194 (59%), Gaps = 15/194 (8%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGAS  N+A YN  +V++  +  GTP RP   +   +FAL+NENQKPG
Sbjct  266  ETGWPSAGDGNEIGASESNAAAYNGGLVQRVLNGNGTPLRPKEPLNVFLFALFNENQKPG  325

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            P +ER++G+ YPN   +Y +  +              TT+ P  G+ WCV    A    +
Sbjct  326  PTSERNYGLFYPNERKVYAVPFAA-------------TTSTP--GETWCVSNGDAAKEKL  370

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
              AL YACG+G   C PIQPG  CY+P SL  HAS+AF+SY+ +     GTCYF G A  
Sbjct  371  QAALDYACGEGGADCRPIQPGATCYHPKSLEAHASFAFNSYYQKNARRDGTCYFGGTAHV  430

Query  241  TINDPSYGACKYPS  200
                P YG CK+P+
Sbjct  431  VTQHPRYGKCKFPT  444



>ref|XP_010270042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nelumbo nucifera]
Length=466

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 117/207 (57%), Gaps = 16/207 (8%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+ GAS  N+A YN N+V++  +  GTP RP   +   +FAL+NEN KPG
Sbjct  261  ETGWPSKGDEDESGASEVNAAAYNGNLVRRVLAGGGTPQRPQEDLDVYLFALFNENMKPG  320

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLP--------KPTTNQPYKG-----KV  461
            P +ER++G+ YPN   +Y I L   TPE     +P         P  N          + 
Sbjct  321  PTSERNYGLFYPNEEKVYDIPL---TPEEVRQKVPVNGGKSQMTPVNNGGSVSTSSSGQT  377

Query  460  WCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRS  281
            WCV    A    +  AL YACG+G   C PIQPG +CY+PN+L  HAS+AF+SY+ + R 
Sbjct  378  WCVANGKAGEQKLQAALDYACGEGGSDCRPIQPGASCYDPNTLEAHASFAFNSYYQKMRR  437

Query  280  LGGTCYFNGLAVKTINDPSYGACKYPS  200
              GTC F G A      P +G C++P+
Sbjct  438  GMGTCDFEGAAYVVTQPPKFGKCEFPT  464



>ref|XP_006469612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=540

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 120/208 (58%), Gaps = 14/208 (7%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++ GAS+ N+A YN N+V++  +  GTP RP   +   +FAL+NE+QKPG
Sbjct  331  ETGWPSKGDENENGASVENAAAYNGNLVRRILTGGGTPLRPKADLTVYLFALFNEDQKPG  390

Query  601  PGTERHFGVLYPNGTNIY--PIDLSG-------KTPESEFPPLPKPT-----TNQPYKGK  464
            P +ER++G+ YPN   +Y  P  + G       ++P +  P +  P       ++   G 
Sbjct  391  PTSERNYGLFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRSPTVRAPVNGGGGVSKSTSGN  450

Query  463  VWCVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFR  284
             WCV         +   L YACG+G   C PIQPG  CY+PN+L  HAS+AF+SY+ +  
Sbjct  451  TWCVANAEVGKEKLQRGLDYACGEGGADCRPIQPGATCYSPNTLEAHASFAFNSYYQKQS  510

Query  283  SLGGTCYFNGLAVKTINDPSYGACKYPS  200
              GG+CYF G A      P YG C++P+
Sbjct  511  RAGGSCYFGGAAYVVTQPPRYGVCEFPT  538



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 119/192 (62%), Gaps = 11/192 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ G  D+  A++ N+ T+N N++K+  +  G P++P + I T I+ LYNE+++ G
Sbjct  266  ETGWPSSGGGDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNEDKRSG  325

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTAV  422
            P +ER++G+L+PNGT++YP+ LSG +  +                 ++CV    A+   +
Sbjct  326  PVSERNWGILFPNGTSVYPLSLSGGSNSAAL-----------NDSSMFCVAKADADDDKL  374

Query  421  ADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAVK  242
             D L++ACGQG   C  IQPG  CY PN +  HAS+AF+ Y+ + +S GGTC F+G A+ 
Sbjct  375  IDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAIT  434

Query  241  TINDPSYGACKY  206
            T  DPSY  C Y
Sbjct  435  TTRDPSYRTCAY  446



>ref|XP_006280442.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
 gb|EOA13340.1| hypothetical protein CARUB_v10026374mg [Capsella rubella]
Length=457

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 116/198 (59%), Gaps = 8/198 (4%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGA   N+A YN  +VK+  +  GTP +P   +   +FAL+NENQK G
Sbjct  262  ETGWPSAGDENEIGAGSANAAAYNGGLVKRVLTGNGTPLKPKEPLNVYLFALFNENQKTG  321

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKT----PESEFPPLPKPTTNQPYKGKVWCVVAPAAN  434
            P +ER++G+ YPN   +Y + LSGK+     E E     KP+    + G+ WCV      
Sbjct  322  PTSERNYGLFYPNENKVYDVSLSGKSTPVNDEKEKVTPVKPS----HVGQTWCVANGKTT  377

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
               + + L YACG+G   C PIQPG  CY+P SL  HASYAF+SY+ +     GTC F G
Sbjct  378  KEKLQEGLDYACGEGGADCRPIQPGATCYDPESLEAHASYAFNSYYQKNARGTGTCDFKG  437

Query  253  LAVKTINDPSYGACKYPS  200
             A      P YG C++P+
Sbjct  438  AAYVVSQPPKYGKCEFPT  455



>gb|EPS68573.1| hypothetical protein M569_06194, partial [Genlisea aurea]
Length=436

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 115/194 (59%), Gaps = 2/194 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD D+ GAS+ N+A YN N+V++  +  GTP RP V +   +FAL+NE+QKPG
Sbjct  243  ETGWPSQGDPDEAGASVENAAAYNGNLVRRVLAGNGTPLRPSVPLQVYLFALFNEDQKPG  302

Query  601  PGTERHFGVLYPNGTNIY--PIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            P +ER++G+ YP+   +Y  P+  +G    +E   +  P  +     + WCV    A   
Sbjct  303  PTSERNYGLFYPDEQKVYDVPLTAAGLDEATEVSKIQSPPGSFAGGSQTWCVANEDAGTD  362

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL YACG     C PIQPG  CY+PN+L+ HAS+AF+SY+       G+C F G A
Sbjct  363  KLQQALDYACGNSLVNCRPIQPGATCYDPNTLLAHASFAFNSYYQMMDRASGSCDFGGGA  422

Query  247  VKTINDPSYGACKY  206
                  P++G C++
Sbjct  423  HVVSQPPNFGNCRF  436



>gb|EYU43154.1| hypothetical protein MIMGU_mgv1a005917mg [Erythranthe guttata]
Length=465

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 115/197 (58%), Gaps = 4/197 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GA++ N+A YN N+V++     GTP RP   +   +FAL+NEN+K G
Sbjct  266  ETGWPSKGDKNEVGATVENAAAYNGNLVRRVLGGGGTPLRPKADLTVYLFALFNENKKVG  325

Query  601  PGTERHFGVLYPNGTNIYPIDLSGK----TPESEFPPLPKPTTNQPYKGKVWCVVAPAAN  434
            P +ER+FG+ YP+   +Y I L+ +      E   P            G+ WCV    A 
Sbjct  326  PTSERNFGLFYPDQKKVYDIPLTAEGLRGLGEKTTPVSGGEQRMATASGETWCVAKEEAG  385

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
               + + L YACG+G   C+PIQPG  C++PN+L  HAS+AF+SY+ +     GTC+F G
Sbjct  386  KDKLQEGLDYACGEGGADCHPIQPGSTCFDPNTLEAHASFAFNSYFQKKGRAIGTCFFGG  445

Query  253  LAVKTINDPSYGACKYP  203
             A      P YG C++P
Sbjct  446  AAYIVTQKPKYGKCEFP  462



>gb|EYU33669.1| hypothetical protein MIMGU_mgv1a005896mg [Erythranthe guttata]
Length=466

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 118/198 (60%), Gaps = 4/198 (2%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  ++GAS+ N+A YN N+V++  +  GTP RP V I   +FAL+NENQKPG
Sbjct  267  ETGWPSIGDEGEVGASVENAAAYNGNLVRRVLTGGGTPLRPDVPIDVYLFALFNENQKPG  326

Query  601  PGTERHFGVLYPNGTNIYPIDLSGK---TPESEFPPLPKPT-TNQPYKGKVWCVVAPAAN  434
            P +ER++G+ YPN   +Y I L+        S+      P   ++ + G+ WCV    A 
Sbjct  327  PTSERNYGLFYPNEEKVYDIPLTAAALGVASSKRKVAAAPAHRHRHHSGETWCVANEKAG  386

Query  433  LTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNG  254
               +  AL YACG+G   C PIQPG  C++P+++  HAS+AF+SY+ +     G+CYF G
Sbjct  387  AEKLQAALDYACGEGGADCRPIQPGATCHDPDTIGAHASFAFNSYYQKNARRRGSCYFGG  446

Query  253  LAVKTINDPSYGACKYPS  200
             A      P +G C + +
Sbjct  447  AAYVVTQPPKFGTCDFAT  464



>gb|EPS59841.1| hypothetical protein M569_14964, partial [Genlisea aurea]
Length=461

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 117/195 (60%), Gaps = 2/195 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD +++GAS+ N+A YN N+V++  +  GTP RP V +   +FAL+NENQK G
Sbjct  267  ETGWPSKGDANEVGASVGNAAAYNGNLVRRVLAGNGTPLRPTVPLNVYLFALFNENQKTG  326

Query  601  PGTERHFGVLYPNGTNIY--PIDLSGKTPESEFPPLPKPTTNQPYKGKVWCVVAPAANLT  428
            P +ER++G+ YP+   +Y  P+  +G +  +    +  P       G+ WCV    +   
Sbjct  327  PTSERNYGLFYPDEQKVYNIPLTAAGLSAGTGVSRIQTPPPEGAAAGETWCVANQDSGSE  386

Query  427  AVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLA  248
             +  AL YACG+G   C PIQPG  CY+P+SL+ HAS+AF+SY+       G C F G A
Sbjct  387  KLQRALDYACGEGGANCRPIQPGATCYHPDSLLAHASFAFNSYYQASDRRSGACDFAGAA  446

Query  247  VKTINDPSYGACKYP  203
                  P+YG C++P
Sbjct  447  HVVTQPPNYGNCQFP  461



>ref|XP_002864380.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40639.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 115/195 (59%), Gaps = 2/195 (1%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD ++IGA   N+A YN  +VK+  +  GTP +P   +   +FAL+NENQK G
Sbjct  266  ETGWPSAGDENEIGAGSANAAAYNGGLVKRVLTGNGTPLKPKEPLNVYLFALFNENQKTG  325

Query  601  PGTERHFGVLYPNGTNIYPIDLSGK-TPESEFPPLPKPTTNQPYKGKVWCVVAPAANLTA  425
            P +ER++G+ YPN   +Y + LSGK TP ++      P     + G+ WCV         
Sbjct  326  PTSERNYGLFYPNENKVYDVSLSGKSTPVNDNKEKVVP-VKPSHVGQTWCVANGKTTKEK  384

Query  424  VADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCYFNGLAV  245
            + + L YACG+G   C PIQPG  CYNP SL  HASYAF+SY+ +     GTC F G A 
Sbjct  385  LQEGLDYACGEGGADCRPIQPGATCYNPESLEAHASYAFNSYYQKNARGVGTCDFGGAAY  444

Query  244  KTINDPSYGACKYPS  200
                 P YG C++P+
Sbjct  445  VVSQPPKYGKCEFPT  459



>gb|EPS73917.1| hypothetical protein M569_00835, partial [Genlisea aurea]
Length=445

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 116/201 (58%), Gaps = 7/201 (3%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  ++GA++ N+A YN N++++     GTP RP   +   +FAL+NEN+KPG
Sbjct  245  ETGWPSKGDSKEVGAAVENAAAYNGNLIRRVLRGGGTPRRPSADLTVFLFALFNENKKPG  304

Query  601  PGTERHFGVLYPNGTNIYPIDLSGKTPESEFPPLPKPTTNQPYKGKV-------WCVVAP  443
            P +ER+FG+ YP+ T +Y +  + +  ++       P      + ++       WCV   
Sbjct  305  PTSERNFGLFYPDETRVYDVPFTAEGLKNVNNNNNNPPAMDHGEQRISTGSGPSWCVANA  364

Query  442  AANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSLGGTCY  263
            AA    +   L YACG+G   C  IQPG  C++PN++  HAS+AF+SY+ +     GTCY
Sbjct  365  AAGRKKLQAGLDYACGEGGADCRSIQPGSTCFDPNTVEAHASFAFNSYFQKNGRRIGTCY  424

Query  262  FNGLAVKTINDPSYGACKYPS  200
            F G A      P YGAC+ PS
Sbjct  425  FGGAAYVVTQQPKYGACELPS  445



>ref|XP_009628415.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nicotiana tomentosiformis]
Length=471

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 119/206 (58%), Gaps = 12/206 (6%)
 Frame = -3

Query  781  ETGWPNGGDVDQIGASIYNSATYNRNVVKKFTSKVGTPARPGVVIPTLIFALYNENQKPG  602
            ETGWP+ GD  ++GAS+ N+A YN N+V++  +  GTP RP   I   +FAL+NEN+KPG
Sbjct  264  ETGWPSKGDDIEVGASVDNAAAYNGNLVRRILTGGGTPLRPKEDITVFLFALFNENKKPG  323

Query  601  PGTERHFGVLYPNGTNIY--PIDLSGKTP--ESEFPPLPKPTTNQPYKGKV--------W  458
            P +ER+FG+ YPN   +Y  P+++ G     + + P        +  KG V        W
Sbjct  324  PTSERNFGLFYPNERKVYDIPLNMEGLKHYIDRQSPVAGGERMQKGGKGNVSPSVPGQTW  383

Query  457  CVVAPAANLTAVADALSYACGQGNRTCNPIQPGGACYNPNSLIRHASYAFSSYWAQFRSL  278
            CV +  A    +  AL +ACG+G   C  IQPG  CYNPN+L  HASYAF+SY+ +    
Sbjct  384  CVASGEAGKDNLQAALDFACGEGGADCRSIQPGSTCYNPNTLEAHASYAFNSYYQKKGRA  443

Query  277  GGTCYFNGLAVKTINDPSYGACKYPS  200
             G+CYF G A      P YG C+ P+
Sbjct  444  MGSCYFGGAAYIVHQQPKYGNCELPT  469



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1572839714856