BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11752

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354036.1|  PREDICTED: uncharacterized protein LOC102585287    312   1e-99   Solanum tuberosum [potatoes]
ref|NP_001275331.1|  uncharacterized protein LOC102585287               312   1e-99   Solanum tuberosum [potatoes]
ref|XP_004237874.1|  PREDICTED: uncharacterized protein LOC101268389    311   2e-99   Solanum lycopersicum
ref|XP_009773832.1|  PREDICTED: uncharacterized protein LOC104223983    308   3e-98   Nicotiana sylvestris
ref|XP_009591345.1|  PREDICTED: uncharacterized protein LOC104088390    308   6e-98   Nicotiana tomentosiformis
ref|XP_011074151.1|  PREDICTED: uncharacterized protein LOC105158...    305   4e-97   Sesamum indicum [beniseed]
ref|XP_010543191.1|  PREDICTED: uncharacterized protein LOC104816...    303   1e-96   Tarenaya hassleriana [spider flower]
ref|XP_011083402.1|  PREDICTED: uncharacterized protein LOC105165944    303   3e-96   Sesamum indicum [beniseed]
ref|XP_012089676.1|  PREDICTED: IST1-like protein isoform X1            303   3e-96   
gb|KJB59582.1|  hypothetical protein B456_009G261900                    303   4e-96   Gossypium raimondii
ref|XP_011038197.1|  PREDICTED: IST1 homolog                            303   2e-95   Populus euphratica
ref|XP_010692212.1|  PREDICTED: IST1 homolog                            300   3e-95   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010501779.1|  PREDICTED: IST1 homolog                            290   3e-95   
ref|XP_002534491.1|  protein with unknown function                      300   4e-95   Ricinus communis
ref|XP_010530141.1|  PREDICTED: IST1 homolog                            299   7e-95   Tarenaya hassleriana [spider flower]
ref|XP_010063798.1|  PREDICTED: IST1 homolog                            300   1e-94   Eucalyptus grandis [rose gum]
ref|XP_007020222.1|  Regulator of Vps4 activity in the MVB pathwa...    299   2e-94   
emb|CDP01161.1|  unnamed protein product                                298   5e-94   Coffea canephora [robusta coffee]
gb|EPS70884.1|  hypothetical protein M569_03876                         288   1e-93   Genlisea aurea
ref|XP_010695698.1|  PREDICTED: IST1-like protein                       288   1e-93   
emb|CBI35325.3|  unnamed protein product                                291   2e-93   Vitis vinifera
ref|XP_010245870.1|  PREDICTED: uncharacterized protein LOC104589305    296   3e-93   Nelumbo nucifera [Indian lotus]
ref|XP_008809517.1|  PREDICTED: IST1-like protein isoform X2            295   9e-93   Phoenix dactylifera
ref|XP_008809516.1|  PREDICTED: IST1-like protein isoform X1            295   9e-93   Phoenix dactylifera
ref|XP_010937030.1|  PREDICTED: IST1 homolog                            295   1e-92   Elaeis guineensis
gb|KDO83978.1|  hypothetical protein CISIN_1g009857mg                   294   1e-92   Citrus sinensis [apfelsine]
ref|XP_006396076.1|  hypothetical protein EUTSA_v10007134mg             296   2e-92   Eutrema salsugineum [saltwater cress]
emb|CDY46461.1|  BnaA08g06470D                                          295   2e-92   Brassica napus [oilseed rape]
ref|XP_006376337.1|  hypothetical protein POPTR_0013s12140g             294   2e-92   
ref|XP_009107933.1|  PREDICTED: uncharacterized protein LOC103833603    295   2e-92   Brassica rapa
ref|XP_006434655.1|  hypothetical protein CICLE_v10000853mg             293   2e-92   Citrus clementina [clementine]
ref|NP_973961.1|  Regulator of Vps4 activity in the MVB pathway p...    296   2e-92   Arabidopsis thaliana [mouse-ear cress]
gb|KHN32808.1|  IST1-like protein                                       293   2e-92   Glycine soja [wild soybean]
ref|XP_003548955.1|  PREDICTED: vacuolar protein sorting-associat...    293   2e-92   
ref|XP_008381028.1|  PREDICTED: IST1-like protein                       293   3e-92   
ref|XP_009339749.1|  PREDICTED: IST1-like protein                       293   4e-92   Pyrus x bretschneideri [bai li]
ref|XP_002275027.1|  PREDICTED: uncharacterized protein LOC100245921    293   4e-92   Vitis vinifera
ref|XP_006473234.1|  PREDICTED: uncharacterized protein LOC102611062    293   4e-92   Citrus sinensis [apfelsine]
ref|XP_009339061.1|  PREDICTED: uncharacterized protein LOC103931...    293   5e-92   Pyrus x bretschneideri [bai li]
ref|XP_010499963.1|  PREDICTED: IST1 homolog isoform X1                 294   6e-92   Camelina sativa [gold-of-pleasure]
ref|XP_006303943.1|  hypothetical protein CARUB_v10008690mg             293   7e-92   Capsella rubella
ref|XP_010478853.1|  PREDICTED: IST1 homolog                            294   8e-92   Camelina sativa [gold-of-pleasure]
ref|XP_009403189.1|  PREDICTED: ENHANCER OF AG-4 protein 2-like         294   8e-92   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003518384.1|  PREDICTED: uncharacterized protein DDB_G0271...    291   1e-91   Glycine max [soybeans]
ref|XP_004489726.1|  PREDICTED: dentin sialophosphoprotein-like         291   1e-91   Cicer arietinum [garbanzo]
gb|KFK45126.1|  hypothetical protein AALP_AA1G347400                    293   2e-91   Arabis alpina [alpine rockcress]
gb|ABS32229.1|  hypothetical protein                                    291   3e-91   Carica papaya [mamon]
ref|XP_007151911.1|  hypothetical protein PHAVU_004G086100g             290   3e-91   Phaseolus vulgaris [French bean]
emb|CDX91784.1|  BnaC08g07030D                                          292   3e-91   
ref|XP_007201705.1|  hypothetical protein PRUPE_ppa004125mg             290   3e-91   
ref|XP_008237348.1|  PREDICTED: IST1 homolog                            290   4e-91   Prunus mume [ume]
ref|XP_010939573.1|  PREDICTED: IST1 homolog                            291   4e-91   Elaeis guineensis
ref|XP_008804491.1|  PREDICTED: IST1 homolog                            291   4e-91   Phoenix dactylifera
ref|XP_010543209.1|  PREDICTED: uncharacterized protein LOC104816...    288   6e-91   Tarenaya hassleriana [spider flower]
gb|ABY60784.1|  hypothetical protein                                    289   1e-90   Carica papaya [mamon]
ref|XP_011458445.1|  PREDICTED: IST1-like protein                       289   1e-90   Fragaria vesca subsp. vesca
ref|XP_008464351.1|  PREDICTED: uncharacterized protein LOC103502259    290   2e-90   
gb|ABS32234.1|  hypothetical protein                                    287   5e-90   Carica papaya [mamon]
ref|XP_010261134.1|  PREDICTED: uncharacterized protein LOC104600038    287   8e-90   Nelumbo nucifera [Indian lotus]
ref|XP_008384411.1|  PREDICTED: uncharacterized protein LOC103447017    288   9e-90   
ref|XP_004138362.1|  PREDICTED: uncharacterized protein LOC101208940    288   1e-89   Cucumis sativus [cucumbers]
gb|KJB66152.1|  hypothetical protein B456_010G129400                    286   2e-89   Gossypium raimondii
gb|KHG18028.1|  Uncharacterized protein F383_00577                      285   3e-89   Gossypium arboreum [tree cotton]
ref|XP_002325569.2|  hypothetical protein POPTR_0019s11730g             285   3e-89   
ref|XP_006827078.2|  PREDICTED: IST1 homolog                            285   6e-89   Amborella trichopoda
ref|XP_011002513.1|  PREDICTED: uncharacterized protein LOC105109486    285   1e-88   Populus euphratica
ref|XP_010094831.1|  hypothetical protein L484_016412                   284   2e-88   
gb|EYU43558.1|  hypothetical protein MIMGU_mgv1a005603mg                281   5e-88   Erythranthe guttata [common monkey flower]
ref|XP_009401388.1|  PREDICTED: IST1 homolog                            281   1e-87   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN60958.1|  hypothetical protein VITISV_034688                     281   2e-87   Vitis vinifera
gb|KEH25939.1|  regulator of Vps4 activity in the MVB pathway pro...    281   7e-87   Medicago truncatula
ref|NP_174684.2|  Regulator of Vps4 activity in the MVB pathway p...    281   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ22619.1|  At1g34220                                               281   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|KJB59584.1|  hypothetical protein B456_009G261900                    276   3e-86   Gossypium raimondii
gb|EAZ05774.1|  hypothetical protein OsI_28007                          277   8e-86   Oryza sativa Indica Group [Indian rice]
ref|NP_001061111.1|  Os08g0175200                                       277   9e-86   
ref|NP_001288461.1|  uncharacterized protein LOC103641204               275   3e-85   Zea mays [maize]
ref|XP_006659884.1|  PREDICTED: polycystic kidney disease protein...    278   5e-85   Oryza brachyantha
ref|XP_002893813.1|  hypothetical protein ARALYDRAFT_473574             277   9e-85   
emb|CDM86090.1|  unnamed protein product                                270   2e-83   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003573416.1|  PREDICTED: IST1-like protein                       270   2e-83   Brachypodium distachyon [annual false brome]
ref|XP_004972729.1|  PREDICTED: IST1-like protein-like isoform X2       269   3e-83   
ref|XP_004972728.1|  PREDICTED: IST1-like protein-like isoform X1       270   3e-83   Setaria italica
dbj|BAJ94091.1|  predicted protein                                      268   8e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008676764.1|  PREDICTED: uncharacterized protein LOC100272...    267   2e-82   Zea mays [maize]
gb|EMS63538.1|  hypothetical protein TRIUR3_01260                       265   1e-81   Triticum urartu
ref|XP_006589468.1|  PREDICTED: IST1-like protein-like                  245   3e-75   Glycine max [soybeans]
gb|AFW57124.1|  hypothetical protein ZEAMMB73_703221                    235   2e-74   
gb|ERM94315.1|  hypothetical protein AMTR_s00010p00237800               244   1e-73   Amborella trichopoda
ref|XP_006842294.2|  PREDICTED: vacuolar protein sorting-associat...    234   1e-71   Amborella trichopoda
ref|XP_011622578.1|  PREDICTED: IST1 homolog isoform X1                 234   2e-71   
ref|XP_002971060.1|  hypothetical protein SELMODRAFT_66889              228   3e-71   
ref|XP_002962032.1|  hypothetical protein SELMODRAFT_66879              228   3e-71   
ref|XP_011074152.1|  PREDICTED: vacuolar protein sorting-associat...    237   4e-71   Sesamum indicum [beniseed]
ref|XP_001765737.1|  predicted protein                                  228   7e-71   
ref|XP_010266112.1|  PREDICTED: uncharacterized protein LOC104603713    233   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_001757890.1|  predicted protein                                  223   3e-69   
ref|XP_010265126.1|  PREDICTED: IST1 homolog                            228   4e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010066717.1|  PREDICTED: IST1 homolog                            223   1e-67   Eucalyptus grandis [rose gum]
ref|XP_010051622.1|  PREDICTED: uncharacterized protein LOC104440388    228   1e-66   Eucalyptus grandis [rose gum]
gb|KCW82531.1|  hypothetical protein EUGRSUZ_C03936                     227   1e-66   Eucalyptus grandis [rose gum]
ref|XP_009356835.1|  PREDICTED: IST1 homolog                            220   2e-66   
ref|XP_008339668.1|  PREDICTED: IST1 homolog                            219   2e-66   
ref|XP_009356258.1|  PREDICTED: IST1 homolog                            219   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_009394434.1|  PREDICTED: IST1 homolog                            219   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008360045.1|  PREDICTED: IST1 homolog                            218   1e-65   
ref|XP_007046561.1|  Regulator of Vps4 activity in the MVB pathwa...    218   1e-65   
ref|XP_004497085.1|  PREDICTED: IST1 homolog isoform X1                 218   2e-65   Cicer arietinum [garbanzo]
ref|XP_004497086.1|  PREDICTED: IST1 homolog isoform X2                 218   2e-65   Cicer arietinum [garbanzo]
ref|XP_010921566.1|  PREDICTED: IST1 homolog isoform X2                 218   2e-65   Elaeis guineensis
ref|XP_012089679.1|  PREDICTED: uncharacterized protein LOC105648...    221   3e-65   
ref|XP_008243237.1|  PREDICTED: IST1 homolog                            217   4e-65   Prunus mume [ume]
ref|XP_007222948.1|  hypothetical protein PRUPE_ppa008869mg             217   4e-65   Prunus persica
gb|EPS57911.1|  hypothetical protein M569_16906                         213   5e-65   Genlisea aurea
gb|EEC71300.1|  hypothetical protein OsI_03320                          216   5e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_011079063.1|  PREDICTED: uncharacterized protein LOC105162673    221   6e-65   Sesamum indicum [beniseed]
gb|EYU30364.1|  hypothetical protein MIMGU_mgv1a006443mg                220   6e-65   Erythranthe guttata [common monkey flower]
ref|XP_008389286.1|  PREDICTED: IST1 homolog                            216   7e-65   
ref|XP_006644556.1|  PREDICTED: IST1-like protein-like                  216   8e-65   Oryza brachyantha
gb|EMS45366.1|  hypothetical protein TRIUR3_03192                       215   9e-65   Triticum urartu
ref|XP_003547905.1|  PREDICTED: IST1-like protein-like                  219   9e-65   Glycine max [soybeans]
ref|XP_004140335.1|  PREDICTED: IST1 homolog                            216   1e-64   Cucumis sativus [cucumbers]
gb|KHN35563.1|  IST1-like protein                                       219   1e-64   Glycine soja [wild soybean]
ref|XP_011628969.1|  PREDICTED: uncharacterized protein LOC18424324     219   1e-64   
ref|XP_003536682.1|  PREDICTED: IST1 homolog isoform X1                 215   1e-64   Glycine max [soybeans]
ref|XP_003555907.1|  PREDICTED: IST1 homolog                            215   1e-64   
emb|CBI33275.3|  unnamed protein product                                216   2e-64   Vitis vinifera
ref|NP_001043915.1|  Os01g0687700                                       215   2e-64   
ref|XP_002969507.1|  hypothetical protein SELMODRAFT_91777              211   2e-64   
ref|XP_002986780.1|  hypothetical protein SELMODRAFT_124829             210   2e-64   
emb|CDM83872.1|  unnamed protein product                                214   3e-64   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004969594.1|  PREDICTED: IST1-like protein-like                  214   3e-64   Setaria italica
ref|XP_007044322.1|  Regulator of Vps4 activity in the MVB pathwa...    214   5e-64   Theobroma cacao [chocolate]
gb|ACU23342.1|  unknown                                                 214   5e-64   Glycine max [soybeans]
ref|XP_010935225.1|  PREDICTED: IST1-like protein                       218   7e-64   Elaeis guineensis
ref|XP_002533970.1|  protein with unknown function                      214   7e-64   Ricinus communis
ref|XP_004299071.1|  PREDICTED: IST1 homolog                            213   8e-64   Fragaria vesca subsp. vesca
ref|XP_003635529.1|  PREDICTED: IST1-like protein                       217   8e-64   Vitis vinifera
gb|EMT07440.1|  hypothetical protein F775_26144                         213   9e-64   
ref|XP_003635213.2|  PREDICTED: IST1-like protein                       216   1e-63   Vitis vinifera
ref|NP_001141797.1|  hypothetical protein                               213   1e-63   Zea mays [maize]
ref|XP_010941392.1|  PREDICTED: IST1-like protein                       217   1e-63   Elaeis guineensis
ref|XP_003592663.1|  IST1-like protein                                  211   1e-63   
ref|XP_007046560.1|  Regulator of Vps4 activity in the MVB pathwa...    216   1e-63   
ref|XP_007156216.1|  hypothetical protein PHAVU_003G268000g             216   1e-63   Phaseolus vulgaris [French bean]
ref|XP_003517626.1|  PREDICTED: dentin sialophosphoprotein-like         224   1e-63   
ref|XP_006448467.1|  hypothetical protein CICLE_v10015906mg             213   1e-63   Citrus clementina [clementine]
gb|AFK46378.1|  unknown                                                 213   2e-63   Medicago truncatula
ref|XP_004513087.1|  PREDICTED: dentin sialophosphoprotein-like         224   2e-63   Cicer arietinum [garbanzo]
ref|XP_010921561.1|  PREDICTED: IST1 homolog isoform X1                 214   2e-63   
gb|KCW82257.1|  hypothetical protein EUGRSUZ_C03673                     226   2e-63   Eucalyptus grandis [rose gum]
gb|KCW56546.1|  hypothetical protein EUGRSUZ_I02282                     223   2e-63   Eucalyptus grandis [rose gum]
ref|XP_008781253.1|  PREDICTED: IST1-like protein                       216   3e-63   Phoenix dactylifera
ref|XP_008465781.1|  PREDICTED: IST1 homolog                            212   3e-63   Cucumis melo [Oriental melon]
gb|AES62914.2|  regulator of Vps4 activity in the MVB pathway pro...    212   4e-63   Medicago truncatula
ref|XP_010029609.1|  PREDICTED: IST1-like protein                       216   4e-63   Eucalyptus grandis [rose gum]
gb|KHG01623.1|  Uncharacterized protein F383_21801                      211   4e-63   Gossypium arboreum [tree cotton]
ref|XP_009624176.1|  PREDICTED: IST1 homolog                            211   4e-63   Nicotiana tomentosiformis
ref|XP_006468704.1|  PREDICTED: IST1 homolog                            212   5e-63   Citrus sinensis [apfelsine]
ref|XP_011022214.1|  PREDICTED: IST1 homolog                            211   5e-63   Populus euphratica
ref|XP_003629204.1|  IST1-like protein                                  214   5e-63   
ref|XP_010049566.1|  PREDICTED: uncharacterized protein LOC104438...    224   5e-63   
gb|AET03680.2|  regulator of Vps4 activity in the MVB pathway pro...    214   6e-63   Medicago truncatula
ref|XP_006379742.1|  hypothetical protein POPTR_0008s12030g             211   6e-63   Populus trichocarpa [western balsam poplar]
ref|XP_003569587.1|  PREDICTED: IST1-like protein                       211   7e-63   Brachypodium distachyon [annual false brome]
ref|XP_003519849.1|  PREDICTED: IST1-like protein-like                  214   7e-63   Glycine max [soybeans]
ref|XP_009804183.1|  PREDICTED: IST1 homolog                            211   8e-63   Nicotiana sylvestris
gb|KCW82256.1|  hypothetical protein EUGRSUZ_C03673                     224   8e-63   Eucalyptus grandis [rose gum]
ref|XP_002282696.1|  PREDICTED: IST1-like protein                       211   8e-63   Vitis vinifera
ref|XP_004236982.1|  PREDICTED: IST1 homolog                            211   9e-63   Solanum lycopersicum
ref|XP_011076713.1|  PREDICTED: IST1 homolog isoform X2                 211   9e-63   Sesamum indicum [beniseed]
tpg|DAA58064.1|  TPA: hypothetical protein ZEAMMB73_112435              210   2e-62   
emb|CDX69159.1|  BnaC01g02940D                                          213   2e-62   
gb|KJB43237.1|  hypothetical protein B456_007G189800                    213   2e-62   Gossypium raimondii
ref|XP_010463126.1|  PREDICTED: uncharacterized protein LOC104743778    217   2e-62   
ref|XP_003530191.1|  PREDICTED: dentin sialophosphoprotein-like i...    221   2e-62   Glycine max [soybeans]
gb|KHG16212.1|  IST1-like protein                                       213   2e-62   Gossypium arboreum [tree cotton]
ref|XP_010113265.1|  hypothetical protein L484_026594                   213   3e-62   Morus notabilis
ref|XP_012082098.1|  PREDICTED: IST1 homolog                            210   3e-62   Jatropha curcas
ref|XP_010526826.1|  PREDICTED: uncharacterized protein LOC104804285    214   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_004134834.1|  PREDICTED: IST1-like protein                       213   3e-62   Cucumis sativus [cucumbers]
gb|KJB31432.1|  hypothetical protein B456_005G191700                    209   3e-62   Gossypium raimondii
ref|XP_006283590.1|  hypothetical protein CARUB_v10004646mg             214   3e-62   
ref|XP_009150864.1|  PREDICTED: uncharacterized protein LOC103874176    212   3e-62   Brassica rapa
ref|XP_006412068.1|  hypothetical protein EUTSA_v10025095mg             213   3e-62   
ref|XP_010432238.1|  PREDICTED: uncharacterized protein LOC104716552    213   4e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006352060.1|  PREDICTED: dentin sialophosphoprotein-like         220   5e-62   Solanum tuberosum [potatoes]
ref|XP_008440890.1|  PREDICTED: IST1-like protein                       212   5e-62   Cucumis melo [Oriental melon]
gb|KDO76986.1|  hypothetical protein CISIN_1g020278mg                   209   5e-62   Citrus sinensis [apfelsine]
ref|XP_010446886.1|  PREDICTED: uncharacterized protein LOC104729623    213   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010437435.1|  PREDICTED: uncharacterized protein LOC104721204    213   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004509413.1|  PREDICTED: IST1-like protein-like                  211   7e-62   Cicer arietinum [garbanzo]
gb|KJB43236.1|  hypothetical protein B456_007G189800                    212   8e-62   Gossypium raimondii
ref|XP_007012909.1|  Regulator of Vps4 activity in the MVB pathwa...    220   9e-62   
gb|EPS63330.1|  hypothetical protein M569_11456                         204   1e-61   Genlisea aurea
gb|AES77090.2|  regulator of Vps4 activity in the MVB pathway pro...    219   1e-61   Medicago truncatula
ref|XP_004287747.1|  PREDICTED: uncharacterized protein LOC101305976    212   1e-61   Fragaria vesca subsp. vesca
ref|XP_004243148.1|  PREDICTED: uncharacterized protein LOC101265657    219   1e-61   Solanum lycopersicum
gb|EYU40759.1|  hypothetical protein MIMGU_mgv1a010655mg                207   2e-61   Erythranthe guttata [common monkey flower]
gb|ERM96392.1|  hypothetical protein AMTR_s00001p00238960               218   2e-61   Amborella trichopoda
ref|XP_002521677.1|  protein with unknown function                      211   2e-61   Ricinus communis
ref|XP_007152932.1|  hypothetical protein PHAVU_004G172500g             218   2e-61   Phaseolus vulgaris [French bean]
ref|XP_002869065.1|  hypothetical protein ARALYDRAFT_491075             211   2e-61   
gb|KHN17067.1|  IST1 like                                               207   3e-61   Glycine soja [wild soybean]
ref|XP_009593841.1|  PREDICTED: IST1 homolog                            211   3e-61   Nicotiana tomentosiformis
gb|KFK30216.1|  hypothetical protein AALP_AA7G232900                    210   4e-61   Arabis alpina [alpine rockcress]
ref|XP_011077936.1|  PREDICTED: uncharacterized protein LOC105161...    218   4e-61   
ref|XP_011077935.1|  PREDICTED: uncharacterized protein LOC105161...    218   4e-61   Sesamum indicum [beniseed]
ref|XP_009777469.1|  PREDICTED: uncharacterized protein LOC104227040    211   5e-61   Nicotiana sylvestris
ref|NP_195298.2|  Regulator of Vps4 activity in the MVB pathway p...    210   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683018.1|  PREDICTED: IST1-like protein                       209   7e-61   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP00628.1|  unnamed protein product                                206   7e-61   Coffea canephora [robusta coffee]
ref|XP_008812038.1|  PREDICTED: IST1-like protein                       211   8e-61   Phoenix dactylifera
ref|XP_010090010.1|  hypothetical protein L484_027240                   217   9e-61   Morus notabilis
ref|XP_010924918.1|  PREDICTED: uncharacterized protein LOC105047619    217   9e-61   Elaeis guineensis
ref|XP_008806530.1|  PREDICTED: uncharacterized protein LOC103719...    217   9e-61   Phoenix dactylifera
ref|XP_008806538.1|  PREDICTED: uncharacterized protein LOC103719...    216   1e-60   Phoenix dactylifera
ref|XP_010681608.1|  PREDICTED: IST1 homolog isoform X1                 205   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009401974.1|  PREDICTED: uncharacterized protein LOC103985842    217   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010551261.1|  PREDICTED: IST1 homolog                            205   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_006475395.1|  PREDICTED: dentin sialophosphoprotein-like         216   2e-60   Citrus sinensis [apfelsine]
ref|XP_011076703.1|  PREDICTED: IST1-like protein isoform X1            205   2e-60   
ref|XP_006451405.1|  hypothetical protein CICLE_v10010570mg             216   2e-60   
gb|KDO59271.1|  hypothetical protein CISIN_1g001451mg                   216   2e-60   Citrus sinensis [apfelsine]
ref|XP_012065349.1|  PREDICTED: IST1-like protein                       209   2e-60   Jatropha curcas
ref|XP_012076797.1|  PREDICTED: uncharacterized protein LOC105637...    216   3e-60   Jatropha curcas
ref|XP_007202071.1|  hypothetical protein PRUPE_ppa005964mg             207   4e-60   
ref|XP_004232542.1|  PREDICTED: uncharacterized protein LOC101250180    208   4e-60   Solanum lycopersicum
ref|XP_006340806.1|  PREDICTED: uncharacterized protein LOC102584...    208   4e-60   Solanum tuberosum [potatoes]
ref|XP_009614745.1|  PREDICTED: dentin sialophosphoprotein              215   6e-60   Nicotiana tomentosiformis
ref|XP_009337093.1|  PREDICTED: uncharacterized protein LOC103929596    208   7e-60   Pyrus x bretschneideri [bai li]
ref|XP_006340805.1|  PREDICTED: uncharacterized protein LOC102584...    207   7e-60   Solanum tuberosum [potatoes]
ref|XP_009783674.1|  PREDICTED: dentin sialophosphoprotein              215   7e-60   Nicotiana sylvestris
ref|XP_008242434.1|  PREDICTED: dentin sialophosphoprotein-like         216   8e-60   Prunus mume [ume]
ref|XP_008393582.1|  PREDICTED: uncharacterized protein DDB_G0271670    207   9e-60   
ref|XP_009418373.1|  PREDICTED: IST1-like protein                       203   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002279892.1|  PREDICTED: uncharacterized protein LOC100256...    214   1e-59   Vitis vinifera
emb|CDP01823.1|  unnamed protein product                                207   1e-59   Coffea canephora [robusta coffee]
ref|XP_008797910.1|  PREDICTED: uncharacterized protein LOC103712964    214   1e-59   
ref|XP_010656225.1|  PREDICTED: uncharacterized protein LOC100256...    214   1e-59   Vitis vinifera
emb|CDY69937.1|  BnaAnng32080D                                          205   1e-59   Brassica napus [oilseed rape]
ref|XP_010912111.1|  PREDICTED: sericin 1-like                          213   2e-59   Elaeis guineensis
ref|XP_011010805.1|  PREDICTED: uncharacterized protein LOC105115575    214   2e-59   Populus euphratica
ref|XP_009392873.1|  PREDICTED: IST1-like protein                       206   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011007786.1|  PREDICTED: uncharacterized protein LOC105113...    206   2e-59   Populus euphratica
ref|XP_008241981.1|  PREDICTED: uncharacterized protein LOC103340355    206   2e-59   Prunus mume [ume]
ref|XP_008337952.1|  PREDICTED: uncharacterized protein LOC103401027    206   2e-59   
ref|XP_002514165.1|  protein with unknown function                      213   2e-59   Ricinus communis
ref|XP_008352419.1|  PREDICTED: uncharacterized protein LOC103415915    206   2e-59   
gb|KHN32904.1|  IST1-like protein                                       213   2e-59   Glycine soja [wild soybean]
ref|XP_008450820.1|  PREDICTED: probable GPI-anchored adhesin-lik...    213   3e-59   Cucumis melo [Oriental melon]
ref|XP_003524418.1|  PREDICTED: suppressor protein SRP40-like           208   3e-59   
ref|XP_011007785.1|  PREDICTED: uncharacterized protein LOC105113...    206   3e-59   Populus euphratica
ref|XP_011622580.1|  PREDICTED: uncharacterized protein LOC184321...    201   3e-59   Amborella trichopoda
ref|XP_009352609.1|  PREDICTED: filaggrin isoform X2                    213   3e-59   Pyrus x bretschneideri [bai li]
emb|CDY41639.1|  BnaC03g62450D                                          204   4e-59   Brassica napus [oilseed rape]
emb|CAN83622.1|  hypothetical protein VITISV_007919                     214   4e-59   Vitis vinifera
ref|XP_009352608.1|  PREDICTED: filaggrin isoform X1                    213   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_010666831.1|  PREDICTED: uncharacterized protein LOC104883...    212   5e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010262216.1|  PREDICTED: uncharacterized protein LOC104600776    213   5e-59   
ref|XP_010666830.1|  PREDICTED: uncharacterized protein LOC104883...    212   5e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|ERN03969.1|  hypothetical protein AMTR_s00079p00103020               200   5e-59   Amborella trichopoda
ref|XP_002308291.2|  hypothetical protein POPTR_0006s15430g             212   5e-59   
gb|KDO71425.1|  hypothetical protein CISIN_1g012264mg                   204   6e-59   Citrus sinensis [apfelsine]
emb|CAA20043.1|  putative protein                                       204   7e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305211.1|  hypothetical protein CARUB_v10009577mg             201   7e-59   
ref|XP_006467048.1|  PREDICTED: IST1-like protein-like                  204   8e-59   Citrus sinensis [apfelsine]
ref|XP_004135813.1|  PREDICTED: uncharacterized protein LOC101217093    211   1e-58   Cucumis sativus [cucumbers]
gb|KJB59583.1|  hypothetical protein B456_009G261900                    203   2e-58   Gossypium raimondii
emb|CDP03201.1|  unnamed protein product                                211   2e-58   Coffea canephora [robusta coffee]
dbj|BAK06249.1|  predicted protein                                      204   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010460384.1|  PREDICTED: IST1 homolog                            199   3e-58   Camelina sativa [gold-of-pleasure]
gb|EPS66564.1|  hypothetical protein M569_08211                         201   5e-58   Genlisea aurea
ref|NP_001130202.1|  uncharacterized protein LOC100191296               202   7e-58   Zea mays [maize]
ref|XP_006415870.1|  hypothetical protein EUTSA_v10008210mg             198   7e-58   Eutrema salsugineum [saltwater cress]
ref|XP_008367261.1|  PREDICTED: probable GPI-anchored adhesin-lik...    210   7e-58   
ref|XP_009109280.1|  PREDICTED: uncharacterized protein LOC103834941    201   8e-58   Brassica rapa
ref|XP_008361315.1|  PREDICTED: probable GPI-anchored adhesin-lik...    209   8e-58   
ref|XP_010499113.1|  PREDICTED: IST1 homolog                            197   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010267034.1|  PREDICTED: uncharacterized protein LOC104604...    209   1e-57   
ref|XP_010267033.1|  PREDICTED: uncharacterized protein LOC104604...    209   1e-57   
ref|XP_007012910.1|  Uncharacterized protein isoform 2                  208   1e-57   
ref|XP_004957548.1|  PREDICTED: uncharacterized protein LOC101771957    202   1e-57   
ref|XP_002462783.1|  hypothetical protein SORBIDRAFT_02g031850          202   1e-57   
ref|XP_008391519.1|  PREDICTED: dentin sialophosphoprotein-like         209   1e-57   
gb|AAM66100.1|  unknown                                                 197   1e-57   
ref|XP_002893427.1|  hypothetical protein ARALYDRAFT_890165             197   1e-57   
ref|NP_564235.1|  Vps4 activity in the MVB pathway regulator            197   2e-57   
gb|KFK44522.1|  hypothetical protein AALP_AA1G267500                    197   2e-57   
gb|EYU30662.1|  hypothetical protein MIMGU_mgv1a000491mg                208   2e-57   
ref|XP_010238462.1|  PREDICTED: uncharacterized protein LOC100823111    200   2e-57   
ref|XP_009103065.1|  PREDICTED: IST1 homolog                            197   2e-57   
ref|XP_004288917.1|  PREDICTED: mucin-5AC                               208   3e-57   
dbj|BAD46466.1|  unknown protein                                        199   3e-57   
ref|XP_010477930.1|  PREDICTED: IST1 homolog                            197   5e-57   
emb|CDY53122.1|  BnaCnng24500D                                          196   6e-57   
gb|EEC84993.1|  hypothetical protein OsI_32271                          199   7e-57   
ref|XP_008809518.1|  PREDICTED: uncharacterized protein LOC103721...    200   7e-57   
ref|NP_001063848.1|  Os09g0547200                                       199   7e-57   
ref|XP_008337638.1|  PREDICTED: dentin sialophosphoprotein isofor...    206   1e-56   
ref|XP_008337637.1|  PREDICTED: dentin sialophosphoprotein isofor...    206   1e-56   
ref|XP_006853993.1|  PREDICTED: uncharacterized protein LOC18443749     205   2e-56   
gb|KJB54338.1|  hypothetical protein B456_009G030200                    204   2e-56   
ref|XP_006661501.1|  PREDICTED: uncharacterized protein LOC102720632    197   3e-56   
ref|NP_001044016.2|  Os01g0706400                                       204   6e-56   
gb|EAY75540.1|  hypothetical protein OsI_03445                          204   6e-56   
gb|KJB07242.1|  hypothetical protein B456_001G010500                    202   6e-56   
gb|KDO83979.1|  hypothetical protein CISIN_1g009857mg                   196   8e-56   
ref|XP_007142916.1|  hypothetical protein PHAVU_007G027900g             192   8e-56   
gb|KHG18435.1|  IST1-like protein                                       201   9e-56   
ref|XP_007203540.1|  hypothetical protein PRUPE_ppb008146mg             191   1e-55   
ref|XP_010681609.1|  PREDICTED: IST1 homolog isoform X2                 191   2e-55   
ref|XP_004969692.1|  PREDICTED: dentin sialophosphoprotein-like         202   2e-55   
ref|XP_010103752.1|  hypothetical protein L484_014641                   191   2e-55   
ref|XP_010499965.1|  PREDICTED: IST1 homolog isoform X3                 197   2e-55   
ref|XP_002456226.1|  hypothetical protein SORBIDRAFT_03g032440          202   3e-55   
ref|XP_006646252.1|  PREDICTED: dentin sialophosphoprotein-like         201   7e-55   
ref|XP_008656796.1|  PREDICTED: dentin sialophosphoprotein-like         201   9e-55   
gb|KHM99838.1|  IST1-like protein                                       196   1e-54   
ref|XP_006589691.1|  PREDICTED: IST1 homolog isoform X2                 187   6e-54   
ref|XP_003620872.1|  IST1-like protein                                  197   7e-54   
gb|KHN40346.1|  IST1-like protein                                       197   8e-54   
gb|EYU41608.1|  hypothetical protein MIMGU_mgv1a000472mg                197   1e-53   
gb|KJB65101.1|  hypothetical protein B456_010G081100                    197   1e-53   
gb|EMT23882.1|  hypothetical protein F775_12691                         190   2e-53   
ref|XP_003569648.1|  PREDICTED: uncharacterized protein LOC100838789    196   3e-53   
emb|CDX82713.1|  BnaC07g01530D                                          194   7e-53   
gb|KJB31434.1|  hypothetical protein B456_005G191700                    182   3e-52   
ref|XP_006425319.1|  hypothetical protein CICLE_v10026997mg             191   3e-52   
ref|XP_009102144.1|  PREDICTED: uncharacterized protein LOC103828286    192   3e-52   
ref|NP_179561.2|  Vps4 regulator of MVB pathway                         192   4e-52   
dbj|BAF01603.1|  hypothetical protein                                   192   4e-52   
ref|XP_010489136.1|  PREDICTED: uncharacterized protein LOC104766867    191   8e-52   
gb|AAC62144.1|  hypothetical protein                                    191   9e-52   
gb|AAQ62878.1|  At2g19710                                               191   9e-52   
emb|CDM83721.1|  unnamed protein product                                192   9e-52   
ref|XP_010416745.1|  PREDICTED: uncharacterized protein LOC104702567    190   1e-51   
ref|XP_010495939.1|  PREDICTED: uncharacterized protein LOC104773084    190   1e-51   
ref|XP_004497088.1|  PREDICTED: IST1 homolog                            174   6e-51   
ref|XP_006296926.1|  hypothetical protein CARUB_v10012919mg             187   1e-50   
gb|EMT04508.1|  hypothetical protein F775_29471                         183   2e-50   
ref|XP_002886026.1|  hypothetical protein ARALYDRAFT_480500             186   3e-50   
ref|XP_006408888.1|  hypothetical protein EUTSA_v10001901mg             186   7e-50   
ref|XP_010541020.1|  PREDICTED: flocculation protein FLO11-like         185   1e-49   
ref|XP_010526411.1|  PREDICTED: protein IWS1 homolog A-like             183   7e-49   
gb|EMT13152.1|  hypothetical protein F775_31310                         182   3e-48   
ref|XP_002963979.1|  hypothetical protein SELMODRAFT_66952              165   6e-47   
ref|XP_010438300.1|  PREDICTED: apoptotic chromatin condensation ...    169   8e-44   
ref|XP_006283052.1|  hypothetical protein CARUB_v10004047mg             169   8e-44   
ref|NP_194673.2|  regulator of Vps4 activity protein                    169   8e-44   
ref|XP_004289053.1|  PREDICTED: IST1 homolog                            160   1e-43   
emb|CAB79702.1|  putative protein                                       169   1e-43   
emb|CDY43502.1|  BnaA01g07420D                                          167   2e-43   
gb|KEH20362.1|  regulator of Vps4 activity in the MVB pathway pro...    161   2e-43   
gb|KCW82532.1|  hypothetical protein EUGRSUZ_C03936                     163   5e-43   
ref|XP_010447853.1|  PREDICTED: WASH complex subunit FAM21-like         167   5e-43   
ref|XP_009128739.1|  PREDICTED: uncharacterized protein LOC103853...    166   7e-43   
ref|XP_009128734.1|  PREDICTED: uncharacterized protein LOC103853...    166   7e-43   
ref|XP_002867408.1|  hypothetical protein ARALYDRAFT_491814             166   8e-43   
ref|XP_008352573.1|  PREDICTED: uncharacterized protein LOC103416083    164   2e-42   
gb|EEE55206.1|  hypothetical protein OsJ_03059                          155   4e-42   
ref|XP_010267035.1|  PREDICTED: uncharacterized protein LOC104604...    164   5e-42   
ref|NP_001031748.1|  regulator of Vps4 activity protein                 161   4e-41   
emb|CDY48635.1|  BnaC06g08120D                                          154   6e-41   
ref|XP_001767597.1|  predicted protein                                  150   8e-41   
emb|CDY04642.1|  BnaC05g16800D                                          147   3e-40   
ref|XP_010049567.1|  PREDICTED: uncharacterized protein LOC104438...    157   1e-39   
emb|CBI38472.3|  unnamed protein product                                155   1e-39   
gb|KJB30340.1|  hypothetical protein B456_005G138400                    153   2e-39   
gb|KJB30342.1|  hypothetical protein B456_005G138400                    152   2e-39   
ref|XP_006412839.1|  hypothetical protein EUTSA_v10027451mg             156   2e-39   
ref|XP_008358108.1|  PREDICTED: IST1 homolog                            143   3e-39   
ref|XP_008358845.1|  PREDICTED: IST1 homolog                            143   3e-39   
ref|XP_011008198.1|  PREDICTED: uncharacterized protein LOC105113641    151   5e-39   
gb|KHG22343.1|  IST1-like protein                                       151   5e-39   
gb|KEH27251.1|  regulator of Vps4 activity in the MVB pathway pro...    153   2e-38   
gb|KJB43238.1|  hypothetical protein B456_007G189800                    147   2e-38   
ref|XP_002314874.2|  hypothetical protein POPTR_0010s13710g             149   2e-38   
ref|XP_010102823.1|  hypothetical protein L484_007846                   148   4e-38   
gb|KEH30755.1|  regulator of Vps4 activity in the MVB pathway pro...    147   5e-38   
ref|XP_009356565.1|  PREDICTED: uncharacterized protein LOC103947383    148   5e-38   
gb|AES89896.2|  regulator of Vps4 activity in the MVB pathway pro...    147   5e-38   
ref|XP_003607699.1|  IST1-like protein                                  148   7e-38   
ref|XP_010433096.1|  PREDICTED: WASH complex subunit FAM21-like         151   1e-37   
ref|XP_010926145.1|  PREDICTED: uncharacterized protein LOC105048521    147   2e-37   
ref|XP_002529127.1|  protein with unknown function                      147   2e-37   
ref|XP_008339689.1|  PREDICTED: suppressor protein SRP40                145   4e-37   
gb|KJB30341.1|  hypothetical protein B456_005G138400                    145   1e-36   
ref|XP_006437697.1|  hypothetical protein CICLE_v10031654mg             144   1e-36   
gb|EMS57508.1|  hypothetical protein TRIUR3_09539                       143   2e-36   
ref|XP_007157593.1|  hypothetical protein PHAVU_002G082300g             143   3e-36   
gb|EEE55269.1|  hypothetical protein OsJ_03189                          147   3e-36   
ref|NP_001239723.1|  uncharacterized protein LOC100812818               143   4e-36   
gb|KHN48544.1|  IST1-like protein                                       142   4e-36   
emb|CDP00601.1|  unnamed protein product                                144   4e-36   
ref|XP_010265173.1|  PREDICTED: uncharacterized protein LOC104602...    144   5e-36   
ref|XP_010265172.1|  PREDICTED: uncharacterized protein LOC104602...    144   5e-36   
ref|XP_006484441.1|  PREDICTED: uncharacterized protein LOC102630467    142   6e-36   
ref|XP_008446583.1|  PREDICTED: protein gar2                            142   8e-36   
ref|XP_008243205.1|  PREDICTED: IST1 homolog                            142   1e-35   
ref|XP_008775064.1|  PREDICTED: uncharacterized protein LOC103695492    142   2e-35   
ref|XP_010263421.1|  PREDICTED: uncharacterized protein LOC104601...    142   2e-35   
ref|XP_010263425.1|  PREDICTED: uncharacterized protein LOC104601...    142   2e-35   
ref|XP_004135100.1|  PREDICTED: uncharacterized protein LOC101220964    141   2e-35   
ref|XP_002516728.1|  protein with unknown function                      141   2e-35   
ref|NP_001242560.1|  uncharacterized protein LOC100810665               140   3e-35   
ref|XP_007223096.1|  hypothetical protein PRUPE_ppa007059mg             140   3e-35   
ref|XP_009421191.1|  PREDICTED: uncharacterized protein LOC104000785    141   4e-35   
ref|XP_004497106.1|  PREDICTED: uncharacterized protein LOC101503192    139   4e-35   
ref|XP_008781099.1|  PREDICTED: uncharacterized protein LOC103700966    140   4e-35   
gb|KJB80123.1|  hypothetical protein B456_013G081600                    139   6e-35   
ref|XP_009405897.1|  PREDICTED: uncharacterized protein LOC103988932    140   8e-35   
gb|ABS01355.1|  unknown                                                 139   1e-34   
ref|XP_010916157.1|  PREDICTED: uncharacterized protein LOC105041064    140   1e-34   
ref|XP_008360162.1|  PREDICTED: suppressor protein SRP40-like           139   1e-34   
ref|XP_010066733.1|  PREDICTED: uncharacterized protein LOC104453806    139   1e-34   
ref|XP_007033286.1|  Regulator of Vps4 activity in the MVB pathwa...    139   2e-34   
ref|XP_009837968.1|  hypothetical protein H257_12455                    136   2e-34   
ref|XP_004238941.1|  PREDICTED: biorientation of chromosomes in c...    139   2e-34   
ref|XP_008868092.1|  hypothetical protein H310_05213                    135   2e-34   
ref|XP_009770598.1|  PREDICTED: uncharacterized protein LOC104221...    139   2e-34   
ref|XP_009770596.1|  PREDICTED: uncharacterized protein LOC104221...    138   3e-34   
ref|XP_012077963.1|  PREDICTED: IST1 homolog                            135   4e-34   
ref|NP_973910.1|  Vps4 activity in the MVB pathway regulator            134   5e-34   
ref|XP_009403745.1|  PREDICTED: uncharacterized protein LOC103987230    137   5e-34   
emb|CAN68344.1|  hypothetical protein VITISV_004018                     137   6e-34   
dbj|BAJ93689.1|  predicted protein                                      129   8e-34   
ref|XP_006838419.1|  PREDICTED: uncharacterized protein LOC18429063     137   1e-33   
ref|XP_008448268.1|  PREDICTED: uncharacterized protein LOC103490509    137   1e-33   
ref|XP_006362561.1|  PREDICTED: uncharacterized protein LOC102592415    136   1e-33   
ref|XP_010681583.1|  PREDICTED: uncharacterized protein LOC104896525    136   1e-33   
gb|KHG23590.1|  IST1-like protein                                       135   2e-33   
gb|KJB44080.1|  hypothetical protein B456_007G233300                    135   2e-33   
ref|XP_007046265.1|  Regulator of Vps4 activity in the MVB pathwa...    136   2e-33   
ref|XP_010245319.1|  PREDICTED: uncharacterized protein LOC104588894    138   2e-33   
ref|XP_002516729.1|  protein with unknown function                      135   3e-33   
ref|XP_010242011.1|  PREDICTED: uncharacterized protein LOC104586459    137   3e-33   
emb|CBI27039.3|  unnamed protein product                                135   3e-33   
ref|XP_003541917.1|  PREDICTED: uncharacterized protein LOC100810...    137   4e-33   
ref|XP_011070818.1|  PREDICTED: uncharacterized protein LOC105156397    135   5e-33   
ref|XP_011021230.1|  PREDICTED: IST1-like protein                       132   6e-33   
ref|XP_011097187.1|  PREDICTED: uncharacterized protein LOC105176162    132   6e-33   
ref|XP_010647794.1|  PREDICTED: uncharacterized protein LOC100252495    134   8e-33   
ref|XP_012082069.1|  PREDICTED: uncharacterized protein LOC105642009    134   1e-32   
ref|XP_006430790.1|  hypothetical protein CICLE_v10013590mg             130   1e-32   
ref|XP_009617354.1|  PREDICTED: uncharacterized protein LOC104109712    134   1e-32   
emb|CBI28894.3|  unnamed protein product                                129   1e-32   
ref|XP_010044275.1|  PREDICTED: uncharacterized protein LOC104433287    132   2e-32   
ref|XP_011035047.1|  PREDICTED: uncharacterized protein LOC105132...    133   3e-32   
gb|KCW86342.1|  hypothetical protein EUGRSUZ_B03030                     132   3e-32   
ref|XP_002280096.2|  PREDICTED: uncharacterized protein LOC100249716    133   3e-32   
ref|XP_011035046.1|  PREDICTED: uncharacterized protein LOC105132...    133   4e-32   
ref|XP_010034440.1|  PREDICTED: uncharacterized protein LOC104423678    128   4e-32   
ref|XP_008680714.1|  PREDICTED: uncharacterized protein LOC103655799    133   5e-32   
ref|XP_007043550.1|  Regulator of Vps4 activity in the MVB pathwa...    134   5e-32   
gb|KCW52060.1|  hypothetical protein EUGRSUZ_J01499                     127   5e-32   
ref|XP_008237201.1|  PREDICTED: IST1 homolog                            127   5e-32   
gb|KJB50093.1|  hypothetical protein B456_008G153500                    133   6e-32   
ref|XP_009343396.1|  PREDICTED: uncharacterized protein LOC103935361    132   7e-32   
gb|KDO58992.1|  hypothetical protein CISIN_1g010606mg                   131   1e-31   
ref|XP_007214929.1|  hypothetical protein PRUPE_ppa002722mg             132   1e-31   
ref|XP_008227648.1|  PREDICTED: IST1 homolog                            125   2e-31   
gb|KEH44246.1|  regulator of Vps4 activity in the MVB pathway pro...    129   2e-31   
ref|XP_004140030.2|  PREDICTED: uncharacterized protein LOC101206370    130   2e-31   
ref|XP_009357120.1|  PREDICTED: uncharacterized protein LOC103947882    130   3e-31   
gb|KEH39104.1|  regulator of Vps4 activity in the MVB pathway pro...    130   5e-31   
ref|XP_011622305.1|  PREDICTED: uncharacterized protein LOC184314...    131   6e-31   
ref|XP_007200075.1|  hypothetical protein PRUPE_ppa021284mg             124   6e-31   
ref|XP_011622307.1|  PREDICTED: uncharacterized protein LOC184314...    131   6e-31   
gb|ERN03346.1|  hypothetical protein AMTR_s00003p00244140               131   7e-31   
ref|XP_008365524.1|  PREDICTED: uncharacterized protein LOC103429159    129   7e-31   
ref|XP_006482262.1|  PREDICTED: lisH domain-containing protein C1...    129   7e-31   
gb|KDO34885.1|  hypothetical protein SPRG_00943                         126   7e-31   
ref|XP_006592838.1|  PREDICTED: uncharacterized protein LOC102669...    130   7e-31   
ref|XP_008348272.1|  PREDICTED: uncharacterized protein LOC103411414    129   8e-31   
ref|XP_004297125.1|  PREDICTED: uncharacterized protein LOC101300241    128   8e-31   
gb|KHN27876.1|  IST1-like protein                                       130   9e-31   
ref|XP_009341401.1|  PREDICTED: IST1 homolog                            122   9e-31   
ref|XP_006592837.1|  PREDICTED: uncharacterized protein LOC102669...    130   9e-31   
ref|XP_008605099.1|  hypothetical protein SDRG_01356                    126   1e-30   
ref|XP_010103786.1|  hypothetical protein L484_008638                   130   1e-30   
ref|XP_006650481.1|  PREDICTED: uncharacterized protein LOC102710004    127   1e-30   
gb|AFK35852.1|  unknown                                                 127   2e-30   
ref|XP_008230406.1|  PREDICTED: uncharacterized protein LOC103329684    129   2e-30   
gb|KFK43596.1|  hypothetical protein AALP_AA1G146900                    127   2e-30   
ref|XP_010657261.1|  PREDICTED: uncharacterized protein LOC104880874    129   3e-30   
ref|XP_007200052.1|  hypothetical protein PRUPE_ppa023533mg             122   3e-30   
dbj|BAD82254.1|  unknown protein                                        129   4e-30   
ref|XP_002306666.2|  hypothetical protein POPTR_0005s15750g             124   4e-30   
ref|XP_011651370.1|  PREDICTED: uncharacterized protein LOC105434...    125   4e-30   
ref|XP_008461584.1|  PREDICTED: uncharacterized protein LOC103500154    126   5e-30   
ref|XP_007211156.1|  hypothetical protein PRUPE_ppa027096mg             121   5e-30   
ref|XP_010103796.1|  hypothetical protein L484_008648                   125   7e-30   
gb|EPS67872.1|  hypothetical protein M569_06903                         123   1e-29   
ref|XP_011651369.1|  PREDICTED: uncharacterized protein LOC105434...    125   1e-29   
ref|XP_002305812.2|  hypothetical protein POPTR_0004s10010g             126   1e-29   
ref|XP_008237203.1|  PREDICTED: IST1 homolog                            120   1e-29   
gb|KJB80124.1|  hypothetical protein B456_013G081600                    124   2e-29   
gb|KHN36623.1|  IST1-like protein                                       126   3e-29   
ref|XP_008341903.1|  PREDICTED: uncharacterized protein LOC103404727    125   3e-29   



>ref|XP_006354036.1| PREDICTED: uncharacterized protein LOC102585287 [Solanum tuberosum]
Length=528

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF+KGFKAAKCKT+LKLTIPRIKLLRNRRE QLKQMRKEIAKLLETGQEATARIRVE
Sbjct  1    MDSFFSKGFKAAKCKTMLKLTIPRIKLLRNRREFQLKQMRKEIAKLLETGQEATARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  61   HIIREEKMMAAQEIVELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELL  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F GKYGKEF+AAATEL PECGVNRQLIELLSIRAPAPDVK+K+LKEIAEEH+L
Sbjct  121  QVQMMFAGKYGKEFIAAATELMPECGVNRQLIELLSIRAPAPDVKMKLLKEIAEEHQL  178



>ref|NP_001275331.1| uncharacterized protein LOC102585287 [Solanum tuberosum]
 dbj|BAE46414.1| hypothetical protein [Solanum tuberosum]
Length=528

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF+KGFKAAKCKT+LKLTIPRIKLLRNRRE QLKQMRKEIAKLLETGQEATARIRVE
Sbjct  1    MDSFFSKGFKAAKCKTMLKLTIPRIKLLRNRREFQLKQMRKEIAKLLETGQEATARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  61   HIIREEKMMAAQEIVELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELL  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F GKYGKEF+AAATEL PECGVNRQLIELLSIRAPAPDVK+K+LKEIAEEH+L
Sbjct  121  QVQMMFAGKYGKEFIAAATELMPECGVNRQLIELLSIRAPAPDVKMKLLKEIAEEHQL  178



>ref|XP_004237874.1| PREDICTED: uncharacterized protein LOC101268389 [Solanum lycopersicum]
Length=528

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF+KGFKAAKCKT+LKLTIPRIKLLRNRRE QLKQMRKEIAKLLETGQEATARIRVE
Sbjct  1    MDSFFSKGFKAAKCKTMLKLTIPRIKLLRNRREFQLKQMRKEIAKLLETGQEATARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  61   HIIREEKMMAAQEIVELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELL  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQL F GKYGKEF+ AATEL PECGVNRQLIELLSIRAPAPDVK+K+LKEIAEEH+L
Sbjct  121  QVQLMFAGKYGKEFITAATELMPECGVNRQLIELLSIRAPAPDVKMKLLKEIAEEHQL  178



>ref|XP_009773832.1| PREDICTED: uncharacterized protein LOC104223983 [Nicotiana sylvestris]
 ref|XP_009773840.1| PREDICTED: uncharacterized protein LOC104223983 [Nicotiana sylvestris]
Length=532

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF+KGFKAAKCKTLLKLTIPRIKLLRNRRE+QLKQMRKEIAKLLETGQEATARIRVE
Sbjct  1    MDSFFSKGFKAAKCKTLLKLTIPRIKLLRNRREMQLKQMRKEIAKLLETGQEATARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  61   HIIREEKMMAAQEIVELFCELISVRLPIIEAQRECPLDLKEAISSICFAAPRCADLPELL  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F GKYGKEFV AATEL PECGVNRQLIELLSIRAPAPDVKLK+LKEIAEE+EL
Sbjct  121  QVQMLFVGKYGKEFVTAATELMPECGVNRQLIELLSIRAPAPDVKLKLLKEIAEENEL  178



>ref|XP_009591345.1| PREDICTED: uncharacterized protein LOC104088390 [Nicotiana tomentosiformis]
Length=530

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF+KGFKAAKCKTLLKLTIPRIKLLRNRRE+QL+QMRKEIAKLLETGQEATARIRVE
Sbjct  1    MDSFFSKGFKAAKCKTLLKLTIPRIKLLRNRREMQLRQMRKEIAKLLETGQEATARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  61   HIIREEKMMAAQEIVELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELL  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F GKYGKEFVAAATEL PECGVNRQLIELLSIRAPAPD KLK+LKEIAEE+EL
Sbjct  121  QVQMLFVGKYGKEFVAAATELMPECGVNRQLIELLSIRAPAPDAKLKLLKEIAEENEL  178



>ref|XP_011074151.1| PREDICTED: uncharacterized protein LOC105158932 isoform X1 [Sesamum 
indicum]
Length=518

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRR+IQ+K MR+EIAKLLETGQEATARIRVE
Sbjct  2    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRRDIQMKNMRREIAKLLETGQEATARIRVE  61

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKM AAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  62   HIIREEKMTAAQEIVELFCELITVRLPIIEAQRECPLDLKEAISSLCFAAPRCADLPELL  121

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F GKY KEFV+AATELRPECGVNRQL+ELLS+RAPAPDVKLK+LKEIAEEHEL
Sbjct  122  QVQMMFAGKYSKEFVSAATELRPECGVNRQLVELLSVRAPAPDVKLKLLKEIAEEHEL  179



>ref|XP_010543191.1| PREDICTED: uncharacterized protein LOC104816186 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543201.1| PREDICTED: uncharacterized protein LOC104816186 isoform X1 [Tarenaya 
hassleriana]
Length=494

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKA+KCKTLLKLT+PRIKLLRNRRE+Q+KQMR+EI+KLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKASKCKTLLKLTVPRIKLLRNRREVQIKQMRREISKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HI+REEKMMAAQEI+ELFCELI+VRLP+IEAQRECPLDLKEAISSVCFAAPRCADLPELQ
Sbjct  64   HIVREEKMMAAQEILELFCELIAVRLPVIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ++F  KYGKEFVAAA ELRP+CGVNR+L+ELLS+RAP+P+ KLK+LK+IAEEHEL
Sbjct  124  QVQMSFVSKYGKEFVAAAAELRPDCGVNRKLVELLSVRAPSPETKLKLLKDIAEEHEL  181



>ref|XP_011083402.1| PREDICTED: uncharacterized protein LOC105165944 [Sesamum indicum]
Length=522

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFF + F AAKCKTLLKLTIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE
Sbjct  4    LDSFFKQRFNAAKCKTLLKLTIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQR+CPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREEKMMAAQEIVELFCELIAVRLPIIEAQRDCPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F GKYGKEFV+AATEL PECGVNRQLIELLSIRAPAPDVKLK+LKEIAEE+EL
Sbjct  124  QVQILFAGKYGKEFVSAATELMPECGVNRQLIELLSIRAPAPDVKLKLLKEIAEEYEL  181



>ref|XP_012089676.1| PREDICTED: IST1-like protein isoform X1 [Jatropha curcas]
 ref|XP_012089677.1| PREDICTED: IST1-like protein isoform X1 [Jatropha curcas]
 ref|XP_012089678.1| PREDICTED: IST1-like protein isoform X1 [Jatropha curcas]
 gb|KDP22885.1| hypothetical protein JCGZ_01959 [Jatropha curcas]
Length=520

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEILELFCELISVRLPIIEAQRECPLDLKEAISSICFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL PECGVNRQLIELLSIRAP+P+VKLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGKEFVAAASELMPECGVNRQLIELLSIRAPSPEVKLKLLKEIAEEHEL  181



>gb|KJB59582.1| hypothetical protein B456_009G261900 [Gossypium raimondii]
Length=516

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  1    MDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELI+VRLPIIE QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  61   HIIREENMMAAQEILELFCELIAVRLPIIETQRECPLDLKEAISSVCFAAPRCADLPELL  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AA+ELRP+CGVNRQLIELLSIR P+P+VKLK+LKEIAEEHEL
Sbjct  121  QVQMLFASKYGKEFVSAASELRPDCGVNRQLIELLSIRVPSPEVKLKILKEIAEEHEL  178



>ref|XP_011038197.1| PREDICTED: IST1 homolog [Populus euphratica]
 ref|XP_011038198.1| PREDICTED: IST1 homolog [Populus euphratica]
Length=579

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+K MR++IAKLLETGQEATARIRVE
Sbjct  4    IDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQMKHMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELISVRLPIIE QRECPLDLKEAISSVCFAAPRCADLPELQ
Sbjct  64   HIIREENMMAAQEIIELFCELISVRLPIIETQRECPLDLKEAISSVCFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATEL P CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQILFASKYGKEFVAAATELMPSCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHEL  181



>ref|XP_010692212.1| PREDICTED: IST1 homolog [Beta vulgaris subsp. vulgaris]
Length=502

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF+KGFK +KCKTLLKL+IPRIKLLRNRRE+Q+KQMRK+IAKLLETGQEATARIRVE
Sbjct  2    MDSFFSKGFKGSKCKTLLKLSIPRIKLLRNRRELQIKQMRKDIAKLLETGQEATARIRVE  61

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HI+REE MMAAQEIIELFCELI+VRLPIIE+QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  62   HIVREENMMAAQEIIELFCELITVRLPIIESQRECPLDLKEAISSICFAAPRCADLPELL  121

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQL+F  KYGKEFVAAATEL P+CGVNRQL+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  122  QVQLSFVSKYGKEFVAAATELMPDCGVNRQLVELLSVRAPSPEKKLKLLKEIAEEHEL  179



>ref|XP_010501779.1| PREDICTED: IST1 homolog [Camelina sativa]
Length=213

 Score =   290 bits (742),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISS+CFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSICFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQILFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAEEHEL  181



>ref|XP_002534491.1| protein with unknown function [Ricinus communis]
 gb|EEF27891.1| protein with unknown function [Ricinus communis]
Length=531

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKA KCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKATKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISS+CFAAPRCADL EL 
Sbjct  64   HIIREENMMAAQEILELFCELISVRLPIIEAQRECPLDLKEAISSICFAAPRCADLQELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYG+EFVAAATEL PECGVNRQLIELLS+RAP+PDVKLK+LKEIAEEHEL
Sbjct  124  QVQMLFVSKYGREFVAAATELMPECGVNRQLIELLSVRAPSPDVKLKLLKEIAEEHEL  181



>ref|XP_010530141.1| PREDICTED: IST1 homolog [Tarenaya hassleriana]
Length=492

 Score =   299 bits (765),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLT PRIKLLRNRRE+Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTTPRIKLLRNRREVQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HI+REEKMMAAQEIIELFCEL++VRLPIIE+QRECPLDLKEAISSVCFAAPRCADLPELQ
Sbjct  64   HIVREEKMMAAQEIIELFCELMAVRLPIIESQRECPLDLKEAISSVCFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATELRP+CGVNR+L+ELLS+ AP+P+ KLK+LK+IAEEHEL
Sbjct  124  QVQMLFVSKYGKEFVAAATELRPDCGVNRKLVELLSVCAPSPETKLKLLKDIAEEHEL  181



>ref|XP_010063798.1| PREDICTED: IST1 homolog [Eucalyptus grandis]
 gb|KCW71052.1| hypothetical protein EUGRSUZ_F04150 [Eucalyptus grandis]
Length=564

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF KGFKAAKCKTLLKLTIPRIKLLRNRREIQLKQMR++IAKLLETGQEATARIRVE
Sbjct  4    MDSFFAKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQE++ELFCELISVRLP+IEAQRECP+DLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREEKMMAAQEVLELFCELISVRLPVIEAQRECPIDLKEAISSVCFAAPRCADLPELI  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL P+CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGKEFVAAASELMPDCGVNRQLIELLSVRAPSPEAKLKLLKEIAEEHEL  181



>ref|XP_007020222.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
 gb|EOY17447.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
Length=530

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFF+KGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFSKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELI+VRLPIIE QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEILELFCELIAVRLPIIETQRECPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEF++AATELRP+CGVNRQLIELLS+RAP+P+VKLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGKEFISAATELRPDCGVNRQLIELLSVRAPSPEVKLKLLKEIAEEHEL  181



>emb|CDP01161.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 1/179 (1%)
 Frame = +1

Query  208  MDSFFNKG-FkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRV  384
            MDSFF+KG FKA+KCKTLLKL+IPRIKLLRNRREIQ+KQMR++IA LLETGQEATARIRV
Sbjct  1    MDSFFSKGGFKASKCKTLLKLSIPRIKLLRNRREIQIKQMRRDIANLLETGQEATARIRV  60

Query  385  EHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPEL  564
            EHIIREEKMMAAQEIIELFCELI VRLPIIEAQRECP+DLKEAISSVCFAAPRCADL EL
Sbjct  61   EHIIREEKMMAAQEIIELFCELIVVRLPIIEAQRECPIDLKEAISSVCFAAPRCADLQEL  120

Query  565  QQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             QVQ+ F  KYGKEFVAAATELRPECGVNRQLIELLS+RAPAPDVKLK+LKEIAEEHEL
Sbjct  121  LQVQMLFAAKYGKEFVAAATELRPECGVNRQLIELLSVRAPAPDVKLKLLKEIAEEHEL  179



>gb|EPS70884.1| hypothetical protein M569_03876, partial [Genlisea aurea]
Length=274

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF + F A KCKTLLKLTIPRIKLLRNRR+IQ+KQMRKEIAKLLETGQEATARIRVE
Sbjct  1    MDSFFKQRFNAGKCKTLLKLTIPRIKLLRNRRDIQIKQMRKEIAKLLETGQEATARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELF ELI VRLPII+AQRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  61   HIIREEKMMAAQEIVELFAELIVVRLPIIDAQRECPLDLKEAISSVCFAAPRCADLPELI  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F+GKYGK+FVAAA+EL PECGVNRQL+ELLS+RAPAP++KLK+LK+IAEEHEL
Sbjct  121  QVQILFSGKYGKDFVAAASELMPECGVNRQLLELLSVRAPAPEMKLKLLKDIAEEHEL  178



>ref|XP_010695698.1| PREDICTED: IST1-like protein [Beta vulgaris subsp. vulgaris]
Length=283

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            MDSFF+KGFK +KCKTLLKL+IPRIKLLRNRRE+Q+KQMRK+IAKLLETGQE TARIRVE
Sbjct  2    MDSFFSKGFKGSKCKTLLKLSIPRIKLLRNRRELQIKQMRKDIAKLLETGQETTARIRVE  61

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HI+REE MMAAQEIIELFCELI+VRLP+IE+ RECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  62   HIVREENMMAAQEIIELFCELITVRLPVIESHRECPLDLKEAISSICFAAPRCADLPELL  121

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQL+F  KYGKEFVAAATEL  +CG NRQL+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  122  QVQLSFVSKYGKEFVAAATELMRDCGNNRQLVELLSVRAPSPEKKLKLLKEIAEEHEL  179



>emb|CBI35325.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFK +KCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKGSKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIEL+CELISVRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELYCELISVRLPIIETQRECPLDLKEAISSLCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+    KYGKEFVAAATEL P+CGV RQLIELLS+RAP+PDVKLK+LKEIAEEH L
Sbjct  124  QVQMLMASKYGKEFVAAATELMPDCGVCRQLIELLSVRAPSPDVKLKLLKEIAEEHGL  181



>ref|XP_010245870.1| PREDICTED: uncharacterized protein LOC104589305 [Nelumbo nucifera]
Length=546

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGFK AKCKTLLKLTIPRIKLLRNRRE+Q+KQMRK+IAKLLE GQEATARIRVE
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREVQIKQMRKDIAKLLEAGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ
Sbjct  64   HIIREENMMAAQEIIELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATEL P+CGVNRQLIELLSIRAP  + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFATKYGKEFVSAATELMPDCGVNRQLIELLSIRAPPAEAKLKLLKEIAEEHEL  181



>ref|XP_008809517.1| PREDICTED: IST1-like protein isoform X2 [Phoenix dactylifera]
Length=560

 Score =   295 bits (756),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGFK AKCKTLLKLTIPRIKLLRNRRE+QLKQMR++IAKLLE GQEATARIRVE
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREVQLKQMRRDIAKLLENGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE +MAAQE IELFCELISVRLPIIE QRECPLDLKEAISS+CFAAPRCADLPELQ
Sbjct  64   HIIREENIMAAQETIELFCELISVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ FT KYGKEFVAAATEL P+CGVNRQ+IELLS+RAP+ + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFTAKYGKEFVAAATELMPDCGVNRQIIELLSVRAPSVEAKLKLLKEIAEEHEL  181



>ref|XP_008809516.1| PREDICTED: IST1-like protein isoform X1 [Phoenix dactylifera]
Length=560

 Score =   295 bits (756),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGFK AKCKTLLKLTIPRIKLLRNRRE+QLKQMR++IAKLLE GQEATARIRVE
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREVQLKQMRRDIAKLLENGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE +MAAQE IELFCELISVRLPIIE QRECPLDLKEAISS+CFAAPRCADLPELQ
Sbjct  64   HIIREENIMAAQETIELFCELISVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ FT KYGKEFVAAATEL P+CGVNRQ+IELLS+RAP+ + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFTAKYGKEFVAAATELMPDCGVNRQIIELLSVRAPSVEAKLKLLKEIAEEHEL  181



>ref|XP_010937030.1| PREDICTED: IST1 homolog [Elaeis guineensis]
Length=549

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
             D+FFNKGF+  KCKTLLKLTIPRIKLLRNRREIQLKQMR++IAKLLE GQEATARIRVE
Sbjct  4    FDAFFNKGFQGTKCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLENGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELI+VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPELQ
Sbjct  64   HIIREENMMAAQEIIELFCELIAVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATEL P+CGVNRQ+IELLS+RAP+ + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFAAKYGKEFVAAATELMPDCGVNRQIIELLSVRAPSVEAKLKLLKEIAEEHEL  181



>gb|KDO83978.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
Length=523

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFK +KCKTLLKL IPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKGSKCKTLLKLAIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HI+REE MMAAQEI+EL+CELI VRLPIIE QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIVREENMMAAQEILELYCELIVVRLPIIETQRECPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYG+EFVAAATEL P+CGVNRQLIELLS+RAP+ D KLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGREFVAAATELMPDCGVNRQLIELLSVRAPSADKKLKLLKEIAEEHEL  181



>ref|XP_006396076.1| hypothetical protein EUTSA_v10007134mg [Eutrema salsugineum]
 gb|ESQ33362.1| hypothetical protein EUTSA_v10007134mg [Eutrema salsugineum]
Length=600

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQILFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAEEHEL  181



>emb|CDY46461.1| BnaA08g06470D [Brassica napus]
Length=566

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEIIELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEIIELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQL F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIA+EH+L
Sbjct  124  QVQLLFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAQEHQL  181



>ref|XP_006376337.1| hypothetical protein POPTR_0013s12140g [Populus trichocarpa]
 gb|ERP54134.1| hypothetical protein POPTR_0013s12140g [Populus trichocarpa]
Length=547

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRR+IQ+K MR++IAKLLETGQEATARIRVE
Sbjct  4    IDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRRDIQMKHMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELF ELISVRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELFSELISVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATEL P CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQILFASKYGKEFVAAATELMPSCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHEL  181



>ref|XP_009107933.1| PREDICTED: uncharacterized protein LOC103833603 [Brassica rapa]
Length=566

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEIIELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEIIELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQL F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIA+EH+L
Sbjct  124  QVQLLFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAQEHQL  181



>ref|XP_006434655.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
 gb|ESR47895.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
Length=523

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFK +KCKTLLKL IPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKGSKCKTLLKLAIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HI+REE MMAAQEI+EL+CELI VRLPIIE QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIVREENMMAAQEILELYCELIVVRLPIIETQRECPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYG+EFVAAATEL P+CGVNRQLIELLS+RAP+ D KLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGREFVAAATELMPDCGVNRQLIELLSVRAPSADKKLKLLKEIAEEHEL  181



>ref|NP_973961.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AAD39610.1|AC007454_9 F23M19.10 [Arabidopsis thaliana]
 gb|AEE31688.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=619

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQILFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAEEHEL  181



>gb|KHN32808.1| IST1-like protein [Glycine soja]
Length=528

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
             DS FNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLK MR+EIAKLLETGQEATARIRVE
Sbjct  4    FDSIFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELI+VRLPIIE+QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELFCELIAVRLPIIESQRECPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEF++AATELRP+CGVNRQLIELLSIRAP+P+ KL +LKEIA EH+L
Sbjct  124  QVQMLFAAKYGKEFLSAATELRPDCGVNRQLIELLSIRAPSPEKKLNLLKEIAVEHDL  181



>ref|XP_003548955.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X1 [Glycine max]
 ref|XP_006599451.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X2 [Glycine max]
Length=528

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
             DS FNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLK MR+EIAKLLETGQEATARIRVE
Sbjct  4    FDSIFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELI+VRLPIIE+QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELFCELIAVRLPIIESQRECPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEF++AATELRP+CGVNRQLIELLSIRAP+P+ KL +LKEIA EH+L
Sbjct  124  QVQMLFAAKYGKEFLSAATELRPDCGVNRQLIELLSIRAPSPEKKLNLLKEIAVEHDL  181



>ref|XP_008381028.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381029.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381030.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381031.1| PREDICTED: IST1-like protein [Malus domestica]
Length=538

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKT+LKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTMLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELF ELI+VRLPIIE+QRECP+DLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEILELFSELIAVRLPIIESQRECPIDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATEL P+CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEH+L
Sbjct  124  QVQMLFASKYGKEFVAAATELIPDCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHDL  181



>ref|XP_009339749.1| PREDICTED: IST1-like protein [Pyrus x bretschneideri]
 ref|XP_009339750.1| PREDICTED: IST1-like protein [Pyrus x bretschneideri]
Length=538

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKT+LKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTMLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELF ELI+VRLPIIE+QRECP+DLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEILELFSELIAVRLPIIESQRECPIDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATEL P+CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEH+L
Sbjct  124  QVQMLFASKYGKEFVAAATELIPDCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHDL  181



>ref|XP_002275027.1| PREDICTED: uncharacterized protein LOC100245921 [Vitis vinifera]
Length=539

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFK +KCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKGSKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIEL+CELISVRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELYCELISVRLPIIETQRECPLDLKEAISSLCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+    KYGKEFVAAATEL P+CGV RQLIELLS+RAP+PDVKLK+LKEIAEEH L
Sbjct  124  QVQMLMASKYGKEFVAAATELMPDCGVCRQLIELLSVRAPSPDVKLKLLKEIAEEHGL  181



>ref|XP_006473234.1| PREDICTED: uncharacterized protein LOC102611062 [Citrus sinensis]
Length=523

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFK +KCKTLLKL IPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKGSKCKTLLKLAIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+EL+CELI VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEILELYCELIVVRLPIIETQRECPLDLKEAISSLCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYG+EFVAAATEL P+CGVNRQLIELLS+RAP+ D KLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGREFVAAATELMPDCGVNRQLIELLSVRAPSADKKLKLLKEIAEEHEL  181



>ref|XP_009339061.1| PREDICTED: uncharacterized protein LOC103931336 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339062.1| PREDICTED: uncharacterized protein LOC103931336 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009339063.1| PREDICTED: uncharacterized protein LOC103931336 isoform X2 [Pyrus 
x bretschneideri]
Length=538

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKT+LKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTMLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELF ELI+VRLPIIE+QRECP+DLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEILELFSELIAVRLPIIESQRECPIDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATEL P+CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEH+L
Sbjct  124  QVQMLFASKYGKEFVAAATELIPDCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHDL  181



>ref|XP_010499963.1| PREDICTED: IST1 homolog isoform X1 [Camelina sativa]
 ref|XP_010499964.1| PREDICTED: IST1 homolog isoform X2 [Camelina sativa]
Length=597

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISS+CFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSICFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQILFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAEEHEL  181



>ref|XP_006303943.1| hypothetical protein CARUB_v10008690mg [Capsella rubella]
 gb|EOA36841.1| hypothetical protein CARUB_v10008690mg [Capsella rubella]
Length=578

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLIELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQVLFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAEEHEL  181



>ref|XP_010478853.1| PREDICTED: IST1 homolog [Camelina sativa]
Length=597

 Score =   294 bits (752),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISS+CFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSICFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQILFVSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAEEHEL  181



>ref|XP_009403189.1| PREDICTED: ENHANCER OF AG-4 protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=594

 Score =   294 bits (752),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FF+KGFK AKCKTLLKLTIPRIKLLRNRREIQLKQMRK+IAKLLE GQEATARIRVE
Sbjct  4    IDAFFSKGFKGAKCKTLLKLTIPRIKLLRNRREIQLKQMRKDIAKLLENGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELI+VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPELQ
Sbjct  64   HIIREENMMAAQEILELFCELITVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV AATEL P+CGVNRQ+IELLSIRAP+ +VKLK+LKEIAEEHEL
Sbjct  124  QVQMLFAAKYGKEFVMAATELLPDCGVNRQIIELLSIRAPSVEVKLKLLKEIAEEHEL  181



>ref|XP_003518384.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
 gb|KHN00708.1| IST1 like [Glycine soja]
Length=537

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
             DS FNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLK MR+EIAKLLETGQEATARIRVE
Sbjct  4    FDSIFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELI+VRLPIIE+QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELFCELIAVRLPIIESQRECPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEF++A TELRP+CGVNRQLIELLSIRAP+P+ KL +LKEIA EH+L
Sbjct  124  QVQMLFAAKYGKEFLSATTELRPDCGVNRQLIELLSIRAPSPEKKLNLLKEIAVEHDL  181



>ref|XP_004489726.1| PREDICTED: dentin sialophosphoprotein-like [Cicer arietinum]
Length=523

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++SFF +GFKAAKCKTLLKLTIPRIKLLRNRREIQLK MR++IAKLLETGQEATARIRVE
Sbjct  4    LNSFFAQGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELISVRLPIIE+QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELFCELISVRLPIIESQRECPLDLKEAISSICFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQL F  KYGKEF++AATELRP+CGVNRQLIELLS+RAP+P+ KL +LK+IA EHEL
Sbjct  124  QVQLQFATKYGKEFISAATELRPDCGVNRQLIELLSVRAPSPEKKLNLLKDIAVEHEL  181



>gb|KFK45126.1| hypothetical protein AALP_AA1G347400 [Arabis alpina]
Length=594

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDAFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISS+CFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSICFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P++KLK+LKEIAEEHEL
Sbjct  124  QVQILFLSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPEIKLKLLKEIAEEHEL  181



>gb|ABS32229.1| hypothetical protein [Carica papaya]
 gb|ABY60780.1| hypothetical protein [Carica papaya]
Length=533

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRI+LLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIRLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELI+VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREESMMAAQEILELFCELIAVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AA EL P+CGVNRQLIELLSIRAP+ ++KLK+LKEIAEEHEL
Sbjct  124  QVQMLFATKYGKEFVSAAAELMPDCGVNRQLIELLSIRAPSSELKLKLLKEIAEEHEL  181



>ref|XP_007151911.1| hypothetical protein PHAVU_004G086100g [Phaseolus vulgaris]
 gb|ESW23905.1| hypothetical protein PHAVU_004G086100g [Phaseolus vulgaris]
Length=525

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
             DS FNKGFKAAKCKTLLKLTIPRIKLLRNRRE QLK MR++IAKLLETGQEATARIRVE
Sbjct  4    FDSLFNKGFKAAKCKTLLKLTIPRIKLLRNRRENQLKNMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELI+VRLPIIE+QRECPLDLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEIIELFCELIAVRLPIIESQRECPLDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEF++AATELRP+CGVNRQLIELLSIRAP+P+ KL +LKEIA EH+L
Sbjct  124  QVQMLFAAKYGKEFLSAATELRPDCGVNRQLIELLSIRAPSPEKKLNLLKEIAVEHDL  181



>emb|CDX91784.1| BnaC08g07030D [Brassica napus]
Length=580

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKM+AAQEIIELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMLAAQEIIELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQL F  KYGKEFVAAA+EL+P+ GVNR+L+ELLS+RAP+P+ KLK+LKEIA+EH+L
Sbjct  124  QVQLLFFSKYGKEFVAAASELKPDSGVNRKLVELLSVRAPSPETKLKLLKEIAQEHQL  181



>ref|XP_007201705.1| hypothetical protein PRUPE_ppa004125mg [Prunus persica]
 gb|EMJ02904.1| hypothetical protein PRUPE_ppa004125mg [Prunus persica]
Length=528

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAA EI+ELFCELI+VRLPIIE+QRECPLDLKEAISSVCFAAPRCADL EL 
Sbjct  64   HIIREENMMAAHEILELFCELIAVRLPIIESQRECPLDLKEAISSVCFAAPRCADLSELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATEL P+CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGKEFVSAATELIPDCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHEL  181



>ref|XP_008237348.1| PREDICTED: IST1 homolog [Prunus mume]
Length=538

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAA EI+ELFCELI+VRLPIIE+QRECPLDLKEAISSVCFAAPRCADL EL 
Sbjct  64   HIIREENMMAAHEILELFCELIAVRLPIIESQRECPLDLKEAISSVCFAAPRCADLSELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATEL P+CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQMLFASKYGKEFVSAATELIPDCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHEL  181



>ref|XP_010939573.1| PREDICTED: IST1 homolog [Elaeis guineensis]
Length=546

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGFK AKCKTLLKLTIPRIKLLRNRREIQLKQMR++IAKLLE GQEATARIRVE
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLENGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HI+REE M+AAQEIIELFCELI+VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPELQ
Sbjct  64   HIVREENMLAAQEIIELFCELIAVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAAT L P+CGVNRQ+IELLS+RAP+ + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFAAKYGKEFVAAATGLMPDCGVNRQIIELLSVRAPSVEAKLKLLKEIAEEHEL  181



>ref|XP_008804491.1| PREDICTED: IST1 homolog [Phoenix dactylifera]
Length=546

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FF KGFK AKCKTLLKLTIPRIKLLRNRREIQLK MR++IAKLLE GQEATARIRVE
Sbjct  4    LDAFFTKGFKGAKCKTLLKLTIPRIKLLRNRREIQLKHMRRDIAKLLENGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEIIELFCELISVRLPIIE QRECPLDLKEAISS+CFAAPRCADLPELQ
Sbjct  64   HIIREENMMAAQEIIELFCELISVRLPIIELQRECPLDLKEAISSICFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV AATEL P+CGVNRQ+IELLS+RAP+ + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFAAKYGKEFVTAATELMPDCGVNRQIIELLSVRAPSVETKLKLLKEIAEEHEL  181



>ref|XP_010543209.1| PREDICTED: uncharacterized protein LOC104816186 isoform X2 [Tarenaya 
hassleriana]
Length=490

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            +PRIKLLRNRRE+Q+KQMR+EI+KLLETGQEATARIRVEHI+REEKMMAAQEI+ELFCEL
Sbjct  21   VPRIKLLRNRREVQIKQMRREISKLLETGQEATARIRVEHIVREEKMMAAQEILELFCEL  80

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+VRLP+IEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQ++F  KYGKEFVAAA EL
Sbjct  81   IAVRLPVIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQMSFVSKYGKEFVAAAAEL  140

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR+L+ELLS+RAP+P+ KLK+LK+IAEEHEL
Sbjct  141  RPDCGVNRKLVELLSVRAPSPETKLKLLKDIAEEHEL  177



>gb|ABY60784.1| hypothetical protein [Carica papaya]
Length=528

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRI+LLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIRLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCEL +VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREESMMAAQEILELFCELTAVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AA EL P+CGVNRQLIELLSIRAP+ ++KLK+LKEIAEEHEL
Sbjct  124  QVQMLFATKYGKEFVSAAAELMPDCGVNRQLIELLSIRAPSSELKLKLLKEIAEEHEL  181



>ref|XP_011458445.1| PREDICTED: IST1-like protein [Fragaria vesca subsp. vesca]
Length=529

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQE+IEL+CELISVRLPI+E+QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQELIELYCELISVRLPIVESQRECPLDLKEAISSLCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATEL P+CGV+RQLIELLS+RAP+ + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFVSKYGKEFVSAATELMPDCGVSRQLIELLSVRAPSAEKKLKLLKEIAEEHEL  181



>ref|XP_008464351.1| PREDICTED: uncharacterized protein LOC103502259 [Cucumis melo]
Length=583

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++SFFNKGFKAA+CKTLLKLTIPRIKLLRNRREIQLKQMR++IAKLLETGQEATARIRVE
Sbjct  4    LNSFFNKGFKAAQCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELI VRLPIIE QRECPLDLKEAISSVCFAAPRCADL EL 
Sbjct  64   HIIREENMMAAQEILELFCELIVVRLPIIETQRECPLDLKEAISSVCFAAPRCADLTELI  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATEL P CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEH+L
Sbjct  124  QVQMLFGAKYGKEFVSAATELMPNCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHDL  181



>gb|ABS32234.1| hypothetical protein [Carica papaya]
Length=528

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRI+LLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIRLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCEL +VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREESMMAAQEILELFCELTAVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AA EL P+CGVNRQLIELLSIRAP+ ++KLK+LKEIAEEHEL
Sbjct  124  QVQMLFAIKYGKEFVSAAAELMPDCGVNRQLIELLSIRAPSSELKLKLLKEIAEEHEL  181



>ref|XP_010261134.1| PREDICTED: uncharacterized protein LOC104600038 [Nelumbo nucifera]
Length=544

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGFK AKCKTLLKLTIPRIKLLRNRRE Q+KQMRKEI+KLLETGQEATARIRVE
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREAQIKQMRKEISKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIR+EKM+AAQEIIEL+CELI+VRLPIIEAQRECPLDLK AISSVCFAAPRCADLPELQ
Sbjct  64   HIIRDEKMIAAQEIIELYCELIAVRLPIIEAQRECPLDLKGAISSVCFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATEL P+CGV+R+LIELLS+RAP  + KLK+LKEIAEEHEL
Sbjct  124  QVQMLFANKYGKEFVSAATELMPDCGVDRKLIELLSVRAPLAEAKLKLLKEIAEEHEL  181



>ref|XP_008384411.1| PREDICTED: uncharacterized protein LOC103447017 [Malus domestica]
Length=597

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKA KCKTLLKLT PRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAVKCKTLLKLTTPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAA EI+ELFCELI+VRLPIIE+QRECP+DLKEAISSVCFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAHEILELFCELIAVRLPIIESQRECPIDLKEAISSVCFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFVAAATEL P+CGVNRQLIELLS+R P+P+ KLK+LKEIAEEH L
Sbjct  124  QVQMLFAAKYGKEFVAAATELIPDCGVNRQLIELLSVRPPSPEKKLKLLKEIAEEHGL  181



>ref|XP_004138362.1| PREDICTED: uncharacterized protein LOC101208940 [Cucumis sativus]
 gb|KGN45897.1| hypothetical protein Csa_6G020110 [Cucumis sativus]
Length=586

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++SFFNKGFKAA+CKTLLKLTIPRIKLLRNRREIQLKQMR++IAKLLETGQEATARIRVE
Sbjct  4    LNSFFNKGFKAAQCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELI VRLPIIE QRECPLDLKEAISSVCFAAPRCADL EL 
Sbjct  64   HIIREENMMAAQEILELFCELIVVRLPIIETQRECPLDLKEAISSVCFAAPRCADLTELI  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEF++AATEL P CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEH+L
Sbjct  124  QVQMLFGAKYGKEFLSAATELMPNCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHDL  181



>gb|KJB66152.1| hypothetical protein B456_010G129400 [Gossypium raimondii]
Length=552

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DS FNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLE GQEATARIRVE
Sbjct  37   LDSLFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLEIGQEATARIRVE  96

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE +MAAQEI+ELFCELI+VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  97   HIIREENIMAAQEILELFCELIAVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELL  156

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             VQ+ F  KYGKEFV+AATELRP+CGVNRQLIELLSI AP+P++KLK+LKEIAEEHEL
Sbjct  157  HVQMLFISKYGKEFVSAATELRPDCGVNRQLIELLSICAPSPELKLKLLKEIAEEHEL  214



>gb|KHG18028.1| Uncharacterized protein F383_00577 [Gossypium arboreum]
Length=529

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DS FNKGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLE GQEATARIRVE
Sbjct  4    LDSLFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLEIGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE  MAAQEI+ELFCELI+VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENTMAAQEILELFCELIAVRLPIIETQRECPLDLKEAISSICFAAPRCADLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATELRP+ GVNRQLIELLSI AP+P++KLK+LKEIAEEHEL
Sbjct  124  QVQMLFISKYGKEFVSAATELRPDSGVNRQLIELLSICAPSPELKLKLLKEIAEEHEL  181



>ref|XP_002325569.2| hypothetical protein POPTR_0019s11730g [Populus trichocarpa]
 gb|EEE99950.2| hypothetical protein POPTR_0019s11730g [Populus trichocarpa]
Length=533

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFF+KGFKAAKCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEAT+RIRVE
Sbjct  4    LDSFFDKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATSRIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            +IIREE MMAAQEIIELFCELI+VRLPIIE QRECPLDLKEAISSVCFAAPRC DLPEL 
Sbjct  64   NIIREENMMAAQEIIELFCELITVRLPIIETQRECPLDLKEAISSVCFAAPRCGDLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ  F  KYGKEF AAATELRP CGVNRQLI+LLS+ AP+P+ KLK+LKEIAEEH L
Sbjct  124  QVQTLFASKYGKEFAAAATELRPACGVNRQLIQLLSVCAPSPEAKLKLLKEIAEEHAL  181



>ref|XP_006827078.2| PREDICTED: IST1 homolog [Amborella trichopoda]
Length=552

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGFK AKCKTLLKLTIPRIKLLRN+RE+ LKQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNKREVLLKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE +MAA EIIELFCELI VRLPIIE Q+ECPLDLKEAISS+CFAAPRCADLPELQ
Sbjct  64   HIIREENVMAAHEIIELFCELIVVRLPIIETQKECPLDLKEAISSLCFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEFV+AATEL PE GVNRQ+IELLS+RAP+P V LK+LKEIAEEHEL
Sbjct  124  QVQMLFAAKYGKEFVSAATELLPESGVNRQIIELLSVRAPSPAVNLKLLKEIAEEHEL  181



>ref|XP_011002513.1| PREDICTED: uncharacterized protein LOC105109486 [Populus euphratica]
Length=550

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFF+KGFKAAKCKTLLKLTIPRIKLLRNRREI++KQMR+ IAKLLETGQEAT+RIRVE
Sbjct  4    LDSFFDKGFKAAKCKTLLKLTIPRIKLLRNRREIEIKQMRRNIAKLLETGQEATSRIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            +IIREE MMAAQEIIELFCELI+VRLPIIE QRECPLDLKEAISSVCFAAPRC DLPEL 
Sbjct  64   NIIREENMMAAQEIIELFCELITVRLPIIETQRECPLDLKEAISSVCFAAPRCGDLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ  F  KYGKEFVAAATELRP CGVNRQLI+LLS+ AP+P+ KLK+LKEIAEEHEL
Sbjct  124  QVQTLFAFKYGKEFVAAATELRPACGVNRQLIQLLSVCAPSPEAKLKLLKEIAEEHEL  181



>ref|XP_010094831.1| hypothetical protein L484_016412 [Morus notabilis]
 gb|EXB57360.1| hypothetical protein L484_016412 [Morus notabilis]
Length=555

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QLKQMR++IAKLLETGQEATARIRVEHIIREE MMAAQEIIELFCEL
Sbjct  46   IPRIKLLRNRREVQLKQMRRDIAKLLETGQEATARIRVEHIIREENMMAAQEIIELFCEL  105

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+VRLPIIE QRECPLDLKEAISSVCFAAPRCADLPEL QVQ+ F  KYGKEFVAAATEL
Sbjct  106  ITVRLPIIETQRECPLDLKEAISSVCFAAPRCADLPELLQVQILFASKYGKEFVAAATEL  165

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQLIELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  166  IPDCGVNRQLIELLSVRAPSPEKKLKLLKEIAEEHEL  202



>gb|EYU43558.1| hypothetical protein MIMGU_mgv1a005603mg [Erythranthe guttata]
Length=477

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DS F + F AAKCKTLLKLTIPRIKLLRNRRE+QL+QMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSIFKQRFNAAKCKTLLKLTIPRIKLLRNRREMQLRQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCEL+ VRLPIIE QRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREEKMMAAQEIVELFCELVVVRLPIIEIQRECPLDLKEAISSICFAAPRCADLPELI  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q Q+ F GKY KEFV AATEL PE GVNRQLIELLSIRAPAPDVKLK+LKEIA EHEL
Sbjct  124  QAQMLFAGKYSKEFVIAATELMPESGVNRQLIELLSIRAPAPDVKLKLLKEIALEHEL  181



>ref|XP_009401388.1| PREDICTED: IST1 homolog [Musa acuminata subsp. malaccensis]
Length=543

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +D+FFNKGF+ AKCKTLLKLTIPRI+LLRNRRE QLKQMRK+IAKLLE GQEATARIRVE
Sbjct  4    LDAFFNKGFRGAKCKTLLKLTIPRIRLLRNRRESQLKQMRKDIAKLLEDGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCELI+VRLPIIE+QRECPLDLKEAIS++CFAAPRCADLPELQ
Sbjct  64   HIIREENMMAAQEILELFCELIAVRLPIIESQRECPLDLKEAISTICFAAPRCADLPELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ+ F  KYGKEF  AAT L P+CGVNRQ+IELLSIR P+ + K+K+LKEIAE+HEL
Sbjct  124  QVQMLFAAKYGKEFATAATYLLPDCGVNRQVIELLSIRVPSVETKMKLLKEIAEQHEL  181



>emb|CAN60958.1| hypothetical protein VITISV_034688 [Vitis vinifera]
Length=557

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 167/196 (85%), Gaps = 18/196 (9%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFK +KCKTLLKLTIPRIKLLRNRREIQ+KQMR++IAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKGSKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQ------------------RECPLDLKEA  513
            HIIREE MMAAQEIIEL+CELISVRLPIIE Q                  +ECPLDLKEA
Sbjct  64   HIIREENMMAAQEIIELYCELISVRLPIIETQSFLAKNFVTKGNLLEVFSKECPLDLKEA  123

Query  514  ISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAP  693
            ISS+CFAAPRCADLPEL QVQ+    KYGKEFVAAATEL P+CGV RQLIELLS+RAP+P
Sbjct  124  ISSLCFAAPRCADLPELLQVQMLMASKYGKEFVAAATELMPDCGVCRQLIELLSVRAPSP  183

Query  694  DVKLKVLKEIAEEHEL  741
            DVKLK+LKEIAEEH L
Sbjct  184  DVKLKLLKEIAEEHGL  199



>gb|KEH25939.1| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=585

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++SFF +GFKA+KCKTLLKL+IPRIKLLRNRRE QLK MR+EIAKLLETGQEATARIRVE
Sbjct  4    LNSFFAQGFKASKCKTLLKLSIPRIKLLRNRRENQLKNMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREE MMAAQEI+ELFCEL+SVRLPIIE+QRE PLDLKEAISS+CFAAPRCADLPEL 
Sbjct  64   HIIREENMMAAQEILELFCELVSVRLPIIESQREIPLDLKEAISSICFAAPRCADLPELI  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QVQ  F  KYGKEF++AATELRP+CGVNRQ+IELLS+RAP+P+ KL +LK+IA EHEL
Sbjct  124  QVQQQFATKYGKEFISAATELRPDCGVNRQIIELLSVRAPSPEKKLTLLKDIAVEHEL  181



>ref|NP_174684.2| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AEE31687.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=649

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 171/208 (82%), Gaps = 30/208 (14%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNR------------------------------Q  657
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR                              Q
Sbjct  124  QVQILFVSKYGKEFVAAASELKPDSGVNRKTESLIFIAWFSLVETRDLFMFLYFSNSILQ  183

Query  658  LIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  184  LVELLSVRAPSPETKLKLLKEIAEEHEL  211



>gb|AAQ22619.1| At1g34220 [Arabidopsis thaliana]
 dbj|BAE99480.1| hypothetical protein [Arabidopsis thaliana]
Length=649

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 171/208 (82%), Gaps = 30/208 (14%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNR------------------------------Q  657
            QVQ+ F  KYGKEFVAAA+EL+P+ GVNR                              Q
Sbjct  124  QVQILFVSKYGKEFVAAASELKPDSGVNRKTESLIFIAWFSLVETRDLFMFLYFSNSILQ  183

Query  658  LIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  184  LVELLSVRAPSPETKLKLLKEIAEEHEL  211



>gb|KJB59584.1| hypothetical protein B456_009G261900 [Gossypium raimondii]
Length=491

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  286  LLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELISVRL  465
            LLRNRREIQ+KQMR++IAKLLETGQEATARIRVEHIIREE MMAAQEI+ELFCELI+VRL
Sbjct  2    LLRNRREIQIKQMRRDIAKLLETGQEATARIRVEHIIREENMMAAQEILELFCELIAVRL  61

Query  466  PIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRPECG  645
            PIIE QRECPLDLKEAISSVCFAAPRCADLPEL QVQ+ F  KYGKEFV+AA+ELRP+CG
Sbjct  62   PIIETQRECPLDLKEAISSVCFAAPRCADLPELLQVQMLFASKYGKEFVSAASELRPDCG  121

Query  646  VNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            VNRQLIELLSIR P+P+VKLK+LKEIAEEHEL
Sbjct  122  VNRQLIELLSIRVPSPEVKLKILKEIAEEHEL  153



>gb|EAZ05774.1| hypothetical protein OsI_28007 [Oryza sativa Indica Group]
Length=561

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  29   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  88

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+VRLPIIE Q+ECP+DLKEAISS+CFAAPRCADLPEL QVQ+ F  KYGKEFVAAATEL
Sbjct  89   IAVRLPIIETQKECPIDLKEAISSICFAAPRCADLPELMQVQMMFATKYGKEFVAAATEL  148

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIRAP  DVK+K+LKEIAEEHE+
Sbjct  149  MPDCGVNRQIIELLSIRAPPVDVKMKLLKEIAEEHEI  185



>ref|NP_001061111.1| Os08g0175200 [Oryza sativa Japonica Group]
 dbj|BAD05225.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD05552.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23025.1| Os08g0175200 [Oryza sativa Japonica Group]
 gb|EEE68132.1| hypothetical protein OsJ_26225 [Oryza sativa Japonica Group]
Length=561

 Score =   277 bits (709),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  29   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  88

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+VRLPIIE Q+ECP+DLKEAISS+CFAAPRCADLPEL QVQ+ F  KYGKEFVAAATEL
Sbjct  89   IAVRLPIIETQKECPIDLKEAISSICFAAPRCADLPELMQVQMMFATKYGKEFVAAATEL  148

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIRAP  DVK+K+LKEIAEEHE+
Sbjct  149  MPDCGVNRQIIELLSIRAPPVDVKMKLLKEIAEEHEI  185



>ref|NP_001288461.1| uncharacterized protein LOC103641204 [Zea mays]
 gb|ACN34775.1| unknown [Zea mays]
 gb|AFW57123.1| hypothetical protein ZEAMMB73_703221 [Zea mays]
Length=516

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +1

Query  208  MDSFFNKG----FkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATAR  375
            +D+FF+KG    F+ AKCKTLLKL+IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATAR
Sbjct  4    LDTFFSKGGGGGFRGAKCKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  63

Query  376  IRVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADL  555
            IRVEHIIREE MMAAQEI+ELFCELI+VRLPIIEAQ+ECP+DLKEAISSVCFAAPRCADL
Sbjct  64   IRVEHIIREENMMAAQEILELFCELIAVRLPIIEAQKECPIDLKEAISSVCFAAPRCADL  123

Query  556  PELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
            PEL QVQ+ F  KYGKEFVAAA+EL P+CGVNRQ+IELLSIR P  D KLK+LKEIAEEH
Sbjct  124  PELMQVQMMFATKYGKEFVAAASELMPDCGVNRQIIELLSIRPPPVDAKLKLLKEIAEEH  183

Query  736  EL  741
            E+
Sbjct  184  EV  185



>ref|XP_006659884.1| PREDICTED: polycystic kidney disease protein 1-like 3-like [Oryza 
brachyantha]
Length=662

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  30   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  89

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+VRLPIIE Q+ECP+DLKEAISS+CFAAPRCADLPEL QVQ+ F  KYGKEFVAAATEL
Sbjct  90   IAVRLPIIETQKECPIDLKEAISSICFAAPRCADLPELMQVQMMFATKYGKEFVAAATEL  149

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIRAP  D K+K+LKEIAEEHE+
Sbjct  150  MPDCGVNRQIIELLSIRAPPVDAKMKLLKEIAEEHEI  186



>ref|XP_002893813.1| hypothetical protein ARALYDRAFT_473574 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70072.1| hypothetical protein ARALYDRAFT_473574 [Arabidopsis lyrata subsp. 
lyrata]
Length=649

 Score =   277 bits (708),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 171/208 (82%), Gaps = 30/208 (14%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKL+RNRRE Q+KQMR+EIAKLLETGQEATARIRVE
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKMMAAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISSVCFAAPRC+DL ELQ
Sbjct  64   HIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSVCFAAPRCSDLTELQ  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNR------------------------------Q  657
            QVQ+ F  KYGKEFVAAA+EL+ + GVNR                              Q
Sbjct  124  QVQILFVSKYGKEFVAAASELKLDSGVNRKTESLIFIAWFSLVETRYLFMFLYFSKSILQ  183

Query  658  LIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L+ELLS+RAP+P++KLK+LKEIAEEHEL
Sbjct  184  LVELLSVRAPSPEIKLKLLKEIAEEHEL  211



>emb|CDM86090.1| unnamed protein product [Triticum aestivum]
Length=511

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  32   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  91

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            ++VRLPIIEAQ+ECP+DLKEAISS+CFAAPRC+DLPEL QVQ+ F  KYGKEFVAAA EL
Sbjct  92   VAVRLPIIEAQKECPIDLKEAISSICFAAPRCSDLPELMQVQMMFATKYGKEFVAAAAEL  151

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIR P  D+K+K+LKEIAEEHE+
Sbjct  152  MPDCGVNRQIIELLSIRPPPVDIKMKLLKEIAEEHEI  188



>ref|XP_003573416.1| PREDICTED: IST1-like protein [Brachypodium distachyon]
Length=515

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  33   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  92

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            ++VRLPIIE Q+ECP+DLKEAISS+CFAAPRCADLPEL QVQ+ F  KYGKEFVAAA EL
Sbjct  93   VAVRLPIIETQKECPIDLKEAISSICFAAPRCADLPELMQVQVMFATKYGKEFVAAAAEL  152

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIR P  DVK+K+LKEIAEEHE+
Sbjct  153  MPDCGVNRQIIELLSIRPPPVDVKMKLLKEIAEEHEI  189



>ref|XP_004972729.1| PREDICTED: IST1-like protein-like isoform X2 [Setaria italica]
Length=504

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  28   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  87

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            ++VRLP+IEA++ECP+DLKEAISS+CFAAPRCADLPEL QVQ+ F  KYGKEFVAAA+EL
Sbjct  88   VAVRLPVIEAKKECPIDLKEAISSICFAAPRCADLPELMQVQMMFATKYGKEFVAAASEL  147

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIR P  D KLK+LKEIAEEHE+
Sbjct  148  MPDCGVNRQIIELLSIRPPPVDAKLKLLKEIAEEHEV  184



>ref|XP_004972728.1| PREDICTED: IST1-like protein-like isoform X1 [Setaria italica]
Length=543

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  28   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  87

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            ++VRLP+IEA++ECP+DLKEAISS+CFAAPRCADLPEL QVQ+ F  KYGKEFVAAA+EL
Sbjct  88   VAVRLPVIEAKKECPIDLKEAISSICFAAPRCADLPELMQVQMMFATKYGKEFVAAASEL  147

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIR P  D KLK+LKEIAEEHE+
Sbjct  148  MPDCGVNRQIIELLSIRPPPVDAKLKLLKEIAEEHEV  184



>dbj|BAJ94091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   268 bits (685),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQ+ATARIRVEHIIREE M+AAQEI+ELFCEL
Sbjct  32   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQDATARIRVEHIIREENMLAAQEILELFCEL  91

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            ++VRLP+IEAQ+ECP+DLKEAISS+CFAAPRC+DLPEL QVQ+ F  KYGKEFVAAATEL
Sbjct  92   VAVRLPLIEAQKECPIDLKEAISSICFAAPRCSDLPELIQVQMMFATKYGKEFVAAATEL  151

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIR P  D+K+K+LKEIAEEHE+
Sbjct  152  MPDCGVNRQIIELLSIRPPPVDIKMKLLKEIAEEHEI  188



>ref|XP_008676764.1| PREDICTED: uncharacterized protein LOC100272774 isoform X1 [Zea 
mays]
 gb|ACF85010.1| unknown [Zea mays]
 gb|AFW61114.1| hypothetical protein ZEAMMB73_013899 [Zea mays]
Length=511

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  27   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  86

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+VRLPIIE QRECP+DLKEAISS+CFAAPRCADLPEL QVQ+ F  KYGKEFVAAA+EL
Sbjct  87   IAVRLPIIETQRECPIDLKEAISSICFAAPRCADLPELIQVQMMFATKYGKEFVAAASEL  146

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+CGVNRQ+IELLSIR P    KLK+LKEIAEEHE+
Sbjct  147  MPDCGVNRQIIELLSIRPPPVHAKLKLLKEIAEEHEV  183



>gb|EMS63538.1| hypothetical protein TRIUR3_01260 [Triticum urartu]
Length=513

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATARIRVEHIIREE MMAAQEI+ELFCEL
Sbjct  32   IPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATARIRVEHIIREENMMAAQEILELFCEL  91

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            ++VRLP+IEAQ+ECP+DLKEAISS+CFAAPRC+DLPEL QVQ+ F  KYGKEF AAA EL
Sbjct  92   VAVRLPVIEAQKECPIDLKEAISSICFAAPRCSDLPELMQVQMMFATKYGKEFAAAAAEL  151

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             P+ GVNRQ+IELLSIR P  D+K+K+LKEIAEEHE+
Sbjct  152  MPDSGVNRQIIELLSIRPPPVDIKMKLLKEIAEEHEI  188



>ref|XP_006589468.1| PREDICTED: IST1-like protein-like [Glycine max]
Length=389

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +1

Query  217  FFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHII  396
            FFNK FKA+KC TLL+LTIPRIKLLRNRRE+ LKQMR+++AKLLE GQEA A ++VEH++
Sbjct  7    FFNKAFKASKCATLLQLTIPRIKLLRNRREVHLKQMRRDVAKLLEAGQEAKASLKVEHVM  66

Query  397  REEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQ  576
            REE +MAAQ+II+LFCELI+ R+  +++QR+CPLDLKEAISSVCFAAPRCADLPEL QVQ
Sbjct  67   REENIMAAQDIIQLFCELIAARIAFVQSQRKCPLDLKEAISSVCFAAPRCADLPELLQVQ  126

Query  577  LAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
              F  KYGK+FV+AAT+L P+C VN QLIELLS++AP+ + KLK+LKEIA EH+L
Sbjct  127  SLFASKYGKDFVSAATDLTPDCSVNGQLIELLSVQAPSQEKKLKLLKEIAVEHKL  181



>gb|AFW57124.1| hypothetical protein ZEAMMB73_703221 [Zea mays]
Length=159

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 144/156 (92%), Gaps = 4/156 (3%)
 Frame = +1

Query  208  MDSFFNKG----FkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATAR  375
            +D+FF+KG    F+ AKCKTLLKL+IPRIKLLRNRRE+QL+QMR++IAKLLE GQEATAR
Sbjct  4    LDTFFSKGGGGGFRGAKCKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  63

Query  376  IRVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADL  555
            IRVEHIIREE MMAAQEI+ELFCELI+VRLPIIEAQ+ECP+DLKEAISSVCFAAPRCADL
Sbjct  64   IRVEHIIREENMMAAQEILELFCELIAVRLPIIEAQKECPIDLKEAISSVCFAAPRCADL  123

Query  556  PELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLI  663
            PEL QVQ+ F  KYGKEFVAAA+EL P+CGVNRQ+I
Sbjct  124  PELMQVQMMFATKYGKEFVAAASELMPDCGVNRQVI  159



>gb|ERM94315.1| hypothetical protein AMTR_s00010p00237800 [Amborella trichopoda]
Length=511

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +1

Query  322  MRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLD  501
            MR+EIAKLLETGQEATARIRVEHIIREE +MAA EIIELFCELI VRLPIIE Q+ECPLD
Sbjct  1    MRREIAKLLETGQEATARIRVEHIIREENVMAAHEIIELFCELIVVRLPIIETQKECPLD  60

Query  502  LKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIR  681
            LKEAISS+CFAAPRCADLPELQQVQ+ F  KYGKEFV+AATEL PE GVNRQ+IELLS+R
Sbjct  61   LKEAISSLCFAAPRCADLPELQQVQMLFAAKYGKEFVSAATELLPESGVNRQIIELLSVR  120

Query  682  APAPDVKLKVLKEIAEEHEL  741
            AP+P V LK+LKEIAEEHEL
Sbjct  121  APSPAVNLKLLKEIAEEHEL  140



>ref|XP_006842294.2| PREDICTED: vacuolar protein sorting-associated protein IST1 isoform 
X2 [Amborella trichopoda]
Length=344

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++S FN+G   AKCKT LKL I RIKLLRN+RE+QLKQMRKEIA+ L+TGQE  ARIRVE
Sbjct  4    LNSLFNRGVLGAKCKTCLKLAISRIKLLRNKREVQLKQMRKEIAQFLQTGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ ++AA EIIELFCE + VR+PII+ QRECP +L+EAI+S+ FAAPRC+DLPEL 
Sbjct  64   HIIREQNIVAAYEIIELFCEFVLVRVPIIDTQRECPKELQEAIASIIFAAPRCSDLPELM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             +Q  FT KYGKEF +AA+ELRP+ GVNR +IE LS+ APA ++KLK+LKEIAEE+ L
Sbjct  124  HIQNLFTAKYGKEFTSAASELRPDSGVNRGIIEKLSVTAPAAELKLKILKEIAEENNL  181



>ref|XP_011622578.1| PREDICTED: IST1 homolog isoform X1 [Amborella trichopoda]
 ref|XP_011622579.1| PREDICTED: IST1 homolog isoform X1 [Amborella trichopoda]
Length=349

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++S FN+G   AKCKT LKL I RIKLLRN+RE+QLKQMRKEIA+ L+TGQE  ARIRVE
Sbjct  4    LNSLFNRGVLGAKCKTCLKLAISRIKLLRNKREVQLKQMRKEIAQFLQTGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ ++AA EIIELFCE + VR+PII+ QRECP +L+EAI+S+ FAAPRC+DLPEL 
Sbjct  64   HIIREQNIVAAYEIIELFCEFVLVRVPIIDTQRECPKELQEAIASIIFAAPRCSDLPELM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             +Q  FT KYGKEF +AA+ELRP+ GVNR +IE LS+ APA ++KLK+LKEIAEE+ L
Sbjct  124  HIQNLFTAKYGKEFTSAASELRPDSGVNRGIIEKLSVTAPAAELKLKILKEIAEENNL  181



>ref|XP_002971060.1| hypothetical protein SELMODRAFT_66889, partial [Selaginella moellendorffii]
 gb|EFJ27658.1| hypothetical protein SELMODRAFT_66889, partial [Selaginella moellendorffii]
Length=186

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLLRNRRE+Q++ MR+EIA LL+TGQE +ARIRVEHI RE+ +MAA EI+ELFCEL
Sbjct  8    MSRIKLLRNRRELQVRGMRREIANLLQTGQEPSARIRVEHIFREQNIMAAYEIVELFCEL  67

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            + VRLPIIE+Q++CPLDLKEAI+S+ FAAPRC+DLPEL +V+  F  KYGKEFVA+A EL
Sbjct  68   VVVRLPIIESQKQCPLDLKEAIASLIFAAPRCSDLPELLEVRGLFAVKYGKEFVASAGEL  127

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR++IE LS+RAP+ +VKLK+LKEIA EH +
Sbjct  128  RPDCGVNRRIIEKLSVRAPSGEVKLKLLKEIAAEHNI  164



>ref|XP_002962032.1| hypothetical protein SELMODRAFT_66879, partial [Selaginella moellendorffii]
 gb|EFJ37292.1| hypothetical protein SELMODRAFT_66879, partial [Selaginella moellendorffii]
Length=186

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLLRNRRE+Q++ MR+EIA LL+TGQE +ARIRVEHI RE+ +MAA EI+ELFCEL
Sbjct  8    MSRIKLLRNRRELQVRGMRREIANLLQTGQEPSARIRVEHIFREQNIMAAYEIVELFCEL  67

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            + VRLPIIE+Q++CPLDLKEAI+S+ FAAPRC+DLPEL +V+  F  KYGKEFVA+A EL
Sbjct  68   VVVRLPIIESQKQCPLDLKEAIASLIFAAPRCSDLPELLEVRGLFAVKYGKEFVASAGEL  127

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR++IE LS+RAP+ +VKLK+LKEIA EH +
Sbjct  128  RPDCGVNRRIIEKLSVRAPSGEVKLKLLKEIAAEHNI  164



>ref|XP_011074152.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X2 [Sesamum indicum]
Length=489

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 146/178 (82%), Gaps = 29/178 (16%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            +DSFFNKGFKAAKCKTLLKLTIPRIKLLRNRR+IQ+K MR+EIAKLLETGQEATARIRVE
Sbjct  2    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRRDIQMKNMRREIAKLLETGQEATARIRVE  61

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIREEKM AAQEI+ELFCELI+VRLPIIEAQRECPLDLKEAISS+CFAAPRCADLPEL 
Sbjct  62   HIIREEKMTAAQEIVELFCELITVRLPIIEAQRECPLDLKEAISSLCFAAPRCADLPEL-  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
                                         QL+ELLS+RAPAPDVKLK+LKEIAEEHEL
Sbjct  121  ----------------------------LQLVELLSVRAPAPDVKLKLLKEIAEEHEL  150



>ref|XP_001765737.1| predicted protein [Physcomitrella patens]
 gb|EDQ69328.1| predicted protein, partial [Physcomitrella patens]
Length=215

 Score =   228 bits (581),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLLRN+R++Q+KQMRKEIA+LL +GQE +ARIRVEHIIRE+ ++AA +I+ELF EL
Sbjct  8    MARIKLLRNKRDLQVKQMRKEIAQLLTSGQEPSARIRVEHIIREQNILAAYDILELFSEL  67

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            ++VRLPIIEAQ+ CPLDLKEAISS+ FA+PRC+DLPEL Q++  F  KYGKEF AAA EL
Sbjct  68   VAVRLPIIEAQKNCPLDLKEAISSLIFASPRCSDLPELLQIRQLFAAKYGKEFAAAAAEL  127

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR++IE LS+RAP+ +VKLK+LKEIA EH +
Sbjct  128  RPDCGVNRRIIEKLSVRAPSGEVKLKLLKEIAAEHSV  164



>ref|XP_010266112.1| PREDICTED: uncharacterized protein LOC104603713 [Nelumbo nucifera]
Length=463

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT+ KL   RIKLLRN+RE+ +KQMR+++A LL++GQ+ATARIRVEH+
Sbjct  24   SIFRRGFNSSKCKTMAKLATARIKLLRNKREVVVKQMRRDVALLLQSGQDATARIRVEHV  83

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA EI+ELFCEL+ VRLPII  QRECP DLKE ISS+ FAAPRC+D+PEL  +
Sbjct  84   IREQNIMAANEIVELFCELVVVRLPIIAKQRECPADLKEGISSLIFAAPRCSDIPELLHI  143

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGKEFV+AAT+LRP+CGVNR LIE LS++ P  +VKLKV+KEIA+EH++
Sbjct  144  RDIFEKKYGKEFVSAATDLRPDCGVNRTLIEKLSVKTPTGEVKLKVMKEIAKEHQI  199



>ref|XP_001757890.1| predicted protein [Physcomitrella patens]
 gb|EDQ77132.1| predicted protein, partial [Physcomitrella patens]
Length=195

 Score =   223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLLRN+RE Q+KQMR+EI++LL +GQE +ARIRVEHIIRE+ ++AA +I+ELFCEL+ 
Sbjct  10   RIKLLRNKREAQVKQMRREISQLLTSGQEPSARIRVEHIIREQNILAAYDILELFCELVV  69

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
            VRLPIIE+Q+ CPLDLKEAISS+ FA+PRC+DLPEL Q++  F  KYGKEF AAA ELRP
Sbjct  70   VRLPIIESQKICPLDLKEAISSLIFASPRCSDLPELLQIRQLFAAKYGKEFAAAAAELRP  129

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGVNR++IE LS+RAP+ ++KLK++KEIA EH++
Sbjct  130  DCGVNRRIIEKLSVRAPSGELKLKLMKEIAAEHDV  164



>ref|XP_010265126.1| PREDICTED: IST1 homolog [Nelumbo nucifera]
Length=334

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R++QLKQMRKEIA+ L+TGQEA ARIRVE
Sbjct  4    LNQLFNRGLLGAKCKTCLNLAISRIKLLQNKRDVQLKQMRKEIAQFLQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PI+E+QRECP +L+EAI+S+ FAAPRC+DLPEL 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPILESQRECPSELQEAIASIIFAAPRCSDLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  FT KYGKEFV+AA+ELRP+  VNR++IE LSIRAP+ +VKL +LKEIAEE++L
Sbjct  124  QIRNLFTTKYGKEFVSAASELRPDSNVNREIIEKLSIRAPSAEVKLILLKEIAEEYDL  181



>ref|XP_010066717.1| PREDICTED: IST1 homolog [Eucalyptus grandis]
 gb|KCW64728.1| hypothetical protein EUGRSUZ_G02315 [Eucalyptus grandis]
Length=322

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTSLTLAISRIKLLQNKRDLQLKLMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ MMAA  I+ELFCE ++ R+PIIE+QRECP DL+EAI+S+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNMMAAYAILELFCEFVNARIPIIESQRECPTDLREAIASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  FT KYGKEFV AA ELRPE GVNR+LIE LS+ AP   ++LKVLK+IA+EH L
Sbjct  124  QIKNLFTTKYGKEFVLAAAELRPESGVNRELIEKLSVCAPPVKIRLKVLKDIAQEHNL  181



>ref|XP_010051622.1| PREDICTED: uncharacterized protein LOC104440388 [Eucalyptus grandis]
Length=567

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLLRN++E+ +KQMR+++A+LLE+GQ+ TARIRVEH++REEKMMAA E++ELFCELI+
Sbjct  21   RLKLLRNKKEVLVKQMRRDLAQLLESGQDQTARIRVEHVVREEKMMAAYELVELFCELIA  80

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEA+SSV FA+PRC+D+PEL  ++  FT KYGK+F+ AA ELRP
Sbjct  81   ARLPIIESQKNCPIDLKEAVSSVVFASPRCSDVPELMDIRKHFTSKYGKDFITAAVELRP  140

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGVNR L+E LS +AP    K+K+L  IAEEH +
Sbjct  141  DCGVNRSLVEKLSAKAPDGPTKVKILTSIAEEHNI  175



>gb|KCW82531.1| hypothetical protein EUGRSUZ_C03936 [Eucalyptus grandis]
Length=555

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLLRN++E+ +KQMR+++A+LLE+GQ+ TARIRVEH++REEKMMAA E++ELFCELI+
Sbjct  21   RLKLLRNKKEVLVKQMRRDLAQLLESGQDQTARIRVEHVVREEKMMAAYELVELFCELIA  80

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEA+SSV FA+PRC+D+PEL  ++  FT KYGK+F+ AA ELRP
Sbjct  81   ARLPIIESQKNCPIDLKEAVSSVVFASPRCSDVPELMDIRKHFTSKYGKDFITAAVELRP  140

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGVNR L+E LS +AP    K+K+L  IAEEH +
Sbjct  141  DCGVNRSLVEKLSAKAPDGPTKVKILTSIAEEHNI  175



>ref|XP_009356835.1| PREDICTED: IST1 homolog [Pyrus x bretschneideri]
Length=315

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKHMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE QRECP +L+EAISS+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPIIENQRECPTELREAISSIIFAAPRCSDVPDLM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q+   FT KYGKEFV+A +ELRP+ GVNR +IE LS+ AP+ + +LKVLKEIA+E++L
Sbjct  124  QITNLFTAKYGKEFVSAVSELRPDSGVNRTIIEKLSVSAPSGEARLKVLKEIAQEYKL  181



>ref|XP_008339668.1| PREDICTED: IST1 homolog [Malus domestica]
Length=315

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKHMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE Q ECP +L+EAISS+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPIIENQXECPTELREAISSIIFAAPRCSDVPDLM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q+   FT KYGKEFV+AA+ELRP+ GVNR +IE LS+ AP+ + +LKVLKEIA+E++L
Sbjct  124  QITNLFTAKYGKEFVSAASELRPDSGVNRTIIEKLSVSAPSGEARLKVLKEIAQEYKL  181



>ref|XP_009356258.1| PREDICTED: IST1 homolog [Pyrus x bretschneideri]
 ref|XP_009356259.1| PREDICTED: IST1 homolog [Pyrus x bretschneideri]
Length=315

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKNMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE+QRECP +L+EAISS+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPIIESQRECPTELREAISSIIFAAPRCSDVPDLM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q+   FT KYGKEFV+A +ELRP+ GVNR +IE LS+  P+ + +LKVLKEIA+E++L
Sbjct  124  QITNLFTAKYGKEFVSAVSELRPDSGVNRTIIEKLSVSGPSGEARLKVLKEIAKEYKL  181



>ref|XP_009394434.1| PREDICTED: IST1 homolog [Musa acuminata subsp. malaccensis]
Length=326

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++S FN+     +CKT L L I RIKLLRN+RE+QLKQMRKEI++ ++TGQEA ARIRVE
Sbjct  4    LNSLFNRAPFGTRCKTCLNLAISRIKLLRNKRELQLKQMRKEISQYIQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            +IIRE+ ++AA EIIELFCE +  R+P++E+QR+CPL+L+EAISS+ FA+PRC+DLPEL 
Sbjct  64   YIIREQNILAAYEIIELFCEFVLARVPVLESQRDCPLELQEAISSIIFASPRCSDLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  F+ KYGKEFVAAA+ELRPE  VNR +IE L+ RAP  ++K+KVLK IA+E+ L
Sbjct  124  HIRNLFSTKYGKEFVAAASELRPESNVNRMIIEKLTARAPPAELKIKVLKAIAQEYNL  181



>ref|XP_008360045.1| PREDICTED: IST1 homolog [Malus domestica]
Length=315

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKNMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE+QRECP +L+EAISS+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPIIESQRECPTELREAISSIIFAAPRCSDVPDLM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q+   F  KYGKEFV+A +ELRP+ GVNR +IE LS+ AP+ + +LKVLKEIA+E++L
Sbjct  124  QITNLFXAKYGKEFVSAVSELRPDSGVNRTIIEKLSVSAPSGEARLKVLKEIAKEYKL  181



>ref|XP_007046561.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
2 [Theobroma cacao]
 gb|EOX90718.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
2 [Theobroma cacao]
Length=296

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCEL+  RL II  +RECP DLKE I+S+ FAAPRCA++PEL  +
Sbjct  80   IREQNVLAANEFIELFCELVVARLSIIAKRRECPADLKEGIASLIFAAPRCAEIPELVAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS++ P  +VKLKV+KEIA+EH +
Sbjct  140  RDIFQKKYGKDFVSAATDLRPNCGVNRLLIDKLSVKTPTGEVKLKVMKEIAKEHNI  195



>ref|XP_004497085.1| PREDICTED: IST1 homolog isoform X1 [Cicer arietinum]
Length=330

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G  + +CKT L L I R+KLL+N+R++QLKQMRKEI++ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PIIE+Q+ECP +L+EAI+S+ FAAPRC+D+P+L 
Sbjct  64   HIIREQNIWAAYEILELFCEFVLARVPIIESQKECPSELREAIASIIFAAPRCSDIPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV+A +ELRP+ GVNR +IE LSI AP+ +VKLKVL +IAEE+ L
Sbjct  124  HIKNLFTTKYGKEFVSAISELRPDSGVNRTIIEKLSISAPSGEVKLKVLTDIAEEYNL  181



>ref|XP_004497086.1| PREDICTED: IST1 homolog isoform X2 [Cicer arietinum]
Length=326

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G  + +CKT L L I R+KLL+N+R++QLKQMRKEI++ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PIIE+Q+ECP +L+EAI+S+ FAAPRC+D+P+L 
Sbjct  64   HIIREQNIWAAYEILELFCEFVLARVPIIESQKECPSELREAIASIIFAAPRCSDIPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV+A +ELRP+ GVNR +IE LSI AP+ +VKLKVL +IAEE+ L
Sbjct  124  HIKNLFTTKYGKEFVSAISELRPDSGVNRTIIEKLSISAPSGEVKLKVLTDIAEEYNL  181



>ref|XP_010921566.1| PREDICTED: IST1 homolog isoform X2 [Elaeis guineensis]
Length=328

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++S FN+     +CKT L L I RIKLL N+RE+QLK MR+EI + L+TGQEA ARIRVE
Sbjct  4    LNSLFNRATLGTRCKTCLNLAISRIKLLHNKRELQLKNMRREIFQYLQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ ++AA EIIELFCE +  R+PI+E QR CP +L+EA++S+ FA+PRC+DLPEL 
Sbjct  64   HVIREQNILAAYEIIELFCEFVLARVPILETQRNCPSELQEAVASIIFASPRCSDLPELM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QV+  F  KYGKEFV+AA+ELRP+  VNR +IE LS+RAP  D+KLKVLK IA+E+ L
Sbjct  124  QVRNLFAAKYGKEFVSAASELRPDSSVNRTIIEKLSVRAPPADLKLKVLKAIAQEYNL  181



>ref|XP_012089679.1| PREDICTED: uncharacterized protein LOC105648034 isoform X2 [Jatropha 
curcas]
Length=460

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  382  VEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPE  561
            VEHIIREE MMAAQEI+ELFCELISVRLPIIEAQRECPLDLKEAISS+CFAAPRCADLPE
Sbjct  2    VEHIIREENMMAAQEILELFCELISVRLPIIEAQRECPLDLKEAISSICFAAPRCADLPE  61

Query  562  LQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L QVQ+ F  KYGKEFVAAA+EL PECGVNRQLIELLSIRAP+P+VKLK+LKEIAEEHEL
Sbjct  62   LLQVQMLFASKYGKEFVAAASELMPECGVNRQLIELLSIRAPSPEVKLKLLKEIAEEHEL  121



>ref|XP_008243237.1| PREDICTED: IST1 homolog [Prunus mume]
Length=316

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I R+KLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLNLAISRMKLLQNKRDVQLKHMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE+QRECP +L+EAISS+ FA+PRC+++P+L 
Sbjct  64   HVIREQDIWAAYEILELFCEFVLARVPIIESQRECPPELREAISSIIFASPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  FT KYGKEFV+AA+ELRP+ GVNR +IE LS+ AP+ + +L+VLKEIA+E+ L
Sbjct  124  QIKNLFTAKYGKEFVSAASELRPDSGVNRTIIEKLSVSAPSGEARLRVLKEIAQEYNL  181



>ref|XP_007222948.1| hypothetical protein PRUPE_ppa008869mg [Prunus persica]
 gb|EMJ24147.1| hypothetical protein PRUPE_ppa008869mg [Prunus persica]
Length=316

 Score =   217 bits (552),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I R+KLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLNLAISRMKLLQNKRDVQLKHMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE+QRECP +L+EAISS+ FA+PRC+++P+L 
Sbjct  64   HVIREQDIWAAYEILELFCEFVLARVPIIESQRECPPELREAISSIIFASPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  FT KYGKEFV+AA+ELRP+ GVNR +IE LS+ AP+ + +L+VLKEIA+E+ L
Sbjct  124  QIKNLFTAKYGKEFVSAASELRPDSGVNRTIIEKLSVSAPSGEARLRVLKEIAQEYNL  181



>gb|EPS57911.1| hypothetical protein M569_16906, partial [Genlisea aurea]
Length=201

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + R+KLLRN+RE+ ++QMR+++A LLETGQ+ATARIRVEH+IRE+ ++AA E+IELFCEL
Sbjct  8    VARVKLLRNKREVVIRQMRRDVAMLLETGQDATARIRVEHVIREQNILAANELIELFCEL  67

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  RL II  QRECP DLKE ISS+ FAAPRC+D+PEL  ++  F  KYG++FV+AAT+L
Sbjct  68   VVARLSIISKQRECPADLKEGISSLLFAAPRCSDIPELLSIRDVFAKKYGEDFVSAATDL  127

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP  GVNR LIE LS+++P+ + KLKVLK+IA E+++
Sbjct  128  RPNAGVNRLLIEKLSVKSPSGETKLKVLKDIANEYKV  164



>gb|EEC71300.1| hypothetical protein OsI_03320 [Oryza sativa Indica Group]
Length=319

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  202  NEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIR  381
            + ++S FN+     KCKT L L I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIR
Sbjct  2    SSLNSLFNRSTFGTKCKTCLNLVISRIKLLRNRRELQLINMRKEMVQYLQTGQESIARIR  61

Query  382  VEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPE  561
            VEHIIRE+ ++AA EI+ELFCE +  R+PI+E Q+ECPL+L+EAI+S+ FA+ RC+DLPE
Sbjct  62   VEHIIREQNILAAYEIVELFCEFVLARVPIVEVQKECPLELREAIASIIFASGRCSDLPE  121

Query  562  LQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L  ++  FT KYGKEFVAAA ELRP+ GVNR +IE LS++AP+ + KLKVLK IA+E+ L
Sbjct  122  LMHLRTLFTTKYGKEFVAAAMELRPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAQEYGL  181



>ref|XP_011079063.1| PREDICTED: uncharacterized protein LOC105162673 [Sesamum indicum]
Length=473

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F++GF  +KCKT+ K+ + R+KLLRN+RE+ +KQMR++IA LLE+GQ++TARIRVEH+
Sbjct  17   SLFSRGFNPSKCKTMSKMAVARVKLLRNKREVVIKQMRRDIAMLLESGQDSTARIRVEHV  76

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA E+IELFCEL+  RL II  QRECP DLKE I+S+ FAAPRC+D+PEL  +
Sbjct  77   IREQNIMAANELIELFCELVVARLSIIAKQRECPADLKEGIASLIFAAPRCSDIPELLSI  136

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS++ P+ ++KLKVLKEIA+E+++
Sbjct  137  RDVFQKKYGKDFVSAATDLRPNAGVNRMLIEKLSVKTPSGEIKLKVLKEIAKEYQV  192



>gb|EYU30364.1| hypothetical protein MIMGU_mgv1a006443mg [Erythranthe guttata]
Length=444

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            + F +GF  +KCKT+ K+T+ R+KLLRN+R++ +KQMR++IA LLE+GQ+ATARIRVEH+
Sbjct  21   ALFRRGFNPSKCKTMAKMTVARVKLLRNKRDVVIKQMRRDIAMLLESGQDATARIRVEHV  80

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA E+IELFCEL+  RL II  QRECP DLKE ISS+ FA PRC+D+PEL  +
Sbjct  81   IREQNIMAANELIELFCELVVARLSIIAKQRECPADLKEGISSLIFAGPRCSDIPELLSI  140

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS++ P+ +VK+KVLKEIA+E+++
Sbjct  141  RDVFQKKYGKDFVSAATDLRPNAGVNRMLIEKLSVKTPSGEVKMKVLKEIAKEYQV  196



>ref|XP_008389286.1| PREDICTED: IST1 homolog [Malus domestica]
Length=315

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKNMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE+QRECP +L+EAISS+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPIIESQRECPTELREAISSIIFAAPRCSDVPDLM  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q+   F  KYGKEFV+A +ELRP+ GVNR +IE LS+ AP+ + +LKVLKE A+E++L
Sbjct  124  QITNLFXAKYGKEFVSAVSELRPDSGVNRTIIEKLSVSAPSGEARLKVLKEXAKEYKL  181



>ref|XP_006644556.1| PREDICTED: IST1-like protein-like [Oryza brachyantha]
Length=317

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  202  NEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIR  381
            + ++S FN+     KCKT L L I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIR
Sbjct  2    SSLNSLFNRSTFGTKCKTCLNLVISRIKLLRNRRELQLINMRKEMVQYLQTGQESIARIR  61

Query  382  VEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPE  561
            VEHIIRE+ ++AA EI+ELFCE +  R+PI+E Q+ECPL+L+EAI+S+ FA+ RC+DLPE
Sbjct  62   VEHIIREQNILAAYEIVELFCEFVLARVPIVEVQKECPLELREAIASIIFASGRCSDLPE  121

Query  562  LQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L  ++  FT KYGKEFVAAA ELRP+ GVNR +IE LS++AP+ + KLKVLK IA+E+ L
Sbjct  122  LMHLRTLFTTKYGKEFVAAAMELRPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAQEYGL  181



>gb|EMS45366.1| hypothetical protein TRIUR3_03192 [Triticum urartu]
Length=295

 Score =   215 bits (547),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIRVEHIIRE+ ++AA EI+ELFCE + 
Sbjct  4    RIKLLRNRREMQLINMRKEMVQYLQTGQESIARIRVEHIIREQNILAAYEIVELFCEFVL  63

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             R+PI+EAQ+ECP++L+EAI+S+ FA+ RC+DLPEL  ++  FT KYGKEFVAAA ELRP
Sbjct  64   ARVPIVEAQKECPIELREAIASIIFASGRCSDLPELMHLRNLFTTKYGKEFVAAAMELRP  123

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGVNR +IE LS++AP+ + KLKVLK IA E+ L
Sbjct  124  DCGVNRTIIEKLSVKAPSAESKLKVLKAIAHEYNL  158



>ref|XP_003547905.1| PREDICTED: IST1-like protein-like [Glycine max]
Length=441

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S    GF ++KCKT  K+ + RIKLLRN+RE+ ++QMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLLRLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            +RE+ ++AA E IELFCEL+  RLPII  QRECP DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   MREQNVLAANEFIELFCELVVARLPIISKQRECPADLKEGIASLIFAAPRCSEIPELVAL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AA +LRP CGVNRQLIE LS+R P  +VKLKVLKEIA+EH++
Sbjct  140  KNIFDKKYGKDFVSAAVDLRPSCGVNRQLIEKLSVRTPPGEVKLKVLKEIAKEHQI  195



>ref|XP_004140335.1| PREDICTED: IST1 homolog [Cucumis sativus]
 gb|KGN50955.1| hypothetical protein Csa_5G367190 [Cucumis sativus]
Length=323

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G  A KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+TGQE  ARIRVE
Sbjct  4    LNQLFNRGVFAGKCKTCLSLAISRIKLLQNKRDMQLKLMRKEIAQFLQTGQEQIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PIIE+QRECP++L+EAI+S+ FAAPRC+DLP+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPIIESQRECPVELREAIASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEFV+A +ELRP+ GVNR +IE LS+ AP  ++KLKV+KEIA+EH L
Sbjct  124  QLKNLFAVKYGKEFVSAISELRPDSGVNRSIIEKLSVSAPPGELKLKVMKEIAKEHGL  181



>gb|KHN35563.1| IST1-like protein [Glycine soja]
Length=436

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  GFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEK  408
            GF ++KCKT  K+ + RIKLLRN+RE+ ++QMR++IA LL++GQ+ATARIRVEH++RE+ 
Sbjct  20   GFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATARIRVEHVMREQN  79

Query  409  MMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFT  588
            ++AA E IELFCEL+  RLPII  QRECP DLKE I+S+ FAAPRC+++PEL  ++  F 
Sbjct  80   VLAANEFIELFCELVVARLPIISKQRECPADLKEGIASLIFAAPRCSEIPELVALKNIFD  139

Query  589  GKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             KYGK+FV+AA +LRP CGVNRQLIE LS+R P  +VKLKVLKEIA+EH++
Sbjct  140  KKYGKDFVSAAVDLRPSCGVNRQLIEKLSVRTPPGEVKLKVLKEIAKEHQI  190



>ref|XP_011628969.1| PREDICTED: uncharacterized protein LOC18424324 [Amborella trichopoda]
Length=459

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            M S F K F ++KCKTL+KL + RIKLLRN+++IQ+KQMR+++A L+E+GQEA+ARIRVE
Sbjct  1    MLSMFRKSFNSSKCKTLVKLAMSRIKLLRNKKDIQIKQMRRDVAMLIESGQEASARIRVE  60

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA +IIELFCEL+  RL IIE++R CP+DLKE ISS+ FAAPRCAD+PEL 
Sbjct  61   HVIREQNIAAANDIIELFCELVVARLSIIESKRGCPVDLKEGISSLIFAAPRCADIPELL  120

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYG EF+AAATELRP+CGVNR LIE LS R  + + KL+V+KEIA+E+ +
Sbjct  121  QIRNIFQKKYGHEFIAAATELRPDCGVNRTLIEKLSTRTASGEAKLRVMKEIAKEYHV  178



>ref|XP_003536682.1| PREDICTED: IST1 homolog isoform X1 [Glycine max]
 gb|KHN05563.1| IST1 like [Glycine soja]
Length=324

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    +CKT L L I RIKLL+N+R+IQLKQM KEI++ L+ GQEA ARIRVE
Sbjct  4    INQLFNRGVFGTRCKTCLNLAISRIKLLQNKRDIQLKQMCKEISQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+   AA EI+ELFCE +  R+PIIE QRECP +L+EAI+S+ FAAPRC+D+P+L 
Sbjct  64   HIIREQNTWAAYEILELFCEFVLARVPIIENQRECPTELREAIASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV+A +ELRP+ GVNR +IE LS+ AP+ +VKLKVL+EIAEE+ +
Sbjct  124  HIKNLFTTKYGKEFVSAVSELRPDSGVNRTIIEKLSVSAPSGEVKLKVLREIAEEYNI  181



>ref|XP_003555907.1| PREDICTED: IST1 homolog [Glycine max]
 gb|KHN11413.1| IST1 like [Glycine soja]
Length=324

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    +CKT L L I RIKLL+N+R++QLKQM KEI++ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTRCKTCLNLAISRIKLLQNKRDMQLKQMCKEISQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+   AA EI+ELFCE +  R+PIIE QRECP +L+EAI+S+ FAAPRC+D+P+L 
Sbjct  64   HIIREQNTWAAYEILELFCEFVLARVPIIENQRECPTELREAIASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV+A +ELRP+ GVNR +IE LS+ AP+ +VKLKVL+EIAEE+ +
Sbjct  124  HIKNLFTTKYGKEFVSAVSELRPDSGVNRTIIEKLSVSAPSGEVKLKVLREIAEEYNI  181



>emb|CBI33275.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT+ K+ + RIKLLRN+RE  ++QMR++IA LL++GQ+ATARIRVEH+
Sbjct  6    SIFRRGFSSSKCKTMAKMAMARIKLLRNKREAVVRQMRRDIALLLQSGQDATARIRVEHV  65

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E +ELFCELI  RL II  QR+CP DLKE ISS+ FAAPRC+D+PEL  +
Sbjct  66   IREQNILAANEFLELFCELIIARLTIISKQRDCPADLKEGISSLIFAAPRCSDIPELLAI  125

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  +VKLKV+KEIA+E+++
Sbjct  126  RDNFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRTPMGEVKLKVMKEIAKEYQI  181



>ref|NP_001043915.1| Os01g0687700 [Oryza sativa Japonica Group]
 dbj|BAD82544.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05829.1| Os01g0687700 [Oryza sativa Japonica Group]
 dbj|BAG87765.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93751.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  202  NEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIR  381
            + ++S FN+     KCKT L L I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIR
Sbjct  2    SSLNSLFNRSTFGTKCKTCLNLVISRIKLLRNRRELQLINMRKEMVQYLQTGQESIARIR  61

Query  382  VEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPE  561
            VEHIIRE+ ++AA EI+ELFCE +  R+PI+E Q+ECP +L+EAI+S+ FA+ RC+DLPE
Sbjct  62   VEHIIREQNILAAYEIVELFCEFVLARVPIVEVQKECPFELREAIASIIFASGRCSDLPE  121

Query  562  LQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L  ++  FT KYGKEFVAAA ELRP+ GVNR +IE LS++AP+ + KLKVLK IA+E+ L
Sbjct  122  LMHLRTLFTTKYGKEFVAAAMELRPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAQEYGL  181



>ref|XP_002969507.1| hypothetical protein SELMODRAFT_91777, partial [Selaginella moellendorffii]
 gb|EFJ29595.1| hypothetical protein SELMODRAFT_91777, partial [Selaginella moellendorffii]
Length=190

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLLRN+R+IQ+KQMR++IA++L TGQE +ARIRVEH+IRE+ +M A +++ELF ELI 
Sbjct  10   RIKLLRNKRDIQVKQMRRDIAQMLGTGQEPSARIRVEHVIREQNIMDAYDMVELFAELIV  69

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
            VRLP+I+ Q+ CP DLKE+I+S+ FAA RCADLPEL  ++  F  KYGKEFVAAA ELRP
Sbjct  70   VRLPVIDGQKTCPADLKESIASLIFAAARCADLPELADIKSCFALKYGKEFVAAAAELRP  129

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
             CGV+R++IE +S+RAP+ + KLKVLKEIA E+
Sbjct  130  TCGVSRRIIEKMSVRAPSGETKLKVLKEIATEY  162



>ref|XP_002986780.1| hypothetical protein SELMODRAFT_124829, partial [Selaginella 
moellendorffii]
 gb|EFJ12110.1| hypothetical protein SELMODRAFT_124829, partial [Selaginella 
moellendorffii]
Length=190

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLLRN+R+IQ+KQMR++IA++L TGQE +ARIRVEH+IRE+ +M A +++ELF ELI 
Sbjct  10   RIKLLRNKRDIQVKQMRRDIAQMLGTGQEPSARIRVEHVIREQNIMDAYDMVELFAELIV  69

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
            VRLP+I+ Q+ CP DLKE+I+S+ FAA RCADLPEL  ++  F  KYGKEFVAAA ELRP
Sbjct  70   VRLPVIDGQKTCPADLKESIASLIFAAARCADLPELADIKSCFALKYGKEFVAAAAELRP  129

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
             CGV+R++IE +S+RAP+ + KLKVLKEIA E+
Sbjct  130  TCGVSRRIIEKMSVRAPSGETKLKVLKEIATEY  162



>emb|CDM83872.1| unnamed protein product [Triticum aestivum]
 emb|CDM83875.1| unnamed protein product [Triticum aestivum]
Length=319

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIRVEHIIRE+ ++AA EI+ELFCE 
Sbjct  26   ISRIKLLRNRREMQLINMRKEMVQYLQTGQESIARIRVEHIIREQNILAAYEIVELFCEF  85

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  R+PI+EAQ+ECP++L+EAI+S+ FA+ RC+DLPEL  ++  FT KYGK+FVAAA EL
Sbjct  86   VLARVPIVEAQKECPIELREAIASIIFASGRCSDLPELMHLRNLFTTKYGKDFVAAAMEL  145

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR +IE LS++AP+ + KLKVLK IA E+ L
Sbjct  146  RPDCGVNRTIIEKLSVKAPSAESKLKVLKAIAHEYNL  182



>ref|XP_004969594.1| PREDICTED: IST1-like protein-like [Setaria italica]
Length=318

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  202  NEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIR  381
            + ++S FN+     KCKT L L I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIR
Sbjct  2    SSLNSLFNRSTFGTKCKTCLNLVISRIKLLRNRRELQLINMRKEMVQYLQTGQESIARIR  61

Query  382  VEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPE  561
            VEHIIRE+ ++AA EI+ELFCE +  R+PI+E Q+ECPL+L+EAISS+ FA+ RC+DLPE
Sbjct  62   VEHIIREQNILAAYEIVELFCEFVLARVPIVEVQKECPLELREAISSIIFASGRCSDLPE  121

Query  562  LQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L  ++  FT KYGKEFVA A ELRP+ GVNR +IE LS++AP+ + KLKVLK IA+E+ +
Sbjct  122  LMHLRNLFTTKYGKEFVAGAMELRPDSGVNRTIIEKLSVKAPSGESKLKVLKAIAQEYNV  181



>ref|XP_007044322.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
 gb|EOY00154.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
Length=327

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTCLSLAISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PI+E+Q+ECP +L+EA++S+ FAAPRC+D+P+L 
Sbjct  64   HIIREQNIWAAYEILELFCEFVLARVPILESQKECPSELREAVASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F+ KYGKEFV AA+ELRP+  VNR +IE LS+ AP+ +++LKVLKEIA+EH +
Sbjct  124  QIKNLFSTKYGKEFVTAASELRPDSSVNRAIIEKLSVSAPSGEIRLKVLKEIAQEHSV  181



>gb|ACU23342.1| unknown [Glycine max]
Length=324

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    +CKT L L I RIKLL+N+R++QLKQM KEI++ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGTRCKTCLNLAISRIKLLQNKRDMQLKQMCKEISQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+   AA EI+ELFCE +  R+PIIE QRECP +L+EAI+S+ FAAPRC+D+P+L 
Sbjct  64   HIIREQNTWAAYEILELFCEFVLARVPIIENQRECPTELREAIASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV+A +ELRP+ GVNR +IE LS+ AP+ +VKLKVL EIAEE+ +
Sbjct  124  HIKNLFTTKYGKEFVSAVSELRPDSGVNRTIIEKLSVSAPSGEVKLKVLWEIAEEYNI  181



>ref|XP_010935225.1| PREDICTED: IST1-like protein [Elaeis guineensis]
Length=463

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  KL + RIKLLRN+RE+Q++QMR++IA LL++ QE TARIRVEH+
Sbjct  18   SIFRRGFNSSKCKTEAKLAMARIKLLRNKREVQVRQMRRDIAMLLQSRQEDTARIRVEHV  77

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA EIIELFCELI VRLPII  QR+CP DLKE ISS+ +AAPRC+++PEL ++
Sbjct  78   IREQNVMAANEIIELFCELIVVRLPIIAKQRDCPADLKEGISSLIYAAPRCSEIPELSRI  137

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVN  LIE LS+R P  +VKLK++KEIA+E+++
Sbjct  138  RDIFEKKYGKDFVSAATDLRPNSGVNCMLIEKLSVRKPTGEVKLKIMKEIAKEYQI  193



>ref|XP_002533970.1| protein with unknown function [Ricinus communis]
 gb|EEF28417.1| protein with unknown function [Ricinus communis]
Length=327

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L+I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTCLTLSISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PI+E+Q+ECP +L+EA++S+ FAAPRC+++P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPILESQKECPFELQEAVASIIFAAPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  FT KYGKEFV AA+ELRP+ GVNR +IE LS+ AP  + +LKVLKEIA E+ L
Sbjct  124  QIKNLFTTKYGKEFVMAASELRPDSGVNRAIIERLSVNAPPGEARLKVLKEIAHEYNL  181



>ref|XP_004299071.1| PREDICTED: IST1 homolog [Fragaria vesca subsp. vesca]
Length=313

 Score =   213 bits (543),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L ++I RIKLL+N+R++QLK MRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGTKCKTCLHMSISRIKLLQNKRDMQLKHMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE I  R+PIIE+Q++CP +L+EAISS+ F+APRC+++P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFILARVPIIESQKDCPPELREAISSIIFSAPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  FT KYGKEF+AAA+ELRP+ GVNR +IE LS+ AP+ + +LKVLKEIA+E+ L
Sbjct  124  QIKNLFTAKYGKEFIAAASELRPDSGVNRTIIEKLSVSAPSGEERLKVLKEIAQEYNL  181



>ref|XP_003635529.1| PREDICTED: IST1-like protein [Vitis vinifera]
Length=436

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT+ K+ + RIKLLRN+RE  ++QMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SIFRRGFSSSKCKTMAKMAMARIKLLRNKREAVVRQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E +ELFCELI  RL II  QR+CP DLKE ISS+ FAAPRC+D+PEL  +
Sbjct  80   IREQNILAANEFLELFCELIIARLTIISKQRDCPADLKEGISSLIFAAPRCSDIPELLAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  +VKLKV+KEIA+E+++
Sbjct  140  RDNFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRTPMGEVKLKVMKEIAKEYQI  195



>gb|EMT07440.1| hypothetical protein F775_26144 [Aegilops tauschii]
Length=309

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  280  IKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELISV  459
            IKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIRVEHIIRE+ ++AA EI+ELFCE +  
Sbjct  19   IKLLRNRREMQLINMRKEMVQYLQTGQESIARIRVEHIIREQNILAAYEIVELFCEFVLA  78

Query  460  RLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRPE  639
            R+PI+EAQ+ECP++L+EAI+S+ FA+ RC+DLPEL  ++  FT KYGKEFVAAA ELRP+
Sbjct  79   RVPIVEAQKECPIELREAIASIIFASGRCSDLPELMHLRNLFTTKYGKEFVAAAMELRPD  138

Query  640  CGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            CGVNR +IE LS++AP+ + KLKVLK IA E+ L
Sbjct  139  CGVNRTIIEKLSVKAPSAESKLKVLKAIAHEYNL  172



>ref|XP_003635213.2| PREDICTED: IST1-like protein [Vitis vinifera]
Length=436

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT+ K+ + RIKLLRN+RE  ++QMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SIFRRGFSSSKCKTMAKMAMARIKLLRNKREAVVRQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E +ELFCELI  RL II  QR+CP DLKE ISS+ FAAPRC+D+PEL  +
Sbjct  80   IREQNILAANEFLELFCELIIARLTIISKQRDCPADLKEGISSLIFAAPRCSDIPELLAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  +VKLKV+KEIA+E+++
Sbjct  140  RDNFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRTPMGEVKLKVMKEIAKEYQI  195



>ref|NP_001141797.1| hypothetical protein [Zea mays]
 ref|XP_008672490.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672491.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87063.1| unknown [Zea mays]
 gb|ACF87127.1| unknown [Zea mays]
 gb|ACN26572.1| unknown [Zea mays]
 tpg|DAA58062.1| TPA: hypothetical protein ZEAMMB73_112435 [Zea mays]
 tpg|DAA58063.1| TPA: hypothetical protein ZEAMMB73_112435 [Zea mays]
Length=321

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +1

Query  202  NEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIR  381
            + ++S FN+     KCKT L L I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIR
Sbjct  2    SSLNSLFNRSTFGTKCKTCLNLVISRIKLLRNRRELQLINMRKEMVQYLQTGQESIARIR  61

Query  382  VEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPE  561
            VEHIIRE+ ++AA EI+ELFCE +  R+PI+E Q+ECPL+L+EAI+S+ FA+ RC+DLPE
Sbjct  62   VEHIIREQNILAAYEIVELFCEFVLARVPIVEVQKECPLELREAIASIIFASGRCSDLPE  121

Query  562  LQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L  ++  FT KYGKEFVA A ELRP+  VNR +IE LS++AP+ D KLKVLK IA+E+ +
Sbjct  122  LMHLRNLFTTKYGKEFVAGAMELRPDSSVNRTIIEKLSVKAPSGDSKLKVLKAIAQEYNI  181



>ref|XP_010941392.1| PREDICTED: IST1-like protein [Elaeis guineensis]
Length=462

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCKT  +L   RIKLLRN+RE+Q++QMR++IA LLE+ QE TARIRVEH+
Sbjct  18   SIFRHGFNSSKCKTEARLATARIKLLRNKREVQVRQMRRDIAMLLESHQEDTARIRVEHV  77

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA EIIELFCELI VRL II  QR CP DLKE+ISS+ +AAPRC+++PEL ++
Sbjct  78   IREQNVMAANEIIELFCELIVVRLSIIAKQRHCPADLKESISSLIYAAPRCSEIPELCRI  137

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK FV+AAT+LRP  GVNR LIE LS+R PA +VKLKV++EIA+E+E+
Sbjct  138  RDIFEKKYGKGFVSAATDLRPNSGVNRMLIEKLSVRKPAGEVKLKVMREIAKEYEI  193



>ref|XP_003592663.1| IST1-like protein, partial [Medicago truncatula]
Length=245

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  F++G  + +CKT L L I R+KLL+N+R++QLKQMRKEI++ L+ GQE  ARIRVE
Sbjct  4    LNQLFSRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PIIE+Q+ECP +L+EAI+S+ FAAPRC D+P+L 
Sbjct  64   HIIREQNIWAAYEILELFCEFVLARVPIIESQKECPSELREAIASIIFAAPRCPDIPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV A +ELRP+ GVNR +IE LS+ AP+ ++KLKVL +IAEE+ L
Sbjct  124  HIKNLFTTKYGKEFVTAISELRPDSGVNRTIIEKLSVSAPSGEIKLKVLTDIAEEYNL  181



>ref|XP_007046560.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
1 [Theobroma cacao]
 gb|EOX90717.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
1 [Theobroma cacao]
Length=447

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCEL+  RL II  +RECP DLKE I+S+ FAAPRCA++PEL  +
Sbjct  80   IREQNVLAANEFIELFCELVVARLSIIAKRRECPADLKEGIASLIFAAPRCAEIPELVAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS++ P  +VKLKV+KEIA+EH +
Sbjct  140  RDIFQKKYGKDFVSAATDLRPNCGVNRLLIDKLSVKTPTGEVKLKVMKEIAKEHNI  195



>ref|XP_007156216.1| hypothetical protein PHAVU_003G268000g [Phaseolus vulgaris]
 gb|ESW28210.1| hypothetical protein PHAVU_003G268000g [Phaseolus vulgaris]
Length=420

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  GFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEK  408
            GF ++KCKT  K+ + RIKLLRN+RE+ ++QMR++IA LL++GQ+ATARIRVEH++RE+ 
Sbjct  25   GFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATARIRVEHVMREQN  84

Query  409  MMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFT  588
            ++AA E IELFCELI  RL II  QRECP DLKE I+S+ FA+PRC+++PEL  ++  F 
Sbjct  85   VLAANEFIELFCELIVARLSIIAKQRECPADLKEGIASLIFASPRCSEIPELVSLKKIFE  144

Query  589  GKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             KYGK+FV+AA ELRP CGVNRQLIE LS+R P  +VKLKVLKEIA+EH++
Sbjct  145  KKYGKDFVSAAVELRPSCGVNRQLIEKLSVRTPPGEVKLKVLKEIAKEHQI  195



>ref|XP_003517626.1| PREDICTED: dentin sialophosphoprotein-like [Glycine max]
Length=1064

 Score =   224 bits (572),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 98/157 (62%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL+N+RE Q+KQ+++E+A+LLE+GQ+ TARIRVEH++REEK MAA +++E++CEL
Sbjct  19   VSRIKLLKNKREAQIKQLKRELAQLLESGQDRTARIRVEHVVREEKTMAAYDLVEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLP+IE+Q+ CP+DLKEA+SSV FA+PRC+DLPEL  V+   T KYGKEFV+AA EL
Sbjct  79   IAARLPMIESQKNCPIDLKEAVSSVIFASPRCSDLPELMDVKKQITSKYGKEFVSAAIEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR L+E LS +AP    K+K+L  IAEEH +
Sbjct  139  RPDCGVNRMLVEKLSAKAPDGPTKIKILAAIAEEHNI  175



>ref|XP_006448467.1| hypothetical protein CICLE_v10015906mg [Citrus clementina]
 gb|ESR61707.1| hypothetical protein CICLE_v10015906mg [Citrus clementina]
Length=328

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I R+KLL+N+RE+QLKQMRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTSLTLGISRMKLLQNKRELQLKQMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA  ++ELFCE +  R+PI+E+Q+ECP +++EA++S+ FAAPRC+DLP+L 
Sbjct  64   HVIREQNICAAYAVLELFCEFLLARVPILESQKECPTEMREAVASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F+ KYGKEFV A +ELRP+ GVNR +IE LS+ AP+ + +LKVLKEIA+EH L
Sbjct  124  QIKNLFSAKYGKEFVLAVSELRPDSGVNRTIIEKLSVSAPSSEARLKVLKEIAQEHNL  181



>gb|AFK46378.1| unknown [Medicago truncatula]
Length=326

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  F++G  + +CKT L L I R+KLL+N+R++QLKQMRKEI++ L+ GQE  ARIRVE
Sbjct  4    LNQLFSRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PIIE+Q+ECP +L+EAI+S+ FAAPRC+D+P+L 
Sbjct  64   HIIREQNIWAAYEILELFCEFVLARVPIIESQKECPSELREAIASIIFAAPRCSDIPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV A +ELRP+ GVNR +IE LS+ AP+ ++KLKVL +IAEE+ L
Sbjct  124  HIRNLFTTKYGKEFVTAISELRPDSGVNRTIIEKLSVSAPSGEIKLKVLTDIAEEYNL  181



>ref|XP_004513087.1| PREDICTED: dentin sialophosphoprotein-like [Cicer arietinum]
Length=1062

 Score =   224 bits (571),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 108/174 (62%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +1

Query  220  FNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIR  399
             ++ FK AKCKT LKL + RIKLLRN+R+ Q+KQ+++E+AKLLE+GQ+ TARIRVEH++R
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLRNKRDAQVKQLKRELAKLLESGQDQTARIRVEHVVR  61

Query  400  EEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQL  579
            EEK MAA E++E++CELI+ RLP+IE+Q+ CP+DLKEAI+SV FA PRC+D+PEL  V+ 
Sbjct  62   EEKTMAAYELVEIYCELIAARLPMIESQKHCPIDLKEAIASVIFATPRCSDIPELMDVKK  121

Query  580  AFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
                KYGKEFV+AA ELRP+CGVNR L+E LS +AP    K+K+L  IAEEH +
Sbjct  122  HIVSKYGKEFVSAAVELRPDCGVNRLLVEKLSAKAPDGPTKIKILAAIAEEHNI  175



>ref|XP_010921561.1| PREDICTED: IST1 homolog isoform X1 [Elaeis guineensis]
Length=368

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            I RIKLL N+RE+QLK MR+EI + L+TGQEA ARIRVEH+IRE+ ++AA EIIELFCE 
Sbjct  65   ISRIKLLHNKRELQLKNMRREIFQYLQTGQEAIARIRVEHVIREQNILAAYEIIELFCEF  124

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  R+PI+E QR CP +L+EA++S+ FA+PRC+DLPEL QV+  F  KYGKEFV+AA+EL
Sbjct  125  VLARVPILETQRNCPSELQEAVASIIFASPRCSDLPELMQVRNLFAAKYGKEFVSAASEL  184

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+  VNR +IE LS+RAP  D+KLKVLK IA+E+ L
Sbjct  185  RPDSSVNRTIIEKLSVRAPPADLKLKVLKAIAQEYNL  221



>gb|KCW82257.1| hypothetical protein EUGRSUZ_C03673 [Eucalyptus grandis]
Length=1289

 Score =   226 bits (575),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 112/181 (62%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +1

Query  199  RNEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARI  378
            R +     +K FK AKCKT LKL   R+KLLRN++E+Q+KQMR+++A+LLE+GQ+ TARI
Sbjct  61   RADEKKMLHKSFKPAKCKTALKLAASRLKLLRNKKEVQVKQMRRDLAQLLESGQDQTARI  120

Query  379  RVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLP  558
            RVEH++REEKMMAA E++ELFCELI+ RLPIIE+Q+ CP+DLKEA+SSV FA+PRC+D+P
Sbjct  121  RVEHVVREEKMMAAYELVELFCELIAARLPIIESQKNCPIDLKEAVSSVVFASPRCSDVP  180

Query  559  ELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHE  738
            EL  ++  FT KYGK+F+ AA ELRP+CGVNR L+E LS +AP    K+K+L  IAEEH 
Sbjct  181  ELMDIRKHFTAKYGKDFITAAVELRPDCGVNRSLVEKLSAKAPDGPTKVKILTSIAEEHN  240

Query  739  L  741
            +
Sbjct  241  I  241



>gb|KCW56546.1| hypothetical protein EUGRSUZ_I02282 [Eucalyptus grandis]
Length=945

 Score =   223 bits (569),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 109/176 (62%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GFK++KCKT  K+T+ RIKLLRN+R+  ++QMR++IA LL++GQ+ATAR+RVEH+
Sbjct  20   SLFGGGFKSSKCKTAAKMTVARIKLLRNKRQAVVRQMRRDIALLLQSGQDATARVRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            +RE+ ++AA E IELFCELI  RL II  QRECP DLKE ISS+ FAAPRC+++PEL  +
Sbjct  80   LREQNILAANEFIELFCELIVARLQIISKQRECPADLKEGISSLIFAAPRCSEIPELAAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FVAAA ELRP CGVNR LI+ LS+R P+ + K+KVLKEIA+EH++
Sbjct  140  RKLFEKKYGKDFVAAAIELRPNCGVNRMLIDKLSVRTPSGETKMKVLKEIAKEHQV  195



>ref|XP_008781253.1| PREDICTED: IST1-like protein [Phoenix dactylifera]
Length=448

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  KL + RIKLLRN+RE+Q++QMR++IA LL++ QE TARIRVEH+
Sbjct  18   SMFRRGFNSSKCKTEAKLAMARIKLLRNKREVQVRQMRRDIAMLLQSRQEDTARIRVEHV  77

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA EIIELFCELI  RLPII  QR+CP DLKE ISS+ +AAPRC+++PEL ++
Sbjct  78   IREQNVMAANEIIELFCELIVGRLPIIAKQRDCPTDLKEGISSLIYAAPRCSEIPELSRI  137

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVN  LIE LS+R P  +VKLK++KEIA+E+++
Sbjct  138  RDIFEKKYGKDFVSAATDLRPNSGVNCMLIEKLSVRKPTGEVKLKIMKEIAKEYQI  193



>ref|XP_008465781.1| PREDICTED: IST1 homolog [Cucumis melo]
Length=325

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G  A KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+TGQE  ARIRVE
Sbjct  4    LNQLFNRGVFAGKCKTCLSLAISRIKLLQNKRDLQLKLMRKEIAQFLQTGQEQIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ +  A EI+ELFCE +  R+PIIE+QRECP++L+EAI+S+ FAAPRC+DLP+L 
Sbjct  64   HVIREQNIWDAYEILELFCEFVLARVPIIESQRECPVELREAIASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEFV+A +ELRP+ GVNR +IE LS+ AP  ++KLKV+KEIA++H L
Sbjct  124  QLKNLFAVKYGKEFVSAISELRPDSGVNRSIIEKLSVSAPPGELKLKVMKEIAKQHGL  181



>gb|AES62914.2| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=326

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  F++G  + +CKT L L I R+KLL+N+R++QLKQMRKEI++ L+ GQE  ARIRVE
Sbjct  4    LNQLFSRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PIIE+Q+ECP +L+EAI+S+ FAAPRC D+P+L 
Sbjct  64   HIIREQNIWAAYEILELFCEFVLARVPIIESQKECPSELREAIASIIFAAPRCPDIPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  FT KYGKEFV A +ELRP+ GVNR +IE LS+ AP+ ++KLKVL +IAEE+ L
Sbjct  124  HIKNLFTTKYGKEFVTAISELRPDSGVNRTIIEKLSVSAPSGEIKLKVLTDIAEEYNL  181



>ref|XP_010029609.1| PREDICTED: IST1-like protein [Eucalyptus grandis]
Length=466

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GFK++KCKT  K+T+ RIKLLRN+R+  ++QMR++IA LL++GQ+ATAR+RVEH+
Sbjct  20   SLFGGGFKSSKCKTAAKMTVARIKLLRNKRQAVVRQMRRDIALLLQSGQDATARVRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            +RE+ ++AA E IELFCELI  RL II  QRECP DLKE ISS+ FAAPRC+++PEL  +
Sbjct  80   LREQNILAANEFIELFCELIVARLQIISKQRECPADLKEGISSLIFAAPRCSEIPELAAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FVAAA ELRP CGVNR LI+ LS+R P+ + K+KVLKEIA+EH++
Sbjct  140  RKLFEKKYGKDFVAAAIELRPNCGVNRMLIDKLSVRTPSGETKMKVLKEIAKEHQV  195



>gb|KHG01623.1| Uncharacterized protein F383_21801 [Gossypium arboreum]
Length=324

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTCLSLAISRIKLLQNKRDLQLKNMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PI+E+Q++CP +L+EA++S+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPILESQKDCPPELREAVASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEFV AATELRP+ GVNR +IE LS+ AP+ +++LKVLKEIA+E+ +
Sbjct  124  QIKNLFATKYGKEFVIAATELRPDSGVNRAIIEKLSVSAPSGEIRLKVLKEIAQEYSV  181



>ref|XP_009624176.1| PREDICTED: IST1 homolog [Nicotiana tomentosiformis]
Length=323

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G + +KCKT L L I RIKLL+N+R+ QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGLQGSKCKTCLTLAISRIKLLQNKRDAQLKLMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PI+E+Q+ECP +L+EA++S+ FAAPRC+DLP+L 
Sbjct  64   HIIREQNVWAAYEILELFCEFVYARVPILESQKECPSELREAVASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             V+  F  KYGKEF+AAA+ELRP+  VNR ++E LS+ AP+ ++KL VLKEIA+E+ +
Sbjct  124  HVRNLFAAKYGKEFIAAASELRPDTSVNRTIVEKLSVSAPSAEIKLNVLKEIAKEYNV  181



>ref|XP_006468704.1| PREDICTED: IST1 homolog [Citrus sinensis]
Length=328

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I R+KLL+N+RE+QL+QMRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTSLTLGISRMKLLQNKRELQLQQMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA  ++ELFCE +  R+PI+E+Q+ECP +++EA++S+ FAAPRC+DLP+L 
Sbjct  64   HVIREQNICAAYAVLELFCEFLLARVPILESQKECPTEMREAVASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F+ KYGKEFV A +ELRP+ GVNR +IE LS+ AP+ + +LKVLKEIA+EH L
Sbjct  124  QIKNLFSAKYGKEFVLAVSELRPDSGVNRTIIEKLSVSAPSSEARLKVLKEIAQEHNL  181



>ref|XP_011022214.1| PREDICTED: IST1 homolog [Populus euphratica]
Length=314

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   +KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGSKCKTCLSLAISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE + VR+PI+E+Q+ECP +L+EAI+S+ FAAPRC+++P+L 
Sbjct  64   HVIREQNIRAAYEILELFCEFVLVRVPILESQKECPAELREAIASIIFAAPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEF  AA+ELRP+ GVNR +IE LS+RAP  + +LKVLKEIA+E  L
Sbjct  124  QIKNLFAAKYGKEFNMAASELRPDSGVNRAIIERLSVRAPPAEARLKVLKEIAQEFSL  181



>ref|XP_003629204.1| IST1-like protein [Medicago truncatula]
Length=434

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  GFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEK  408
            GF ++KCKT  K+ + RIKLLRN+RE+ ++QMR++IA LL++GQ+ATARIRVEH++RE+ 
Sbjct  25   GFNSSKCKTASKMAVARIKLLRNKREVVVRQMRRDIAMLLQSGQDATARIRVEHVMREQN  84

Query  409  MMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFT  588
            ++AA E IELFCELI  RL II  QRECP DLKE I+S+ FAAPRC+++PEL  ++  F 
Sbjct  85   VLAANEFIELFCELIVARLSIIAKQRECPADLKEGIASLIFAAPRCSEIPELVSLKKIFE  144

Query  589  GKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             KYG++FV+AAT+LRP CGVNRQLI+ LS+R P  +VKLKVLKEIA+E+++
Sbjct  145  KKYGRDFVSAATDLRPSCGVNRQLIDKLSVRTPPGEVKLKVLKEIAKEYQI  195



>ref|XP_010049566.1| PREDICTED: uncharacterized protein LOC104438178 isoform X1 [Eucalyptus 
grandis]
Length=1310

 Score =   224 bits (572),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 111/174 (64%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  220  FNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIR  399
             +K FK AKCKT LKL   R+KLLRN++E+Q+KQMR+++A+LLE+GQ+ TARIRVEH++R
Sbjct  2    LHKSFKPAKCKTALKLAASRLKLLRNKKEVQVKQMRRDLAQLLESGQDQTARIRVEHVVR  61

Query  400  EEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQL  579
            EEKMMAA E++ELFCELI+ RLPIIE+Q+ CP+DLKEA+SSV FA+PRC+D+PEL  ++ 
Sbjct  62   EEKMMAAYELVELFCELIAARLPIIESQKNCPIDLKEAVSSVVFASPRCSDVPELMDIRK  121

Query  580  AFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             FT KYGK+F+ AA ELRP+CGVNR L+E LS +AP    K+K+L  IAEEH +
Sbjct  122  HFTAKYGKDFITAAVELRPDCGVNRSLVEKLSAKAPDGPTKVKILTSIAEEHNI  175



>gb|AET03680.2| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=426

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  GFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEK  408
            GF ++KCKT  K+ + RIKLLRN+RE+ ++QMR++IA LL++GQ+ATARIRVEH++RE+ 
Sbjct  25   GFNSSKCKTASKMAVARIKLLRNKREVVVRQMRRDIAMLLQSGQDATARIRVEHVMREQN  84

Query  409  MMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFT  588
            ++AA E IELFCELI  RL II  QRECP DLKE I+S+ FAAPRC+++PEL  ++  F 
Sbjct  85   VLAANEFIELFCELIVARLSIIAKQRECPADLKEGIASLIFAAPRCSEIPELVSLKKIFE  144

Query  589  GKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             KYG++FV+AAT+LRP CGVNRQLI+ LS+R P  +VKLKVLKEIA+E+++
Sbjct  145  KKYGRDFVSAATDLRPSCGVNRQLIDKLSVRTPPGEVKLKVLKEIAKEYQI  195



>ref|XP_006379742.1| hypothetical protein POPTR_0008s12030g [Populus trichocarpa]
 gb|ABK94695.1| unknown [Populus trichocarpa]
 gb|ERP57539.1| hypothetical protein POPTR_0008s12030g [Populus trichocarpa]
Length=314

 Score =   211 bits (537),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   +KCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGVFGSKCKTCLNLAISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE + VR+PI+E+Q+ECP +L+EAI+S+ FAAPRC+++P+L 
Sbjct  64   HVIREQNIRAAYEILELFCEFVLVRVPILESQKECPAELREAIASIIFAAPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEF  AA+ELRP+ GVNR +IE LS+RAP  + +LKVLKEIA+E  L
Sbjct  124  QIKNLFAAKYGKEFNMAASELRPDSGVNRAIIERLSVRAPPAEARLKVLKEIAQEFSL  181



>ref|XP_003569587.1| PREDICTED: IST1-like protein [Brachypodium distachyon]
Length=317

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIRVEHIIRE+ ++AA EI+ELFCE 
Sbjct  26   ISRIKLLRNRREMQLINMRKEMVQYLQTGQESIARIRVEHIIREQNILAAYEIVELFCEF  85

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  R+PI+E Q+ECP++L+EAISS+ FA+ RC+DLPEL  ++  FT KYGKEFVAAA EL
Sbjct  86   VLARVPIVEVQKECPIELREAISSIIFASGRCSDLPELMHLRNLFTTKYGKEFVAAALEL  145

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+ GVNR +IE LS++AP+ + KLKVLK IA E+ L
Sbjct  146  RPDSGVNRTIIEKLSVKAPSAESKLKVLKAIAHEYNL  182



>ref|XP_003519849.1| PREDICTED: IST1-like protein-like [Glycine max]
 gb|KHN00433.1| IST1-like protein [Glycine soja]
Length=438

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  GFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEK  408
            GF ++KCKT  K+ + RIKLLRN+RE+ ++QMR++IA LL++GQ+ATARIRVEH++RE+ 
Sbjct  20   GFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATARIRVEHVMREQN  79

Query  409  MMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFT  588
            ++AA E IELFCEL+  RL II  Q+ECP DLKE I+S+ FAAPRC+++PEL  ++  F 
Sbjct  80   VLAANEFIELFCELVVARLAIISKQKECPADLKEGIASLIFAAPRCSEIPELVALKNIFE  139

Query  589  GKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             KYGK+FV+AA +LRP CGVNRQLIE LS+R P  +VKLKVLKEIA+EH +
Sbjct  140  KKYGKDFVSAAVDLRPSCGVNRQLIEKLSVRTPPGEVKLKVLKEIAKEHHI  190



>ref|XP_009804183.1| PREDICTED: IST1 homolog [Nicotiana sylvestris]
Length=320

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G + +KCKT L L I RIKLL+N+R+ QLK MRKEIA+ L+ GQEA ARIRVE
Sbjct  4    LNQLFNRGLQGSKCKTCLTLAISRIKLLQNKRDAQLKLMRKEIAQFLQAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PI+E+Q+ECP +L+EA++S+ FAAPRC+DLP+L 
Sbjct  64   HIIREQNVWAAYEILELFCEFVYARVPILESQKECPSELREAVASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             V+  F  KYGKEF+AAA+ELRP+  VNR ++E LS+ AP+ ++KL VLKEIA E+ +
Sbjct  124  HVRNLFAAKYGKEFIAAASELRPDTSVNRTIVEKLSVSAPSAEIKLNVLKEIAREYNV  181



>gb|KCW82256.1| hypothetical protein EUGRSUZ_C03673 [Eucalyptus grandis]
Length=1376

 Score =   224 bits (571),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 112/181 (62%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +1

Query  199  RNEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARI  378
            R +     +K FK AKCKT LKL   R+KLLRN++E+Q+KQMR+++A+LLE+GQ+ TARI
Sbjct  61   RADEKKMLHKSFKPAKCKTALKLAASRLKLLRNKKEVQVKQMRRDLAQLLESGQDQTARI  120

Query  379  RVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLP  558
            RVEH++REEKMMAA E++ELFCELI+ RLPIIE+Q+ CP+DLKEA+SSV FA+PRC+D+P
Sbjct  121  RVEHVVREEKMMAAYELVELFCELIAARLPIIESQKNCPIDLKEAVSSVVFASPRCSDVP  180

Query  559  ELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHE  738
            EL  ++  FT KYGK+F+ AA ELRP+CGVNR L+E LS +AP    K+K+L  IAEEH 
Sbjct  181  ELMDIRKHFTAKYGKDFITAAVELRPDCGVNRSLVEKLSAKAPDGPTKVKILTSIAEEHN  240

Query  739  L  741
            +
Sbjct  241  I  241



>ref|XP_002282696.1| PREDICTED: IST1-like protein [Vitis vinifera]
 emb|CBI27012.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R + LKQMRKEIA+ L+TGQEA ARIRVE
Sbjct  4    LNQLFNRGILGAKCKTCLNLAISRIKLLQNKRSLHLKQMRKEIAQFLQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PI+E QRECP +L+EA++S+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPILETQRECPTELREAVASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEF+ AA+ELRP+  VNR +IE LS+  P  + KLK LKEIA+E+ L
Sbjct  124  QIKNLFAAKYGKEFILAASELRPDTSVNRAIIEKLSVSTPTGEAKLKQLKEIAQEYNL  181



>ref|XP_004236982.1| PREDICTED: IST1 homolog [Solanum lycopersicum]
Length=323

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G + +KCKT L L I RIKLL+N+R+ QL+ MRKEIA+ L+TGQEA ARIRVE
Sbjct  4    LNQLFNRGLQGSKCKTCLTLAISRIKLLQNKRDAQLRLMRKEIAQFLQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            HIIRE+ + AA EI+ELFCE +  R+PI+E+Q+ECP +L+EA++S+ FAAPRC+DLP+L 
Sbjct  64   HIIREQNVWAAYEILELFCEFVFARVPILESQKECPSELREAVASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             V+  F  KYGKEF+AAA+ELRP+  VNR ++E LS+ AP+ ++KL VLKEIA+E+ +
Sbjct  124  HVRNLFAAKYGKEFIAAASELRPDTSVNRTIVEKLSVGAPSAELKLNVLKEIAKEYNV  181



>ref|XP_011076713.1| PREDICTED: IST1 homolog isoform X2 [Sesamum indicum]
Length=321

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R++ LK MRKEIA+ L+TGQEA ARIRVE
Sbjct  4    LNQLFNRGLLGAKCKTCLTLGISRIKLLQNKRDVHLKLMRKEIAEFLQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+      EI+ELFCE +  R+PI+E+QRECP +L+EA++S+ FAAPRC+DLP+L 
Sbjct  64   HVIREQNTWEVYEILELFCEFVLARVPILESQRECPTELQEAVASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             V+  F  KYGKEF+AAA+ELRP+  VNR +IE LS+ AP  DVKLKVLKEIA E+ +
Sbjct  124  HVRNLFAVKYGKEFIAAASELRPDTSVNRTIIEKLSVSAPPADVKLKVLKEIALEYNI  181



>tpg|DAA58064.1| TPA: hypothetical protein ZEAMMB73_112435 [Zea mays]
Length=311

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            I RIKLLRNRRE+QL  MRKE+ + L+TGQE+ ARIRVEHIIRE+ ++AA EI+ELFCE 
Sbjct  15   ISRIKLLRNRRELQLINMRKEMVQYLQTGQESIARIRVEHIIREQNILAAYEIVELFCEF  74

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  R+PI+E Q+ECPL+L+EAI+S+ FA+ RC+DLPEL  ++  FT KYGKEFVA A EL
Sbjct  75   VLARVPIVEVQKECPLELREAIASIIFASGRCSDLPELMHLRNLFTTKYGKEFVAGAMEL  134

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+  VNR +IE LS++AP+ D KLKVLK IA+E+ +
Sbjct  135  RPDSSVNRTIIEKLSVKAPSGDSKLKVLKAIAQEYNI  171



>emb|CDX69159.1| BnaC01g02940D [Brassica napus]
Length=440

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA EIIELFCELI  RL II  Q+ECP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNILAANEIIELFCELIVSRLTIITKQKECPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FV+AATELRP CGVNR LI+ LS+R P  + KLK++KEIA+E ++
Sbjct  140  KDIFEKKYGRDFVSAATELRPTCGVNRMLIDKLSVRHPGGEFKLKIMKEIAKEFQV  195



>gb|KJB43237.1| hypothetical protein B456_007G189800 [Gossypium raimondii]
Length=418

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFGNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            +RE+ ++AA E IELFCEL+  RL II+ +RECP DLKE I+S+ FAAPRCA++PEL ++
Sbjct  80   MREQNVLAANEFIELFCELVVARLSIIKKRRECPADLKEGIASLIFAAPRCAEIPELIEI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FVAAAT+LRP CGVNR LI+ LS++ P  + KLKV+KEIA++H +
Sbjct  140  RNIFEKKYGRDFVAAATDLRPNCGVNRLLIDKLSVKTPTGETKLKVMKEIAKDHNI  195



>ref|XP_010463126.1| PREDICTED: uncharacterized protein LOC104743778 [Camelina sativa]
Length=621

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 128/148 (86%), Gaps = 6/148 (4%)
 Frame = +1

Query  298  RREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELISVRLPIIE  477
            RREI+ + +   ++++   G E T    VEHIIREEKMMAAQEI+ELFCELI+VRLPIIE
Sbjct  64   RREIREEMLDSFVSRI--DGDEWT----VEHIIREEKMMAAQEILELFCELIAVRLPIIE  117

Query  478  AQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRPECGVNRQ  657
            AQRECPLDLKEAISS+CFAAPRC+DL ELQQVQ+ F  KYGKEFVAAA+EL+P+ GVNR+
Sbjct  118  AQRECPLDLKEAISSICFAAPRCSDLTELQQVQILFVSKYGKEFVAAASELKPDSGVNRK  177

Query  658  LIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            L+ELLS+RAP+P+ KLK+LKEIAEEHEL
Sbjct  178  LVELLSVRAPSPETKLKLLKEIAEEHEL  205



>ref|XP_003530191.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 ref|XP_006583570.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
Length=1053

 Score =   221 bits (563),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 97/157 (62%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL+N+RE Q+KQ+++E+A+LLE+GQ+ TARIRVEH++REEK MAA +++E++CEL
Sbjct  19   VSRIKLLKNKREAQIKQLKRELAQLLESGQDRTARIRVEHVVREEKTMAAYDLVEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLP+IE+Q+ CP+DLKEA+SSV FA+PRC+D+PEL  V+   T KYGKEFV+AA EL
Sbjct  79   IAARLPMIESQKNCPIDLKEAVSSVIFASPRCSDIPELVDVKKQITSKYGKEFVSAAIEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR L+E LS +AP    K+K+L  IAEEH +
Sbjct  139  RPDCGVNRMLVEKLSAKAPDGPTKIKILAAIAEEHNI  175



>gb|KHG16212.1| IST1-like protein [Gossypium arboreum]
Length=419

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFGNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            +RE+ ++AA E IELFCEL+  RL II+ +RECP DLKE I+S+ FAAPRCA++PEL ++
Sbjct  80   MREQNVLAANEFIELFCELVVARLSIIKKRRECPADLKEGIASLIFAAPRCAEIPELIEI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FVAAAT+LRP CGVNR LI+ LS++ P  + KLKV+KEIA++H +
Sbjct  140  RNIFEKKYGRDFVAAATDLRPNCGVNRLLIDKLSVKTPTGEAKLKVMKEIAKDHNI  195



>ref|XP_010113265.1| hypothetical protein L484_026594 [Morus notabilis]
 gb|EXC35272.1| hypothetical protein L484_026594 [Morus notabilis]
Length=451

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF + KCKT  K+ + RIKLLRN+RE+ +KQMR++IA LL++GQ++TARIRVEH+
Sbjct  20   SLFRRGFNSPKCKTAAKMAVARIKLLRNKREVVVKQMRRDIALLLQSGQDSTARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCELI  RL II  +RECP DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNVLAANEFIELFCELIVSRLSIIAKRRECPADLKEGIASLIFAAPRCSEIPELVAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E+++
Sbjct  140  RDVFEKKYGKDFVSAATDLRPNCGVNRMLIDKLSVRTPTGEFKLKIMKEIAKEYQV  195



>ref|XP_012082098.1| PREDICTED: IST1 homolog [Jatropha curcas]
 gb|KDP29414.1| hypothetical protein JCGZ_18335 [Jatropha curcas]
Length=328

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L+I RIKLL+N+R++QLK MRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTCLTLSISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEGIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PI+E+Q+ECP +L+EA++S+ FAAPRC+++P+L 
Sbjct  64   HVIREQNLWAAYEILELFCEFVLARVPILESQKECPAELREAVASIIFAAPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q+Q   + KYGKEFV AA+ELRP+  VNR +IE LSI AP+ + ++KVLKEIA+E+ L
Sbjct  124  QIQNLLSAKYGKEFVMAASELRPDSSVNRAIIEKLSISAPSAEARIKVLKEIAQEYSL  181



>ref|XP_010526826.1| PREDICTED: uncharacterized protein LOC104804285 [Tarenaya hassleriana]
Length=473

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF  +KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNPSKCKTAAKMAMARIKLLRNKRQVVVKQMRRDIAMLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA EIIELFCELI  RL II  QRECP DLKE I+SV FAAPRC+++PEL  +
Sbjct  80   IREQNILAANEIIELFCELIVTRLTIITKQRECPADLKEGIASVIFAAPRCSEIPELADL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FV+AAT+LRP CGVNR L++ LS+R  + + KLK++KEIA+E ++
Sbjct  140  RDTFEKKYGRDFVSAATDLRPSCGVNRMLVDKLSVRNSSGEFKLKIMKEIAKEFQV  195



>ref|XP_004134834.1| PREDICTED: IST1-like protein [Cucumis sativus]
 gb|KGN48972.1| hypothetical protein Csa_6G507450 [Cucumis sativus]
Length=423

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  GFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEK  408
            GF ++KCKT  K+ + RIKLLRN+RE  +KQMR++IA LL++GQ+ATARIRVEH+IRE+ 
Sbjct  25   GFNSSKCKTAAKMAVARIKLLRNKREAVVKQMRRDIALLLQSGQDATARIRVEHVIREQN  84

Query  409  MMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFT  588
            ++AA EIIELFCEL+  RL II  QR+CP DLKE ++S+ FAAPRC+++PEL  ++  F 
Sbjct  85   VLAANEIIELFCELVVARLSIIAKQRQCPADLKEGVASLIFAAPRCSEIPELSALRNVFE  144

Query  589  GKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             KYGK+FV+AA +LRP CGVNR LI+ LS+R P  +VKLK++KEIA+EH++
Sbjct  145  KKYGKDFVSAAVDLRPNCGVNRLLIDKLSVRTPTGEVKLKIMKEIAKEHKI  195



>gb|KJB31432.1| hypothetical protein B456_005G191700 [Gossypium raimondii]
Length=324

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R++QLK MRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTCLSLAISRIKLLQNKRDLQLKNMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA EI+ELFCE +  R+PI+E+Q++CP +L+EA++S+ FAAPRC+D+P+L 
Sbjct  64   HVIREQNIWAAYEILELFCEFVLARVPILESQKDCPPELREAVASIIFAAPRCSDVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEFV AA ELRP+ GVNR +IE LS+ AP+ +++LKVLKEIA+E+ +
Sbjct  124  QIKNLFATKYGKEFVIAAMELRPDSGVNRAIIEKLSVSAPSGEIRLKVLKEIAQEYSV  181



>ref|XP_006283590.1| hypothetical protein CARUB_v10004646mg, partial [Capsella rubella]
 gb|EOA16488.1| hypothetical protein CARUB_v10004646mg, partial [Capsella rubella]
Length=498

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  51   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATARIRVEHV  110

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ + AA EIIELFCELI  RL II  Q++CP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  111  IREQNIQAANEIIELFCELIVARLTIITKQKQCPVDLKEGIASLIFAAPRCSEIPELGDL  170

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E ++
Sbjct  171  RDIFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRNPGGEYKLKIMKEIAKEFQV  226



>ref|XP_009150864.1| PREDICTED: uncharacterized protein LOC103874176 [Brassica rapa]
 emb|CDX75521.1| BnaA01g01810D [Brassica napus]
Length=433

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA EIIELFCELI  RL II  Q+ECP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNILAANEIIELFCELIVSRLTIITKQKECPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FV AATELRP CGVNR LI+ LS+R P  + KLK++KEIA+E ++
Sbjct  140  KDIFEKKYGRDFVTAATELRPTCGVNRMLIDKLSVRHPGGEFKLKIMKEIAKEFQV  195



>ref|XP_006412068.1| hypothetical protein EUTSA_v10025095mg [Eutrema salsugineum]
 gb|ESQ53521.1| hypothetical protein EUTSA_v10025095mg [Eutrema salsugineum]
Length=474

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  39   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATARIRVEHV  98

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA EIIELFCELI  RL II  Q+ECP+DLKE ISS+ FAAPRC+++PEL  +
Sbjct  99   IREQNILAANEIIELFCELIVSRLTIITKQKECPVDLKEGISSLIFAAPRCSEIPELGDL  158

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FV AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E ++
Sbjct  159  KDIFEKKYGRDFVTAATDLRPTCGVNRMLIDKLSVRQPVGEFKLKIMKEIAKEFQV  214



>ref|XP_010432238.1| PREDICTED: uncharacterized protein LOC104716552 [Camelina sativa]
Length=466

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ + AA E+IELFCELI  RL II  Q++CP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNIQAANELIELFCELIVSRLTIITKQKQCPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E ++
Sbjct  140  RDIFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRNPGGEYKLKIMKEIAKEFQV  195



>ref|XP_006352060.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum]
Length=1085

 Score =   220 bits (561),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 95/153 (62%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLL+N++E+Q+KQM++E+A+LL++GQ+ TARIRVEH++REEKMMAA ++IE++CELI 
Sbjct  33   RLKLLKNKKEVQVKQMKRELAQLLDSGQDRTARIRVEHVVREEKMMAAYDLIEIYCELIV  92

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEAI+SV FA+PRC D+PEL  V+   T KYGKEF++AA ELRP
Sbjct  93   ARLPIIESQKNCPIDLKEAITSVVFASPRCGDIPELVDVRKHLTAKYGKEFISAAVELRP  152

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
             CGV+R L+E LS +AP    K+++L  IAEEH
Sbjct  153  NCGVSRMLVEKLSTKAPDGQTKMRILGAIAEEH  185



>ref|XP_008440890.1| PREDICTED: IST1-like protein [Cucumis melo]
 ref|XP_008440891.1| PREDICTED: IST1-like protein [Cucumis melo]
 ref|XP_008440892.1| PREDICTED: IST1-like protein [Cucumis melo]
Length=421

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  GFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEK  408
            GF ++KCKT  K+ + RIKLLRN+RE  +KQMR++IA LL++GQ+ATARIRVEH+IRE+ 
Sbjct  25   GFNSSKCKTAAKMAVARIKLLRNKREAVVKQMRRDIALLLQSGQDATARIRVEHVIREQN  84

Query  409  MMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFT  588
            ++AA E+IELFCEL+  RL II  QR+CP DLKE ++S+ FAAPRC+++PEL  ++  F 
Sbjct  85   VLAANEVIELFCELVVARLSIIAKQRQCPADLKEGVASLIFAAPRCSEIPELSALRNVFE  144

Query  589  GKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             KYGK+FV+AA +LRP CGVNR LI+ LS+R P  +VKLK++KEIA+EH++
Sbjct  145  KKYGKDFVSAAVDLRPNCGVNRLLIDKLSVRTPTGEVKLKIMKEIAKEHKI  195



>gb|KDO76986.1| hypothetical protein CISIN_1g020278mg [Citrus sinensis]
Length=328

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I R+KLL+N+RE+QL+QMRKEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGVFGAKCKTSLTLGISRMKLLQNKRELQLQQMRKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ + AA  ++ELFCE +  R+PI+E+Q+ECP +++EA++S+ FAAPRC+DLP+L 
Sbjct  64   HVIREQNICAAYAVLELFCEFLLARVPILESQKECPTEMREAVASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F+ KYGKEFV A +ELRP+  VNR +IE LS+ AP+ + +LKVLKEIA+EH L
Sbjct  124  QIKNLFSAKYGKEFVLAVSELRPDSSVNRTIIEKLSVSAPSSEARLKVLKEIAQEHNL  181



>ref|XP_010446886.1| PREDICTED: uncharacterized protein LOC104729623 [Camelina sativa]
Length=463

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ + AA E+IELFCELI  RL II  Q++CP+DLKE ++S+ FAAPRC+++PEL  +
Sbjct  80   IREQNIQAANELIELFCELIVSRLTIITKQKQCPVDLKEGVASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E ++
Sbjct  140  RDIFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRNPGGEYKLKIMKEIAKEFQV  195



>ref|XP_010437435.1| PREDICTED: uncharacterized protein LOC104721204 [Camelina sativa]
Length=466

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ + AA E+IELFCELI  RL II  Q++CP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNIQAANELIELFCELIVSRLTIITKQKQCPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E ++
Sbjct  140  RDIFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRNPGGEYKLKIMKEIAKEFQV  195



>ref|XP_004509413.1| PREDICTED: IST1-like protein-like [Cicer arietinum]
Length=430

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S    GF ++KCKT  K+ + RIKLLRN+RE+ ++QMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLLGLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            +RE+ ++AA E IELF EL+  RL II  QRECP DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   MREQNVLAANEFIELFSELVVARLSIIAKQRECPADLKEGIASLIFAAPRCSEIPELVAL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP CGVNRQLI+ LS+R P  +VKLKVLKEIA+E+++
Sbjct  140  KKIFEKKYGKDFVSAATDLRPSCGVNRQLIDKLSVRTPPGEVKLKVLKEIAKEYQI  195



>gb|KJB43236.1| hypothetical protein B456_007G189800 [Gossypium raimondii]
Length=447

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  48   SLFGNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  107

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            +RE+ ++AA E IELFCEL+  RL II+ +RECP DLKE I+S+ FAAPRCA++PEL ++
Sbjct  108  MREQNVLAANEFIELFCELVVARLSIIKKRRECPADLKEGIASLIFAAPRCAEIPELIEI  167

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FVAAAT+LRP CGVNR LI+ LS++ P  + KLKV+KEIA++H +
Sbjct  168  RNIFEKKYGRDFVAAATDLRPNCGVNRLLIDKLSVKTPTGETKLKVMKEIAKDHNI  223



>ref|XP_007012909.1| Regulator of Vps4 activity in the MVB pathway-like protein isoform 
1 [Theobroma cacao]
 gb|EOY30528.1| Regulator of Vps4 activity in the MVB pathway-like protein isoform 
1 [Theobroma cacao]
Length=1110

 Score =   220 bits (560),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 98/157 (62%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            IPRIKL++N+RE Q+KQ+++E+A+LLE+GQ+ TARIRVEH++REEK +AA  ++E++CEL
Sbjct  19   IPRIKLMKNKREAQVKQLKRELAQLLESGQDQTARIRVEHVVREEKTVAAYNLLEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I  R+PIIEAQ+ CP+DLKEAISSV FA+ RC D+PEL+ V   FT KYGKEF +AA EL
Sbjct  79   IVARMPIIEAQKNCPIDLKEAISSVIFASARCEDVPELKDVSKHFTAKYGKEFTSAALEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP CGV R L+E LS++AP    KLK+L  IAEEH +
Sbjct  139  RPNCGVGRMLVEKLSVKAPDGPTKLKILTAIAEEHNI  175



>gb|EPS63330.1| hypothetical protein M569_11456, partial [Genlisea aurea]
Length=200

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S  ++ F  AKCKT LKL   R+KL RN++EIQ+KQM++EIA LLE+GQ+ TA IRVEH+
Sbjct  15   SMLSRSFNPAKCKTALKLATSRLKLSRNKKEIQVKQMKREIAALLESGQDRTAMIRVEHV  74

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IREEKM+AA E++E++CELI  RLPIIE+Q+ CP+DLKEAI+SV FA+PRC D+PEL   
Sbjct  75   IREEKMVAAYELLEIYCELIVARLPIIESQKTCPVDLKEAIASVVFASPRCGDVPELVDA  134

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  FT KYGK+F +AA ELRP+CGV+R L+E LS  +P    K K+L  IA+EH +
Sbjct  135  KKQFTAKYGKDFASAANELRPQCGVSRLLVEKLSAVSPDGQTKTKILTMIAKEHNV  190



>gb|AES77090.2| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=1037

 Score =   219 bits (558),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 106/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +1

Query  220  FNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIR  399
             ++ FK AKCKT LKL + RIKLLRN+R+ Q+  +++E+AKLLE GQ+ TARIRVEH++R
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLRNKRQTQINLLKRELAKLLENGQDQTARIRVEHVVR  61

Query  400  EEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQL  579
            EEK MAA E++E++CELI+ RLP+IEAQ+ CP+DLKEAI++V FA PRC+D+PEL  V+ 
Sbjct  62   EEKTMAAYELVEIYCELIAARLPMIEAQKNCPIDLKEAIATVIFATPRCSDIPELADVKK  121

Query  580  AFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
              T KYGKEF +AA ELRP+CGVNR L+E LS +AP    K+K+L  IAEEH +
Sbjct  122  HMTSKYGKEFTSAALELRPDCGVNRLLVEKLSAKAPDGPTKIKILTAIAEEHNI  175



>ref|XP_004287747.1| PREDICTED: uncharacterized protein LOC101305976 [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL+ G++ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIASLLQKGEDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +++A E IELFCELI  RL II  QRECP DLKE I+S+ FA PRC+++PEL  +
Sbjct  80   IREQNVLSANEFIELFCELIVSRLQIIAKQRECPADLKEGIASLIFATPRCSEIPELVAL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FVAAAT+LRP+CGVNR LI+ LS+R P  +VKLK++KEIA+E+++
Sbjct  140  RNVFEKKYGRDFVAAATDLRPDCGVNRILIDKLSVRTPTGEVKLKIMKEIAKEYQV  195



>ref|XP_004243148.1| PREDICTED: uncharacterized protein LOC101265657 [Solanum lycopersicum]
Length=1085

 Score =   219 bits (558),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 94/153 (61%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLL+N++E+Q+KQM++E+++LL++GQ+ TARIRVEH++REEKMMAA ++IE++CELI 
Sbjct  33   RLKLLKNKKEVQVKQMKRELSQLLDSGQDRTARIRVEHVLREEKMMAAYDLIEIYCELIV  92

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEAI+SV FA+PRC D+PEL  V+   T KYGKEF++AA ELRP
Sbjct  93   ARLPIIESQKNCPIDLKEAITSVVFASPRCGDIPELVDVRKHLTAKYGKEFISAAVELRP  152

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
             CGV+R L+E LS +AP    K+++L  IAEEH
Sbjct  153  NCGVSRMLVEKLSAKAPDGQTKMRILGAIAEEH  185



>gb|EYU40759.1| hypothetical protein MIMGU_mgv1a010655mg [Erythranthe guttata]
Length=306

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I RIKLL+N+R++Q K MRKEIA  L  GQEA ARIRVE
Sbjct  4    LNQLFNRGLLGPKCKTCLTLAISRIKLLQNKRDLQTKLMRKEIADFLLAGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+    A EI+ELFCE +  R+PI+E+QRECP +L+EA++S+ F+APRC+DLP+L 
Sbjct  64   HVIREQNTWEAYEILELFCEFVLARVPILESQRECPTELREAVASIIFSAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             V+  F  KYGKEF+AAA+ELRP+  VNR +IE LS+ AP  DVK+KVLKEIA E+ +
Sbjct  124  HVRNLFAAKYGKEFIAAASELRPDARVNRTIIEKLSVSAPPTDVKIKVLKEIAREYNI  181



>gb|ERM96392.1| hypothetical protein AMTR_s00001p00238960 [Amborella trichopoda]
Length=1002

 Score =   218 bits (556),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 100/157 (64%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLLRN+++IQ+KQMR+++A L+E+GQEA+ARIRVEH+IRE+ + AA +IIELFCEL
Sbjct  556  MSRIKLLRNKKDIQIKQMRRDVAMLIESGQEASARIRVEHVIREQNIAAANDIIELFCEL  615

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  RL IIE++R CP+DLKE ISS+ FAAPRCAD+PEL Q++  F  KYG EF+AAATEL
Sbjct  616  VVARLSIIESKRGCPVDLKEGISSLIFAAPRCADIPELLQIRNIFQKKYGHEFIAAATEL  675

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR LIE LS R  + + KL+V+KEIA+E+ +
Sbjct  676  RPDCGVNRTLIEKLSTRTASGEAKLRVMKEIAKEYHV  712



>ref|XP_002521677.1| protein with unknown function [Ricinus communis]
 gb|EEF40664.1| protein with unknown function [Ricinus communis]
Length=463

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F+  F +++CKT  K+ + RIKLLRN+RE+ ++QM+++IA LLE+GQ+ATAR+RVEH+
Sbjct  20   SIFSPRFSSSRCKTAAKMAVARIKLLRNKREVVVRQMKRDIALLLESGQDATARVRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCEL+  RL II  QRECP DLKE I+S+ FAAPRCA++PEL  +
Sbjct  80   IREQNVLAANEFIELFCELVVARLTIIAKQRECPADLKEGIASLIFAAPRCAEIPELGAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
               F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  +VKLK++KEIA+E+++
Sbjct  140  VKIFEKKYGKDFVSAATDLRPNCGVNRILIDKLSVRTPTGEVKLKIMKEIAKEYQI  195



>ref|XP_007152932.1| hypothetical protein PHAVU_004G172500g [Phaseolus vulgaris]
 gb|ESW24926.1| hypothetical protein PHAVU_004G172500g [Phaseolus vulgaris]
Length=1052

 Score =   218 bits (556),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 94/157 (60%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + R+KLLRN+RE Q++Q+++E+A+LLE+GQ+ TARIRVEH++REEK M A +++E++CEL
Sbjct  19   VSRVKLLRNKREAQVRQLKRELAQLLESGQDRTARIRVEHVVREEKTMTAYDLVEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLP+IE+Q+ CP+DLKEA+SSV FA+PRC+D+PEL  V+   T KYGKEFV+AA EL
Sbjct  79   IAARLPMIESQKNCPIDLKEAVSSVIFASPRCSDVPELVDVKKQLTSKYGKEFVSAAVEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGV+R L+E LS +AP    K+K+L  IAEEH +
Sbjct  139  RPDCGVSRMLVEKLSAKAPDGPTKIKILAAIAEEHNI  175



>ref|XP_002869065.1| hypothetical protein ARALYDRAFT_491075 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45324.1| hypothetical protein ARALYDRAFT_491075 [Arabidopsis lyrata subsp. 
lyrata]
Length=465

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R + +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRLVVVKQMRRDIAVLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ + AA EIIELFCELI  RL II  Q++CP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNIQAANEIIELFCELIVARLTIITKQKQCPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEE  732
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E
Sbjct  140  RDIFEKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRNPGGECKLKIMKEIAKE  192



>gb|KHN17067.1| IST1 like [Glycine soja]
Length=348

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  322  MRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLD  501
            MR+++AKLLE GQEA A ++VEH++REE +MAAQ+II+LFCELI+ R+  +++QR+CPLD
Sbjct  1    MRRDVAKLLEAGQEAKASLKVEHVMREENIMAAQDIIQLFCELIAARIAFVQSQRKCPLD  60

Query  502  LKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIR  681
            LKEAISSVCFAAPRCADLPEL QVQ  F  KYGK+FV+AAT+L P+C VN QLIELLS++
Sbjct  61   LKEAISSVCFAAPRCADLPELLQVQSLFASKYGKDFVSAATDLTPDCSVNGQLIELLSVQ  120

Query  682  APAPDVKLKVLKEIAEEHEL  741
            AP+ + KLK+LKEIA EH+L
Sbjct  121  APSQEKKLKLLKEIAVEHKL  140



>ref|XP_009593841.1| PREDICTED: IST1 homolog [Nicotiana tomentosiformis]
Length=491

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F + F ++KCKT+ K+ + RIKLLRN+RE+ ++QMR++IA LLE+ Q+ATARIRVEH+
Sbjct  20   SLFCRTFNSSKCKTMAKMAVARIKLLRNKREVVVRQMRRDIAMLLESRQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++ A E +ELFCELI  RLPII  Q+ECP DLKE ISS+ FAAPRC+D+PEL ++
Sbjct  80   IREQNILQANEFLELFCELIVARLPIIAKQKECPADLKEGISSLIFAAPRCSDIPELMRI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS++ P+ +VKLK++KEIA+E+++
Sbjct  140  KDVFEKKYGKDFVSAATDLRPNAGVNRTLIEKLSVKTPSGEVKLKIMKEIAKEYQV  195



>gb|KFK30216.1| hypothetical protein AALP_AA7G232900 [Arabis alpina]
Length=461

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ + AA EIIELFCELI  RL II  Q+ECP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNIQAANEIIELFCELIVSRLTIITKQKECPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEE  732
            +  F  KYGK+FV+AAT+LRP CGVN  L++ LS+R P  + KLK LKEIA+E
Sbjct  140  RDIFVKKYGKDFVSAATDLRPTCGVNLMLVDKLSVRHPGGEFKLKFLKEIAKE  192



>ref|XP_011077936.1| PREDICTED: uncharacterized protein LOC105161819 isoform X2 [Sesamum 
indicum]
Length=1075

 Score =   218 bits (554),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 100/155 (65%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLLRN++E+Q+KQM++EIA+LLE+GQ+ TARIRVEH+IREEKMMAA ++IE++CELI 
Sbjct  33   RLKLLRNKKEVQVKQMKREIAQLLESGQDQTARIRVEHVIREEKMMAAYDLIEIYCELIV  92

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEAI+S+ FA+PRC D+PEL  V+  FT KYGK+F  AA ELRP
Sbjct  93   ARLPIIESQKTCPIDLKEAIASIVFASPRCGDVPELLDVRKHFTEKYGKDFTTAAIELRP  152

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            ECGV+R L+E LS +AP    K+K+L  IAEEH +
Sbjct  153  ECGVSRMLVEKLSAKAPDGQTKIKILSAIAEEHNV  187



>ref|XP_011077935.1| PREDICTED: uncharacterized protein LOC105161819 isoform X1 [Sesamum 
indicum]
Length=1077

 Score =   218 bits (554),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 100/155 (65%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLLRN++E+Q+KQM++EIA+LLE+GQ+ TARIRVEH+IREEKMMAA ++IE++CELI 
Sbjct  33   RLKLLRNKKEVQVKQMKREIAQLLESGQDQTARIRVEHVIREEKMMAAYDLIEIYCELIV  92

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEAI+S+ FA+PRC D+PEL  V+  FT KYGK+F  AA ELRP
Sbjct  93   ARLPIIESQKTCPIDLKEAIASIVFASPRCGDVPELLDVRKHFTEKYGKDFTTAAIELRP  152

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            ECGV+R L+E LS +AP    K+K+L  IAEEH +
Sbjct  153  ECGVSRMLVEKLSAKAPDGQTKIKILSAIAEEHNV  187



>ref|XP_009777469.1| PREDICTED: uncharacterized protein LOC104227040 [Nicotiana sylvestris]
Length=501

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F + F +++CKT+ K+ + RIKLLRN+RE+ ++QMR++IA LLE+ Q+ATARIRVEH+
Sbjct  20   SLFCRTFNSSRCKTMAKMAVARIKLLRNKREVVVRQMRRDIAMLLESRQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++ A E +ELFCELI  RLPII  Q+ECP DLKE ISS+ FAAPRC+D+PEL ++
Sbjct  80   IREQNILQANEFLELFCELIVARLPIIAKQKECPADLKEGISSLIFAAPRCSDIPELMRI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS++ P+ +VKLK++KEIA+E+++
Sbjct  140  KDVFEKKYGKDFVSAATDLRPNAGVNRALIEKLSVKTPSGEVKLKIMKEIAKEYQV  195



>ref|NP_195298.2| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AEE86554.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=466

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F +GF ++KCKT  K+ + RIKL+RN+R + +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLIRNKRLVVVKQMRRDIAVLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ + AA EIIELFCELI  RL II  Q++CP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNIQAANEIIELFCELIVSRLTIITKQKQCPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEE  732
            +  F  KYGK+FV+AAT+LRP CGVNR LI+ LS+R P  + KLK++KEIA+E
Sbjct  140  RDIFAKKYGKDFVSAATDLRPSCGVNRMLIDKLSVRNPGGEYKLKIMKEIAKE  192



>ref|XP_010683018.1| PREDICTED: IST1-like protein [Beta vulgaris subsp. vulgaris]
Length=429

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  205  EMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRV  384
            ++ S F + F ++KCKT  ++TI RIKLLRN+RE  ++QMR+++A LL++GQ+ATARIRV
Sbjct  16   KLGSIFRRDFNSSKCKTWARMTIARIKLLRNKRETVVRQMRRDVALLLQSGQDATARIRV  75

Query  385  EHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPEL  564
            EH+IRE+ +MAA EI+ELFCE I  RL II  QR CP DLKEAISS+ FA PRC+D+PEL
Sbjct  76   EHVIREQNIMAANEILELFCERIVTRLSIISKQRTCPNDLKEAISSLIFAGPRCSDIPEL  135

Query  565  QQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
              ++  F  KYGKEFV+AATELRP+ GVNR LIE LS   P  +VKLKV+KEIA+E+++
Sbjct  136  LAIRDIFQKKYGKEFVSAATELRPDSGVNRLLIEKLSALNPKGEVKLKVMKEIAKEYQV  194



>emb|CDP00628.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L LTI RIKLL+N+R+ QLK MRKEIA+ L+ GQE+ ARIRVE
Sbjct  4    LNQLFNRGLLGQKCKTCLTLTISRIKLLQNKRDGQLKIMRKEIAQFLQAGQESIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE  +  A EI+E+FCE +  R+PI+E+QRECP +L+EA++S+ FAAPRC+DLP+L 
Sbjct  64   HVIRERNIWDAYEILEMFCEFVLARVPILESQRECPSELREAVASIIFAAPRCSDLPDLV  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             V+  F  KYGKEF+AAA+ELRP+  VNR +IE LS+ AP+ +VK+ +LKEIA E+ +
Sbjct  124  HVRNLFAAKYGKEFIAAASELRPDTSVNRTIIEKLSVSAPSAEVKMNILKEIAREYNV  181



>ref|XP_008812038.1| PREDICTED: IST1-like protein [Phoenix dactylifera]
Length=551

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++K KT  KL   RIKLLRN+RE+Q++QMR+++A LLE+ QE TARIRVEH+
Sbjct  107  SMFRCGFNSSKLKTESKLATARIKLLRNKREVQVRQMRRDMAMLLESRQEDTARIRVEHV  166

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA EII LFCELI VRLPII  QR+CP DLKE+ISS+ +AAPRC+++PEL ++
Sbjct  167  IREQNVMAANEIIGLFCELIVVRLPIIAKQRDCPADLKESISSMIYAAPRCSEIPELSRI  226

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AA +LRP  GVN  LIE LS+R P  +VKLKV++EIA+E+E+
Sbjct  227  RDIFEKKYGKDFVSAAADLRPNSGVNHMLIEKLSVRKPPGEVKLKVMREIAKEYEI  282



>ref|XP_010090010.1| hypothetical protein L484_027240 [Morus notabilis]
 gb|EXB38807.1| hypothetical protein L484_027240 [Morus notabilis]
Length=1100

 Score =   217 bits (553),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 100/157 (64%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL N+RE+Q++QM++E+A+LLE+GQ  TARIRVEH+IREEK M A  +IE++CEL
Sbjct  19   VSRIKLLNNKREVQVRQMKRELAQLLESGQVQTARIRVEHVIREEKTMTAYNLIEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLPIIE+Q+ CP+DLKEAISSV FA+PRCAD+PEL  ++   T KYGKEFV  A EL
Sbjct  79   IAARLPIIESQKNCPIDLKEAISSVIFASPRCADVPELMDIRKYLTAKYGKEFVTTAIEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR L+E LS +AP    KLK+L  IAEEH +
Sbjct  139  RPDCGVNRMLVEKLSAKAPDGQTKLKILTAIAEEHNV  175



>ref|XP_010924918.1| PREDICTED: uncharacterized protein LOC105047619 [Elaeis guineensis]
Length=1089

 Score =   217 bits (552),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 107/179 (60%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  199  RNEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARI  378
            ++++     + FKAAKCKT LKL + RIKLL+N+RE+ LKQMR+++A+LLE+GQE TARI
Sbjct  4    KSKISDMLPRSFKAAKCKTSLKLAVARIKLLKNKREVSLKQMRRDLAQLLESGQEQTARI  63

Query  379  RVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLP  558
            RVEH+IREEK+M+A ++IE++CELI  RLPIIE+Q+ CP+DLKEAI+S+ FA+ RCAD+P
Sbjct  64   RVEHVIREEKIMSAYDLIEIYCELIVARLPIIESQKSCPIDLKEAIASIVFASLRCADIP  123

Query  559  ELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
            EL +++  F  KYGKEF+ AA E+RPECGV+R ++E LS RAP  + K+K L  IA+EH
Sbjct  124  ELMEIRKHFLAKYGKEFITAALEVRPECGVSRMVVEKLSARAPDVETKIKTLTAIAQEH  182



>ref|XP_008806530.1| PREDICTED: uncharacterized protein LOC103719187 isoform X1 [Phoenix 
dactylifera]
Length=1073

 Score =   217 bits (552),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 108/179 (60%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  199  RNEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARI  378
            ++++     +GFKA KCKT LKL + RIKLL+NRRE+ LKQMR+++A+LLE+GQE TARI
Sbjct  4    KSKISEMLPRGFKAGKCKTSLKLAVARIKLLKNRREVLLKQMRRDLAQLLESGQEQTARI  63

Query  379  RVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLP  558
            RVEH+IREEK M+A ++IE++CELI  RLPIIE+Q+ CP+DLKEAI+S+ FA+PRCAD+P
Sbjct  64   RVEHVIREEKTMSAYDLIEIYCELILARLPIIESQKRCPIDLKEAIASIVFASPRCADIP  123

Query  559  ELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
            EL +++  F  KYGKEF+ AA E++PECGV+R ++E LS RAP  + K+K L  IA+EH
Sbjct  124  ELMEIRKHFLAKYGKEFITAALEVQPECGVSRMVVEKLSARAPDVETKIKTLTAIAQEH  182



>ref|XP_008806538.1| PREDICTED: uncharacterized protein LOC103719187 isoform X2 [Phoenix 
dactylifera]
Length=1044

 Score =   216 bits (551),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 108/179 (60%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +1

Query  199  RNEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARI  378
            ++++     +GFKA KCKT LKL + RIKLL+NRRE+ LKQMR+++A+LLE+GQE TARI
Sbjct  4    KSKISEMLPRGFKAGKCKTSLKLAVARIKLLKNRREVLLKQMRRDLAQLLESGQEQTARI  63

Query  379  RVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLP  558
            RVEH+IREEK M+A ++IE++CELI  RLPIIE+Q+ CP+DLKEAI+S+ FA+PRCAD+P
Sbjct  64   RVEHVIREEKTMSAYDLIEIYCELILARLPIIESQKRCPIDLKEAIASIVFASPRCADIP  123

Query  559  ELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
            EL +++  F  KYGKEF+ AA E++PECGV+R ++E LS RAP  + K+K L  IA+EH
Sbjct  124  ELMEIRKHFLAKYGKEFITAALEVQPECGVSRMVVEKLSARAPDVETKIKTLTAIAQEH  182



>ref|XP_010681608.1| PREDICTED: IST1 homolog isoform X1 [Beta vulgaris subsp. vulgaris]
Length=330

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G    KCKT L L I RIKLL+NRR+  LKQM KEIA+ L+TGQEA ARIRVE
Sbjct  4    LNQLFNRGVLGTKCKTCLTLAISRIKLLQNRRDALLKQMHKEIAQFLQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H+IRE+ +  A EI+E+FCE +  R+PI+E+QR+CP +L+EAI+S+ FAAPRC+DLP+L 
Sbjct  64   HVIREQNIWEAYEILEMFCEFVLARVPILESQRQCPSELQEAIASIIFAAPRCSDLPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            QV+  FT KYGKEF++A +ELRP+  VNR +IE LS+ AP   ++LK+LKEIA+E+ +
Sbjct  124  QVKNLFTAKYGKEFISAVSELRPDTSVNRTIIEKLSLIAPPVQLRLKLLKEIAKEYNV  181



>ref|XP_009401974.1| PREDICTED: uncharacterized protein LOC103985842 [Musa acuminata 
subsp. malaccensis]
Length=1122

 Score =   217 bits (552),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 105/181 (58%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +1

Query  199  RNEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARI  378
            ++++     + FK  KCKT LKL + R+KLL+N+RE  ++QMR+++A+LLE+GQE TARI
Sbjct  4    KSKISELLPRSFKPVKCKTSLKLAVSRMKLLKNKREASVRQMRRDLAQLLESGQEQTARI  63

Query  379  RVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLP  558
            RVEH+IREEK MAA ++I+++CELI  RLPIIE+Q+ CP+DLKEAISSV FA+PRCAD+P
Sbjct  64   RVEHVIREEKTMAAYDLIQIYCELIESRLPIIESQKNCPIDLKEAISSVIFASPRCADIP  123

Query  559  ELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHE  738
            EL  ++  F  KYGK+FV AA E+RPECGV+R ++E LS +AP   +K+KVL E+A+EH+
Sbjct  124  ELMDIRKQFQAKYGKDFVTAAIEVRPECGVSRMMVEKLSAKAPDVQIKIKVLNEVAKEHD  183

Query  739  L  741
            +
Sbjct  184  V  184



>ref|XP_010551261.1| PREDICTED: IST1 homolog [Tarenaya hassleriana]
Length=315

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++  FN+G   AKCKT L L I RIKLL+N+R++QLK M+KEIA+ L+ GQE  ARIRVE
Sbjct  4    LNQLFNRGIFGAKCKTCLNLAISRIKLLQNKRDMQLKHMKKEIAQFLQAGQEPIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            H++RE  + AA EI+ELFCE +  R+P++E Q+ECP +L+EAISS+ FAAPRC+++P+L 
Sbjct  64   HVVRELNLWAAYEILELFCEFVLARVPVLETQKECPRELREAISSIIFAAPRCSEVPDLL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            Q++  F  KYGKEF+ +A+ELRP+ GVNR +IE LS  AP+ +VKLK+LKEIA+E+ L
Sbjct  124  QIRNLFGSKYGKEFIMSASELRPDSGVNRTIIEKLSPSAPSGEVKLKLLKEIAQEYNL  181



>ref|XP_006475395.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=1075

 Score =   216 bits (550),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLL+N+R  Q+KQ+++E+A+LLE+GQ+ TARIRVEH++REE  MAA +++E++CELI 
Sbjct  21   RIKLLKNKRGAQVKQLKRELAQLLESGQDQTARIRVEHVVREENTMAAYDLLEIYCELIV  80

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPI+E+Q+ CP+DLKEAI SV FA+PRCAD+PEL  V+  FT KYGK+FV+AA ELRP
Sbjct  81   TRLPIVESQKNCPIDLKEAICSVIFASPRCADIPELMDVRKMFTSKYGKDFVSAAAELRP  140

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGV+R L+E LS++AP    K+K+L  IAEEH +
Sbjct  141  DCGVSRLLVEKLSVKAPDGPTKIKILTAIAEEHNI  175



>ref|XP_011076703.1| PREDICTED: IST1-like protein isoform X1 [Sesamum indicum]
Length=327

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            I RIKLL+N+R++ LK MRKEIA+ L+TGQEA ARIRVEH+IRE+      EI+ELFCE 
Sbjct  31   ISRIKLLQNKRDVHLKLMRKEIAEFLQTGQEAIARIRVEHVIREQNTWEVYEILELFCEF  90

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  R+PI+E+QRECP +L+EA++S+ FAAPRC+DLP+L  V+  F  KYGKEF+AAA+EL
Sbjct  91   VLARVPILESQRECPTELQEAVASIIFAAPRCSDLPDLLHVRNLFAVKYGKEFIAAASEL  150

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+  VNR +IE LS+ AP  DVKLKVLKEIA E+ +
Sbjct  151  RPDTSVNRTIIEKLSVSAPPADVKLKVLKEIALEYNI  187



>ref|XP_006451405.1| hypothetical protein CICLE_v10010570mg [Citrus clementina]
 gb|ESR64645.1| hypothetical protein CICLE_v10010570mg [Citrus clementina]
Length=1034

 Score =   216 bits (549),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLL+N+R  Q+KQ+++E+A+LLE+GQ+ TARIRVEH++REE  MAA +++E++CELI 
Sbjct  21   RIKLLKNKRGAQVKQLKRELAQLLESGQDQTARIRVEHVVREENTMAAYDLLEIYCELIV  80

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPI+E+Q+ CP+DLKEAI SV FA+PRCAD+PEL  V+  FT KYGK+FV+AA ELRP
Sbjct  81   TRLPIVESQKNCPIDLKEAICSVIFASPRCADIPELMDVRKMFTSKYGKDFVSAAAELRP  140

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGV+R L+E LS++AP    K+K+L  IAEEH +
Sbjct  141  DCGVSRLLVEKLSVKAPDGPTKIKILTAIAEEHNI  175



>gb|KDO59271.1| hypothetical protein CISIN_1g001451mg [Citrus sinensis]
Length=1075

 Score =   216 bits (550),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLL+N+R  Q+KQ+++E+A+LLE+GQ+ TARIRVEH++REE  MAA +++E++CELI 
Sbjct  21   RIKLLKNKRGAQVKQLKRELAQLLESGQDQTARIRVEHVVREENTMAAYDLLEIYCELIV  80

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPI+E+Q+ CP+DLKEAI SV FA+PRCAD+PEL  V+  FT KYGK+FV+AA ELRP
Sbjct  81   TRLPIVESQKNCPIDLKEAICSVIFASPRCADIPELMDVRKMFTSKYGKDFVSAAAELRP  140

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGV+R L+E LS++AP    K+K+L  IAEEH +
Sbjct  141  DCGVSRLLVEKLSVKAPDGPTKIKILTAIAEEHNI  175



>ref|XP_012065349.1| PREDICTED: IST1-like protein [Jatropha curcas]
 gb|KDP43728.1| hypothetical protein JCGZ_22355 [Jatropha curcas]
Length=474

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLLRN+RE  ++QMR++IA LL++GQ+ATARIRVEH+IRE+ ++AA E IELFCEL
Sbjct  39   VARIKLLRNKREAVVRQMRRDIALLLQSGQDATARIRVEHVIREQNVLAANEFIELFCEL  98

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  RL II  QRECP DLKE I+S+ FAAPRC+++PEL  ++  F  KYGK+FV+AAT+L
Sbjct  99   VVARLSIIAKQRECPADLKEGIASIIFAAPRCSEIPELVAMRDIFEKKYGKDFVSAATDL  158

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP  GVNR LIE LS+R P  +VKLK++KEIA+EH++
Sbjct  159  RPNSGVNRMLIEKLSVRTPTGEVKLKIMKEIAKEHQI  195



>ref|XP_012076797.1| PREDICTED: uncharacterized protein LOC105637790 isoform X1 [Jatropha 
curcas]
 gb|KDP33748.1| hypothetical protein JCGZ_07319 [Jatropha curcas]
Length=1138

 Score =   216 bits (550),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 99/157 (63%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL+N+R+ Q+K +++E+A+LL++GQ+ TARIRVEH++REEK MAA ++IE++CEL
Sbjct  19   VSRIKLLKNKRDSQVKHLKRELAQLLDSGQDQTARIRVEHVVREEKTMAAYDLIEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I  RLPIIE+Q+ CP+DLKEAISSV FA+PRCAD+PEL  V+  FT KYGKEFV+AA EL
Sbjct  79   IVARLPIIESQKNCPIDLKEAISSVIFASPRCADIPELMDVRKHFTAKYGKEFVSAAVEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGV+R L+E LS +AP    K+KVL  IAEEH++
Sbjct  139  RPDCGVSRLLVEKLSAKAPDGPTKIKVLSAIAEEHDV  175



>ref|XP_007202071.1| hypothetical protein PRUPE_ppa005964mg [Prunus persica]
 gb|EMJ03270.1| hypothetical protein PRUPE_ppa005964mg [Prunus persica]
Length=435

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCK   K+ + RIKLLRN+R+  +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQAVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCEL+  RL II  QRECP DLKE I+S+ FA+PRC+++PEL ++
Sbjct  80   IREQNVLAANEFIELFCELVVSRLSIIAKQRECPADLKEGIASLIFASPRCSEIPELVEL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FV+AA +LRP CGVNR LI+ LS+R P  +VKLK+LKEIA+E+++
Sbjct  140  RNIFEKKYGRDFVSAAVDLRPSCGVNRMLIDKLSVRTPTGEVKLKLLKEIAKEYQV  195



>ref|XP_004232542.1| PREDICTED: uncharacterized protein LOC101250180 [Solanum lycopersicum]
Length=489

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F + F ++KCKT+ K+T+ RIKLLRN+RE+ ++QMR++IA LLE+ Q+ATARIRVEH+
Sbjct  20   SLFCRTFNSSKCKTMAKMTVARIKLLRNKREVVVRQMRRDIAMLLESHQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++ A EI+ELFCELI  RL II  Q++CP DLKE ISS+ FAAPRC+D+PEL  +
Sbjct  80   IREQNILQANEILELFCELIVARLTIIAKQKQCPADLKEGISSLIFAAPRCSDIPELMGI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS++ P+ +VKLK++KEIA+E+++
Sbjct  140  KDVFEKKYGKDFVSAATDLRPNAGVNRTLIEKLSVKTPSGEVKLKIMKEIAKEYQV  195



>ref|XP_006340806.1| PREDICTED: uncharacterized protein LOC102584459 isoform X2 [Solanum 
tuberosum]
Length=478

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F + F ++KCKT+ K+T+ RIKLLRN+RE+ ++QMR++IA LLE+ Q+ATARIRVEH+
Sbjct  20   SLFCRTFNSSKCKTMAKMTVARIKLLRNKREVVVRQMRRDIAMLLESRQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++ A EI+ELFCELI  RL II  Q++CP DLKE ISS+ FAAPRC+D+PEL  +
Sbjct  80   IREQNILQANEILELFCELIVARLTIIAKQKQCPADLKEGISSLIFAAPRCSDIPELMGI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS++ P+ +VKLK++KEIA+E+++
Sbjct  140  KDVFEKKYGKDFVSAATDLRPNAGVNRTLIEKLSVKTPSGEVKLKIMKEIAKEYQV  195



>ref|XP_009614745.1| PREDICTED: dentin sialophosphoprotein [Nicotiana tomentosiformis]
Length=1156

 Score =   215 bits (548),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 93/153 (61%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLL+N++E+ +KQM++E+A+LL++GQ+ TARIRVEH++REEKMMAA ++IE++CELI 
Sbjct  33   RLKLLKNKKEVAVKQMKREVAQLLDSGQDRTARIRVEHVVREEKMMAAYDLIEIYCELIV  92

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEAI+SV FA+PRC D+PEL  V+  FT KYGKEF++AA ELRP
Sbjct  93   ARLPIIESQKNCPIDLKEAITSVVFASPRCGDIPELLDVRKHFTAKYGKEFISAAVELRP  152

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
            +CGV+R L+E LS +AP    K+++L  IA E+
Sbjct  153  DCGVSRMLVEKLSAKAPDGQTKIRILGSIAVEY  185



>ref|XP_009337093.1| PREDICTED: uncharacterized protein LOC103929596 [Pyrus x bretschneideri]
Length=493

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCK   K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCEL+  RL II  QRECP DLKE I+S+ FA+PRC+++PEL  +
Sbjct  80   IREQNVLAANEFIELFCELVVSRLSIIAKQRECPPDLKEGIASLIFASPRCSEIPELITL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AA ++RP CGVNR LI+ LS+R P  +VKLK+LKEIA+E+++
Sbjct  140  RNIFEKKYGKDFVSAAVDVRPSCGVNRMLIDKLSVRTPTGEVKLKLLKEIAKEYQV  195



>ref|XP_006340805.1| PREDICTED: uncharacterized protein LOC102584459 isoform X1 [Solanum 
tuberosum]
Length=489

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F + F ++KCKT+ K+T+ RIKLLRN+RE+ ++QMR++IA LLE+ Q+ATARIRVEH+
Sbjct  20   SLFCRTFNSSKCKTMAKMTVARIKLLRNKREVVVRQMRRDIAMLLESRQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++ A EI+ELFCELI  RL II  Q++CP DLKE ISS+ FAAPRC+D+PEL  +
Sbjct  80   IREQNILQANEILELFCELIVARLTIIAKQKQCPADLKEGISSLIFAAPRCSDIPELMGI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS++ P+ +VKLK++KEIA+E+++
Sbjct  140  KDVFEKKYGKDFVSAATDLRPNAGVNRTLIEKLSVKTPSGEVKLKIMKEIAKEYQV  195



>ref|XP_009783674.1| PREDICTED: dentin sialophosphoprotein [Nicotiana sylvestris]
Length=1142

 Score =   215 bits (547),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 93/153 (61%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            R+KLL+N++E+ +KQM++E+A+LL++GQ+ TARIRVEH++REEKM+AA ++IE++CELI 
Sbjct  33   RLKLLKNKKEVAVKQMKREVAQLLDSGQDRTARIRVEHVVREEKMIAAYDLIEIYCELIV  92

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEAI+SV FA+PRC D+PEL  V+  FT KYGKEF++AA ELRP
Sbjct  93   ARLPIIESQKNCPIDLKEAITSVVFASPRCGDIPELLDVRKHFTAKYGKEFISAAVELRP  152

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
            +CGV+R L+E LS +AP    K+++L  IA EH
Sbjct  153  DCGVSRMLVEKLSAKAPDGQTKIRILGAIAVEH  185



>ref|XP_008242434.1| PREDICTED: dentin sialophosphoprotein-like [Prunus mume]
Length=1385

 Score =   216 bits (549),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 97/157 (62%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL+N+++ Q+KQ+++E+A+LLETGQE TARIRVEH++REEK  AA E+IE++CEL
Sbjct  19   VSRIKLLKNKKDAQVKQIKRELAQLLETGQERTARIRVEHVLREEKTKAAYELIEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLP+IE+Q+ CP+DLKEAI+SV FA+PRCAD+PEL  V+  FT KYGKEF++ A EL
Sbjct  79   IAARLPMIESQKNCPIDLKEAITSVVFASPRCADIPELMDVRKHFTAKYGKEFISGAVEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CGVNR L+E LS ++P    K+K+L  IAEEH +
Sbjct  139  RPDCGVNRMLVEKLSAKSPDGPTKMKILAAIAEEHNI  175



>ref|XP_008393582.1| PREDICTED: uncharacterized protein DDB_G0271670 [Malus domestica]
Length=494

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCK   K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCEL+  RL II  QRECP DLKE I+S+ FA+PRC+++PEL  +
Sbjct  80   IREQNILAANEFIELFCELVVSRLSIIAKQRECPPDLKEGIASLIFASPRCSEIPELIAL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV AA ++RP CGVNR LI+ LS+R P  +VKLK+LKEIA+E+++
Sbjct  140  RNIFEKKYGKDFVXAAVDVRPSCGVNRMLIDKLSVRTPTGEVKLKLLKEIAKEYQV  195



>ref|XP_009418373.1| PREDICTED: IST1-like protein [Musa acuminata subsp. malaccensis]
Length=327

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +1

Query  208  MDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVE  387
            ++S FN+     +CKT L L I RIKLLRN+RE+QLK MRKEI++ ++TGQEA ARIRVE
Sbjct  4    LNSIFNRASFGTRCKTCLNLAISRIKLLRNKRELQLKHMRKEISQYIQTGQEAIARIRVE  63

Query  388  HIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQ  567
            +IIRE+ ++AA EIIELFCE +  R+ I+E QR CP++L+EA++S+ FA+PRC+DLPEL 
Sbjct  64   NIIREQNILAAYEIIELFCEFVLARVLILETQRACPVELQEAVASIIFASPRCSDLPELL  123

Query  568  QVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             ++  F  KYGKEF AAA+ELRPE  VNR +IE L++ AP  ++K+KVLK IA+E+ L
Sbjct  124  HIRNLFFTKYGKEFAAAASELRPESNVNRMIIEKLTVTAPPAELKVKVLKAIAQEYNL  181



>ref|XP_002279892.1| PREDICTED: uncharacterized protein LOC100256064 isoform X1 [Vitis 
vinifera]
 emb|CBI27947.3| unnamed protein product [Vitis vinifera]
Length=1179

 Score =   214 bits (546),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 95/157 (61%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL+NRRE QLKQM++++A+LL++GQ+ TARIRVEH++REEK MAA ++IE++CE+
Sbjct  19   VSRIKLLKNRREAQLKQMKRDLAQLLQSGQDQTARIRVEHVVREEKTMAAYDLIEVYCEM  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLPIIE+Q+ CP+DLKEAI+S+ FA+PRC+D+PEL +++  FT KYGK+F++ A EL
Sbjct  79   IAARLPIIESQKNCPIDLKEAITSIIFASPRCSDIPELMEIRKHFTAKYGKDFISVALEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RPECGV+R L+E LS  AP    K+K+L  IAEEH +
Sbjct  139  RPECGVSRNLVEKLSATAPDGQTKIKILAAIAEEHNI  175



>emb|CDP01823.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F + F ++KCKT+ K+ + RIKLLRN+RE+ ++QMR++IA LLE  Q+ATAR+RVEH+
Sbjct  20   SLFGRRFNSSKCKTMAKMAVARIKLLRNKREVVIRQMRRDIAMLLEKKQDATARVRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA E IELFCELI  RL II  +R+CP DLKE ISS+ FA PRC+++PEL  +
Sbjct  80   IREQNIMAANEFIELFCELIVARLQIIAKRRDCPADLKEGISSLIFAGPRCSEIPELLAI  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AAT+LRP  GVNR LIE LS+R P+ +VKLKV+KEIA+E+++
Sbjct  140  RDVFEKKYGKDFVSAATDLRPNAGVNRMLIEKLSVRTPSGEVKLKVMKEIAKEYQV  195



>ref|XP_008797910.1| PREDICTED: uncharacterized protein LOC103712964 [Phoenix dactylifera]
Length=1071

 Score =   214 bits (544),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 93/155 (60%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLL+N+R++ LKQM++++A+LL++GQE TARIRVEH+IREEK M+A ++IE++CELI 
Sbjct  30   RIKLLKNKRQVLLKQMKRDLAQLLDSGQEQTARIRVEHVIREEKTMSAYDLIEIYCELIV  89

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEA++S+ FA+PRCAD+PEL +++  F  KYGKEF+ AA E+RP
Sbjct  90   ARLPIIESQKSCPIDLKEAVASIVFASPRCADIPELMEIRKHFLAKYGKEFITAALEVRP  149

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            ECGV+R ++E LS RAP  + K+K L  IA+EH +
Sbjct  150  ECGVSRMVVEKLSARAPDVEAKIKTLTAIAQEHNV  184



>ref|XP_010656225.1| PREDICTED: uncharacterized protein LOC100256064 isoform X2 [Vitis 
vinifera]
Length=1157

 Score =   214 bits (545),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 95/157 (61%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL+NRRE QLKQM++++A+LL++GQ+ TARIRVEH++REEK MAA ++IE++CE+
Sbjct  19   VSRIKLLKNRREAQLKQMKRDLAQLLQSGQDQTARIRVEHVVREEKTMAAYDLIEVYCEM  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLPIIE+Q+ CP+DLKEAI+S+ FA+PRC+D+PEL +++  FT KYGK+F++ A EL
Sbjct  79   IAARLPIIESQKNCPIDLKEAITSIIFASPRCSDIPELMEIRKHFTAKYGKDFISVALEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RPECGV+R L+E LS  AP    K+K+L  IAEEH +
Sbjct  139  RPECGVSRNLVEKLSATAPDGQTKIKILAAIAEEHNI  175



>emb|CDY69937.1| BnaAnng32080D, partial [Brassica napus]
Length=415

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCKT  K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRLGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA EIIELFCELI  RL II  Q+ECP+DLKE I+S+ FAAPRC+++PEL  +
Sbjct  80   IREQNILAANEIIELFCELIVSRLAIITKQKECPVDLKEGIASLIFAAPRCSEIPELGDL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FV+AATELRP CGVNR L+  LS+  P  + KLKV+KEIA+E ++
Sbjct  140  KDIFEKKYGRDFVSAATELRPTCGVNRMLVVKLSVTRPEGEFKLKVMKEIAKEFQV  195



>ref|XP_010912111.1| PREDICTED: sericin 1-like [Elaeis guineensis]
Length=1073

 Score =   213 bits (543),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 106/181 (59%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +1

Query  199  RNEMDSFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARI  378
            ++++     K FKA KCKT LKL + RIKLL+N+RE+ LKQM++++A+LLE+GQE TARI
Sbjct  4    KSKISGMLPKSFKAGKCKTSLKLALARIKLLKNKREVLLKQMKRDLAQLLESGQEQTARI  63

Query  379  RVEHIIREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLP  558
            RVEH+IREEK M+A ++IE++CELI  RL IIE+Q+ CP+DLKEAI+S+ FA+PRCAD+P
Sbjct  64   RVEHVIREEKTMSAYDLIEIYCELIVARLSIIESQKICPIDLKEAIASIVFASPRCADIP  123

Query  559  ELQQVQLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHE  738
            EL +++  F  KYGKEF+ AA E+RPECGV+R ++E LS RAP  + K+K L  IA+EH 
Sbjct  124  ELMEIRKHFLAKYGKEFITAALEVRPECGVSRMVVEKLSARAPDVETKVKTLTAIAQEHN  183

Query  739  L  741
            +
Sbjct  184  V  184



>ref|XP_011010805.1| PREDICTED: uncharacterized protein LOC105115575 [Populus euphratica]
Length=1117

 Score =   214 bits (544),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 96/155 (62%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  277  RIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCELIS  456
            RIKLL+N+RE Q+K +++E+A+LL+ GQ+ TARIRVEH++REEK +AA E+IE++CELI 
Sbjct  21   RIKLLKNKREAQVKHLKRELAQLLDAGQDRTARIRVEHVVREEKTLAAYELIEIYCELIV  80

Query  457  VRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATELRP  636
             RLPIIE+Q+ CP+DLKEA+SSV FA+PRCAD+PEL  ++   T KYGKEFV+AA ELRP
Sbjct  81   ARLPIIESQKNCPIDLKEAVSSVIFASPRCADVPELMDIRKHLTAKYGKEFVSAAVELRP  140

Query  637  ECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +CGV+R L+E LS +AP    K+K+L  IAEEH +
Sbjct  141  DCGVSRLLVEKLSSKAPDGPTKIKILTAIAEEHNI  175



>ref|XP_009392873.1| PREDICTED: IST1-like protein [Musa acuminata subsp. malaccensis]
Length=448

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            +   +GF ++KCKT  K+   RIKLLRN+RE Q++QMR+++A LLE+G++ TARIRVEH+
Sbjct  23   AILGRGFNSSKCKTEAKMATARIKLLRNKREAQVRQMRRDVAMLLESGRDETARIRVEHV  82

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ +MAA EIIELFCEL+  RLPII  QR CP DLKE ISS+ +A+PRC+++PEL ++
Sbjct  83   IREQNVMAANEIIELFCELLVARLPIIAKQRICPPDLKEGISSLIYASPRCSEIPELSRI  142

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEH  735
               F  KYGK+FV+AAT+LRPE GVN  LIE LS+R P  ++KLKVLKEIA+E+
Sbjct  143  VHMFEKKYGKDFVSAATDLRPESGVNCMLIEKLSVRKPTGEIKLKVLKEIAKEY  196



>ref|XP_011007786.1| PREDICTED: uncharacterized protein LOC105113336 isoform X2 [Populus 
euphratica]
Length=466

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLLRN+RE  ++QMR++IA LL++GQ+ATARIRVEH+IRE+ ++AA E IELFCEL
Sbjct  39   VARIKLLRNKREAVMRQMRRDIAVLLQSGQDATARIRVEHVIREQNVLAANEFIELFCEL  98

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            +  RL II  +RECP DLKE I+S+ FA+PRC+++PEL  ++  F  KYGK+FV+AAT+L
Sbjct  99   VVSRLSIIAKRRECPADLKEGIASLIFASPRCSEIPELVALRKIFEKKYGKDFVSAATDL  158

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP  GVNR LI+ LS+R P  +VKLKV+KEIA+EH++
Sbjct  159  RPNSGVNRMLIDKLSVRTPTGEVKLKVMKEIAKEHQI  195



>ref|XP_008241981.1| PREDICTED: uncharacterized protein LOC103340355 [Prunus mume]
Length=456

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCK   K+ + RIKLLRN+R+  +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQAVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE+ ++AA E IELFCEL+  RL II  QRECP DLKE I+S+ FA+PRC+++PEL ++
Sbjct  80   IREQNVLAANEFIELFCELVVSRLSIIAKQRECPADLKEGIASLIFASPRCSEIPELLEL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYG++FV+AA ++RP CGVNR LI+ LS+R P  +VKLK+LKEIA+E+++
Sbjct  140  RNIFEKKYGRDFVSAAVDVRPSCGVNRMLIDKLSVRTPTGEVKLKLLKEIAKEYQV  195



>ref|XP_008337952.1| PREDICTED: uncharacterized protein LOC103401027 [Malus domestica]
Length=494

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCK   K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE  ++AA E IELFCEL+  RL II  QRECP DLKE I+S+ FA+PRC+++PEL  +
Sbjct  80   IREXNVLAANEFIELFCELVVSRLSIIAKQRECPPDLKEGIASLIFASPRCSEIPELIAL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AA ++RP CGVNR LI+ LS+R P  +VKLK+LKEIA+E+++
Sbjct  140  RNIFEKKYGKDFVSAAVDVRPSCGVNRMLIDKLSVRTPTGEVKLKLLKEIAKEYQV  195



>ref|XP_002514165.1| protein with unknown function [Ricinus communis]
 gb|EEF48119.1| protein with unknown function [Ricinus communis]
Length=1155

 Score =   213 bits (543),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 109/174 (63%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  220  FNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIR  399
             +K FK AKCKT LKL + RIKLL+N+R+ Q+KQ+++E+A+LLE+GQ+ TARIRVEH++R
Sbjct  2    LHKSFKPAKCKTALKLAVSRIKLLKNKRDAQVKQLKRELAQLLESGQDRTARIRVEHVVR  61

Query  400  EEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQL  579
            EEK +AA ++IE++CELI  RL IIE+Q+ CP+DLKEAISSV FA+PRCAD+PEL  V+ 
Sbjct  62   EEKTLAAYDLIEIYCELIVARLQIIESQKNCPIDLKEAISSVLFASPRCADVPELMDVRK  121

Query  580  AFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
             FT KYGKEFV+AA ELRP+CGV+R L+E LS +AP   +K+K+L  IAEEH +
Sbjct  122  HFTAKYGKEFVSAAVELRPDCGVSRLLVEKLSAKAPDGPMKMKILSAIAEEHNV  175



>ref|XP_008352419.1| PREDICTED: uncharacterized protein LOC103415915 [Malus domestica]
Length=494

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  214  SFFNKGFkaakcktllkltIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHI  393
            S F  GF ++KCK   K+ + RIKLLRN+R++ +KQMR++IA LL++GQ+ATARIRVEH+
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATARIRVEHV  79

Query  394  IREEKMMAAQEIIELFCELISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQV  573
            IRE  ++AA E IELFCEL+  RL II  QRECP DLKE I+S+ FA+PRC+++PEL  +
Sbjct  80   IREXNVLAANEFIELFCELVVSRLSIIAKQRECPPDLKEGIASLIFASPRCSEIPELIAL  139

Query  574  QLAFTGKYGKEFVAAATELRPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            +  F  KYGK+FV+AA ++RP CGVNR LI+ LS+R P  +VKLK+LKEIA+E+++
Sbjct  140  RNIFEKKYGKDFVSAAVDVRPSCGVNRMLIDKLSVRTPTGEVKLKLLKEIAKEYQV  195



>gb|KHN32904.1| IST1-like protein [Glycine soja]
Length=1060

 Score =   213 bits (541),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 95/157 (61%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = +1

Query  271  IPRIKLLRNRREIQLKQMRKEIAKLLETGQEATARIRVEHIIREEKMMAAQEIIELFCEL  450
            + RIKLL+N+RE Q+KQ+++E+A+LLE+GQ+ TARIRVEH++REEK MAA +++E++CEL
Sbjct  19   VSRIKLLKNKREAQIKQLKRELAQLLESGQDRTARIRVEHVVREEKTMAAYDLVEIYCEL  78

Query  451  ISVRLPIIEAQRECPLDLKEAISSVCFAAPRCADLPELQQVQLAFTGKYGKEFVAAATEL  630
            I+ RLP+IE+Q+ CP+DLKEA+SSV FA+PRC+DLPEL  V+   T KYGKEFV+AA EL
Sbjct  79   IAARLPMIESQKNCPIDLKEAVSSVIFASPRCSDLPELMDVKKQITSKYGKEFVSAAIEL  138

Query  631  RPECGVNRQLIELLSIRAPAPDVKLKVLKEIAEEHEL  741
            RP+CG    L+E LS +AP    K+K+L  IAEEH +
Sbjct  139  RPDCG----LVEKLSAKAPDGPTKIKILAAIAEEHNI  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1400076157675