BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11592

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg             197   6e-57   Citrus clementina [clementine]
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                   197   6e-57   Citrus sinensis [apfelsine]
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like    197   7e-57   Citrus sinensis [apfelsine]
ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45         192   9e-55   Solanum lycopersicum
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46         189   1e-53   Nicotiana tomentosiformis
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45         189   2e-53   Nicotiana sylvestris
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like    188   3e-53   Solanum tuberosum [potatoes]
ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like    186   3e-52   Solanum tuberosum [potatoes]
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like    185   6e-52   Solanum tuberosum [potatoes]
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...    183   2e-51   
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg             181   1e-50   
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46         181   1e-50   Eucalyptus grandis [rose gum]
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45         179   4e-50   
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                     179   5e-50   Eucalyptus grandis [rose gum]
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45         179   5e-50   
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                     179   7e-50   Eucalyptus grandis [rose gum]
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                   178   9e-50   Citrus sinensis [apfelsine]
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         178   1e-49   Gossypium arboreum [tree cotton]
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like    179   2e-49   
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45         177   3e-49   
ref|XP_007046207.1|  Serine carboxypeptidase 46                         177   5e-49   
ref|XP_011629134.1|  PREDICTED: serine carboxypeptidase-like 45         176   5e-49   
gb|ERM96771.1|  hypothetical protein AMTR_s02986p00003470               176   7e-49   Amborella trichopoda
ref|XP_007046209.1|  Serine carboxypeptidase 46 isoform 2               174   1e-48   
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1               174   3e-48   
ref|XP_010256545.1|  PREDICTED: serine carboxypeptidase-like 45         174   5e-48   
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46         171   4e-47   Vitis vinifera
gb|KJB11409.1|  hypothetical protein B456_001G257100                    170   5e-47   Gossypium raimondii
ref|XP_007099702.1|  Serine carboxypeptidase 46                         170   2e-46   
ref|XP_006838780.1|  PREDICTED: serine carboxypeptidase-like 45         168   8e-46   Amborella trichopoda
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...    166   6e-45   Vitis vinifera
emb|CBI22166.3|  unnamed protein product                                166   8e-45   Vitis vinifera
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g             163   5e-44   Phaseolus vulgaris [French bean]
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...    161   4e-43   Vitis vinifera
emb|CAJ91147.1|  serine carboxypeptidase II                             152   1e-41   Platanus x hispanica [London plane tree]
gb|KHN08898.1|  Serine carboxypeptidase-like 45                         155   3e-41   Glycine soja [wild soybean]
gb|KJB40058.1|  hypothetical protein B456_007G044700                    152   3e-41   Gossypium raimondii
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like    155   3e-41   
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g             155   3e-41   Phaseolus vulgaris [French bean]
ref|XP_012088729.1|  PREDICTED: serine carboxypeptidase-like 45         154   7e-41   Jatropha curcas
gb|KJB40057.1|  hypothetical protein B456_007G044700                    153   8e-41   Gossypium raimondii
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    154   1e-40   Glycine max [soybeans]
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         154   1e-40   Glycine soja [wild soybean]
ref|XP_006495375.1|  PREDICTED: serine carboxypeptidase-like 45-like    150   2e-40   
gb|KDO83183.1|  hypothetical protein CISIN_1g012396mg                   150   2e-40   Citrus sinensis [apfelsine]
ref|XP_006380972.1|  hypothetical protein POPTR_0006s03480g             153   2e-40   
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45         154   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006380973.1|  hypothetical protein POPTR_0006s03480g             153   2e-40   
ref|XP_011040750.1|  PREDICTED: serine carboxypeptidase-like 45         153   3e-40   Populus euphratica
gb|KJB40056.1|  hypothetical protein B456_007G044700                    153   3e-40   Gossypium raimondii
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         153   3e-40   Pyrus x bretschneideri [bai li]
gb|KDO83182.1|  hypothetical protein CISIN_1g012396mg                   150   3e-40   Citrus sinensis [apfelsine]
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                152   4e-40   
ref|XP_012072731.1|  PREDICTED: serine carboxypeptidase-like 45         152   5e-40   Jatropha curcas
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45         152   5e-40   Sesamum indicum [beniseed]
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46         152   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1          152   5e-40   Theobroma cacao [chocolate]
gb|KDP37688.1|  hypothetical protein JCGZ_06345                         152   6e-40   Jatropha curcas
ref|XP_006477516.1|  PREDICTED: serine carboxypeptidase-like 45-like    148   7e-40   
gb|KHG09716.1|  Serine carboxypeptidase-like 45                         152   7e-40   Gossypium arboreum [tree cotton]
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3          152   8e-40   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       152   8e-40   Elaeis guineensis
gb|KGN59522.1|  hypothetical protein Csa_3G824190                       146   9e-40   Cucumis sativus [cucumbers]
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like    151   9e-40   Glycine max [soybeans]
ref|XP_002517286.1|  serine carboxypeptidase, putative                  151   1e-39   
emb|CDO98312.1|  unnamed protein product                                151   1e-39   Coffea canephora [robusta coffee]
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...    151   1e-39   Glycine max [soybeans]
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46         151   1e-39   Brassica rapa
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45         151   2e-39   
ref|XP_006576775.1|  PREDICTED: serine carboxypeptidase-like 45-l...    150   2e-39   
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                151   2e-39   Selaginella moellendorffii
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45         151   2e-39   Eucalyptus grandis [rose gum]
ref|XP_006844530.2|  PREDICTED: serine carboxypeptidase-like 45         150   2e-39   Amborella trichopoda
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    150   2e-39   Citrus sinensis [apfelsine]
ref|XP_008443350.1|  PREDICTED: serine carboxypeptidase-like 45         151   2e-39   Cucumis melo [Oriental melon]
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   150   2e-39   Citrus sinensis [apfelsine]
gb|ERN06205.1|  hypothetical protein AMTR_s00016p00162700               150   2e-39   Amborella trichopoda
ref|XP_002512656.1|  serine carboxypeptidase, putative                  150   2e-39   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             150   2e-39   Citrus clementina [clementine]
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            150   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46         150   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...    150   3e-39   Glycine max [soybeans]
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       150   3e-39   Phoenix dactylifera
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         150   4e-39   Glycine soja [wild soybean]
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         144   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    150   4e-39   Glycine max [soybeans]
ref|XP_002517289.1|  serine carboxypeptidase, putative                  149   5e-39   Ricinus communis
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          150   5e-39   Sorghum bicolor [broomcorn]
ref|XP_010653630.1|  PREDICTED: serine carboxypeptidase-like 45         146   5e-39   
emb|CBI32794.3|  unnamed protein product                                149   6e-39   Vitis vinifera
ref|XP_004136677.1|  PREDICTED: serine carboxypeptidase-like 45         149   6e-39   Cucumis sativus [cucumbers]
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         149   6e-39   Vitis vinifera
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    148   7e-39   
emb|CDY11750.1|  BnaC03g58280D                                          149   8e-39   Brassica napus [oilseed rape]
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g             149   8e-39   Phaseolus vulgaris [French bean]
ref|XP_002520628.1|  serine carboxypeptidase, putative                  149   9e-39   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       149   9e-39   Phoenix dactylifera
gb|KEH40983.1|  serine carboxypeptidase-like protein                    148   1e-38   Medicago truncatula
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45         149   1e-38   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45         148   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg             148   1e-38   Capsella rubella
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein         148   1e-38   
gb|KEH33274.1|  serine carboxypeptidase-like protein                    148   1e-38   Medicago truncatula
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             148   1e-38   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         148   1e-38   Vitis vinifera
emb|CDY19500.1|  BnaC04g10990D                                          148   1e-38   Brassica napus [oilseed rape]
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    148   2e-38   Elaeis guineensis
ref|XP_012072739.1|  PREDICTED: serine carboxypeptidase-like 45         147   2e-38   
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    148   2e-38   
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg             147   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g             147   2e-38   Phaseolus vulgaris [French bean]
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45         148   3e-38   Camelina sativa [gold-of-pleasure]
gb|KDP37687.1|  hypothetical protein JCGZ_06344                         147   3e-38   Jatropha curcas
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         148   3e-38   Nelumbo nucifera [Indian lotus]
gb|KJB31549.1|  hypothetical protein B456_005G196500                    144   3e-38   Gossypium raimondii
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299             147   3e-38   
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45         147   3e-38   Populus euphratica
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...    147   3e-38   Populus euphratica
ref|XP_002517750.1|  serine carboxypeptidase, putative                  147   4e-38   Ricinus communis
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...    147   4e-38   Populus euphratica
ref|XP_002277420.3|  PREDICTED: serine carboxypeptidase-like 45         147   4e-38   Vitis vinifera
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like    147   4e-38   Glycine max [soybeans]
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    147   4e-38   Prunus mume [ume]
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    147   4e-38   Prunus mume [ume]
gb|KHN07932.1|  Serine carboxypeptidase-like 45                         147   4e-38   Glycine soja [wild soybean]
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45         147   4e-38   Pyrus x bretschneideri [bai li]
gb|AAB80670.1|  putative serine carboxypeptidase II                     147   5e-38   Arabidopsis thaliana [mouse-ear cress]
gb|ERN14540.1|  hypothetical protein AMTR_s00038p00085900               147   5e-38   Amborella trichopoda
gb|KJB31550.1|  hypothetical protein B456_005G196500                    144   5e-38   Gossypium raimondii
ref|XP_002314061.1|  hypothetical protein POPTR_0009s06080g             147   6e-38   Populus trichocarpa [western balsam poplar]
ref|NP_850212.1|  serine carboxypeptidase-like 46                       146   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511104.1|  serine carboxypeptidase, putative                  146   6e-38   Ricinus communis
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45         146   7e-38   Sesamum indicum [beniseed]
gb|KJB31551.1|  hypothetical protein B456_005G196500                    145   7e-38   Gossypium raimondii
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg             146   8e-38   Prunus persica
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg             146   8e-38   Prunus persica
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg             146   9e-38   Eutrema salsugineum [saltwater cress]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            146   9e-38   Vitis vinifera
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45         146   9e-38   Elaeis guineensis
gb|ABK25236.1|  unknown                                                 146   9e-38   Picea sitchensis
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...    146   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006853074.2|  PREDICTED: serine carboxypeptidase II-3            146   1e-37   
gb|KGN59518.1|  hypothetical protein Csa_3G823660                       144   1e-37   Cucumis sativus [cucumbers]
emb|CAN70439.1|  hypothetical protein VITISV_011900                     145   1e-37   Vitis vinifera
ref|XP_012090605.1|  PREDICTED: serine carboxypeptidase-like 45 i...    145   1e-37   Jatropha curcas
ref|XP_010279514.1|  PREDICTED: serine carboxypeptidase-like 40         146   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010653632.1|  PREDICTED: serine carboxypeptidase-like 45         145   1e-37   Vitis vinifera
ref|XP_010055750.1|  PREDICTED: serine carboxypeptidase-like 45 i...    145   1e-37   Eucalyptus grandis [rose gum]
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46         145   2e-37   Camelina sativa [gold-of-pleasure]
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg                145   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       145   2e-37   Phoenix dactylifera
ref|XP_011652217.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    145   2e-37   Cucumis sativus [cucumbers]
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45         145   2e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         145   2e-37   Prunus mume [ume]
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       145   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES77859.2|  serine carboxypeptidase-like protein                    145   2e-37   Medicago truncatula
gb|KJB31548.1|  hypothetical protein B456_005G196500                    145   2e-37   Gossypium raimondii
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         145   2e-37   Populus euphratica
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    145   2e-37   
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...    145   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45         145   2e-37   Fragaria vesca subsp. vesca
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...    145   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       145   2e-37   Elaeis guineensis
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    145   2e-37   Solanum tuberosum [potatoes]
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         145   2e-37   Nicotiana sylvestris
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45         144   2e-37   Cucumis sativus [cucumbers]
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45         145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g             145   3e-37   Populus trichocarpa [western balsam poplar]
gb|KHN13827.1|  Serine carboxypeptidase-like 45                         144   3e-37   Glycine soja [wild soybean]
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45         145   3e-37   Malus domestica [apple tree]
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45         144   3e-37   Sesamum indicum [beniseed]
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    145   3e-37   Eucalyptus grandis [rose gum]
gb|ABK25202.1|  unknown                                                 144   3e-37   Picea sitchensis
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45         145   3e-37   Camelina sativa [gold-of-pleasure]
emb|CBI32802.3|  unnamed protein product                                147   4e-37   Vitis vinifera
gb|EMT05424.1|  Serine carboxypeptidase II-3                            144   4e-37   
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g             144   4e-37   Phaseolus vulgaris [French bean]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            144   4e-37   Sesamum indicum [beniseed]
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45         144   4e-37   
gb|KHN47533.1|  Serine carboxypeptidase-like 45                         144   5e-37   Glycine soja [wild soybean]
emb|CBI32801.3|  unnamed protein product                                144   5e-37   Vitis vinifera
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         144   5e-37   Populus euphratica
gb|EMS60816.1|  Serine carboxypeptidase-like 45                         144   5e-37   Triticum urartu
ref|XP_010906016.1|  PREDICTED: serine carboxypeptidase II-3-like       144   5e-37   
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg             144   5e-37   Capsella rubella
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         144   5e-37   Brachypodium distachyon [annual false brome]
ref|XP_006830191.1|  PREDICTED: serine carboxypeptidase II-3            144   5e-37   Amborella trichopoda
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         144   6e-37   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         144   6e-37   
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          144   6e-37   Arabidopsis lyrata subsp. petraea
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             144   6e-37   
gb|KEH35690.1|  serine carboxypeptidase-like protein                    144   6e-37   Medicago truncatula
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              144   6e-37   
ref|XP_011626549.1|  PREDICTED: serine carboxypeptidase II-3            144   7e-37   
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45         144   7e-37   Brassica rapa
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                    144   7e-37   Arabis alpina [alpine rockcress]
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             143   7e-37   Prunus persica
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    144   8e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45         143   8e-37   Cucumis sativus [cucumbers]
ref|XP_010261659.1|  PREDICTED: serine carboxypeptidase-like 40         144   8e-37   
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like    143   8e-37   Cicer arietinum [garbanzo]
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                     143   8e-37   Eucalyptus grandis [rose gum]
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45         143   9e-37   Phoenix dactylifera
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...    143   1e-36   Phoenix dactylifera
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         143   1e-36   Nicotiana tomentosiformis
emb|CDX90124.1|  BnaA08g18600D                                          143   1e-36   
ref|XP_008443351.1|  PREDICTED: serine carboxypeptidase-like 45         143   1e-36   
gb|EAY93940.1|  hypothetical protein OsI_15713                          143   1e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45         143   1e-36   Populus euphratica
gb|KCW64995.1|  hypothetical protein EUGRSUZ_G02537                     143   1e-36   Eucalyptus grandis [rose gum]
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             143   1e-36   Populus trichocarpa [western balsam poplar]
ref|NP_001052663.1|  Os04g0396800                                       143   1e-36   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    143   1e-36   Nicotiana tomentosiformis
ref|XP_002462503.1|  hypothetical protein SORBIDRAFT_02g026870          143   1e-36   
ref|XP_011025505.1|  PREDICTED: serine carboxypeptidase-like 40 i...    142   1e-36   Populus euphratica
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like    143   1e-36   Cicer arietinum [garbanzo]
gb|ACN29008.1|  unknown                                                 143   1e-36   Zea mays [maize]
ref|XP_010068956.1|  PREDICTED: serine carboxypeptidase-like 40         143   1e-36   Eucalyptus grandis [rose gum]
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...    143   1e-36   Phoenix dactylifera
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45         143   1e-36   
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    142   2e-36   
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...    142   2e-36   Solanum lycopersicum
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             143   2e-36   Capsella rubella
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45         142   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    143   2e-36   
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         142   2e-36   Camelina sativa [gold-of-pleasure]
gb|KHN08897.1|  Serine carboxypeptidase-like 45                         142   2e-36   Glycine soja [wild soybean]
ref|NP_001147904.1|  serine carboxypeptidase 1 precursor                142   2e-36   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            142   2e-36   Fragaria vesca subsp. vesca
ref|XP_011025504.1|  PREDICTED: serine carboxypeptidase-like 40 i...    142   2e-36   Populus euphratica
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             142   2e-36   
ref|XP_002893504.1|  SCPL45                                             142   2e-36   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45         142   2e-36   Solanum lycopersicum
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    142   2e-36   Solanum lycopersicum
ref|XP_012072734.1|  PREDICTED: serine carboxypeptidase-like 45 i...    142   2e-36   Jatropha curcas
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like    142   2e-36   Glycine max [soybeans]
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         142   2e-36   
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            142   3e-36   Solanum lycopersicum
ref|NP_564298.1|  serine carboxypeptidase-like 45                       142   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038111.1|  Serine carboxypeptidase-like 45 isoform 2          141   3e-36   
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative          142   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45         142   3e-36   
ref|NP_181121.1|  serine carboxypeptidase-like 26                       142   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          142   3e-36   
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         142   3e-36   Glycine soja [wild soybean]
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    142   3e-36   
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45         142   3e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT29573.1|  Serine carboxypeptidase-like 45                         142   3e-36   
emb|CDY61693.1|  BnaC05g51120D                                          142   3e-36   Brassica napus [oilseed rape]
ref|NP_001150705.1|  LOC100284338 precursor                             142   3e-36   
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45         142   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             141   4e-36   Capsella rubella
dbj|BAK01526.1|  predicted protein                                      142   4e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         141   4e-36   Populus euphratica
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                    141   4e-36   Morus notabilis
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    141   4e-36   Glycine max [soybeans]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            141   4e-36   Elaeis guineensis
emb|CDO99730.1|  unnamed protein product                                141   5e-36   Coffea canephora [robusta coffee]
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       141   5e-36   
ref|XP_007220730.1|  hypothetical protein PRUPE_ppa023387mg             137   5e-36   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       141   5e-36   
gb|KHN30342.1|  Serine carboxypeptidase-like 45                         136   5e-36   Glycine soja [wild soybean]
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    141   6e-36   Arabis alpina [alpine rockcress]
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         141   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...    141   6e-36   Glycine max [soybeans]
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like    141   6e-36   Cicer arietinum [garbanzo]
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          141   6e-36   
ref|XP_011626550.1|  PREDICTED: serine carboxypeptidase II-3            141   6e-36   Amborella trichopoda
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...    141   6e-36   Glycine max [soybeans]
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg             141   7e-36   Citrus clementina [clementine]
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    141   7e-36   
ref|NP_191213.1|  alpha/beta-Hydrolases superfamily protein             137   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            141   7e-36   Pyrus x bretschneideri [bai li]
gb|KHN09723.1|  Serine carboxypeptidase-like 45                         141   7e-36   Glycine soja [wild soybean]
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like    141   7e-36   Glycine max [soybeans]
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       141   7e-36   
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         141   7e-36   Camelina sativa [gold-of-pleasure]
gb|KDP31724.1|  hypothetical protein JCGZ_14937                         140   8e-36   Jatropha curcas
gb|AAO72592.1|  serine carboxypepsidase                                 140   8e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060508.1|  Os07g0656900                                       140   8e-36   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    141   8e-36   
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    141   8e-36   
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like    140   8e-36   
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45         140   8e-36   
ref|XP_008231545.1|  PREDICTED: serine carboxypeptidase-like 40         141   8e-36   
ref|XP_002876119.1|  predicted protein                                  141   9e-36   
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45         140   1e-35   
dbj|BAC16131.1|  putative serine carboxypeptidase II-3 precursor        141   1e-35   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         140   1e-35   
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             140   1e-35   
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             140   1e-35   
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            140   1e-35   
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    140   1e-35   
gb|EEC68261.1|  hypothetical protein OsI_36290                          140   1e-35   
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         140   1e-35   
ref|XP_006658912.1|  PREDICTED: serine carboxypeptidase II-3-like       140   1e-35   
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             140   1e-35   
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       140   1e-35   
emb|CDP08504.1|  unnamed protein product                                140   1e-35   
ref|XP_009794618.1|  PREDICTED: serine carboxypeptidase-like 26         140   1e-35   
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          140   2e-35   
ref|NP_001176565.1|  Os11g0522900                                       140   2e-35   
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40         140   2e-35   
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45         140   2e-35   
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                140   2e-35   
emb|CAN63486.1|  hypothetical protein VITISV_017087                     140   2e-35   
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                139   2e-35   
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45         139   2e-35   
ref|NP_001151474.1|  LOC100285107 precursor                             140   2e-35   
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                139   2e-35   
gb|ABR16719.1|  unknown                                                 139   2e-35   
dbj|BAJ94105.1|  predicted protein                                      140   2e-35   
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45         139   2e-35   
ref|NP_001147829.1|  LOC100281439 precursor                             140   2e-35   
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45         139   2e-35   
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg                140   2e-35   
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         139   2e-35   
gb|KEH37845.1|  serine carboxypeptidase-like protein                    139   2e-35   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g             139   2e-35   
ref|XP_006853081.2|  PREDICTED: serine carboxypeptidase II-3            140   2e-35   
emb|CDP08509.1|  unnamed protein product                                139   2e-35   
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                139   2e-35   
emb|CDY32091.1|  BnaC04g44750D                                          139   3e-35   
gb|ACN26414.1|  unknown                                                 140   3e-35   
ref|XP_004959516.1|  PREDICTED: serine carboxypeptidase II-3-like       139   3e-35   
emb|CDY40438.1|  BnaA04g20790D                                          139   3e-35   
ref|NP_567854.1|  serine carboxypeptidase-like 29                       139   3e-35   
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45         139   3e-35   
emb|CBI32446.3|  unnamed protein product                                139   3e-35   
ref|XP_002281988.1|  PREDICTED: serine carboxypeptidase II-3-like       139   3e-35   
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like    139   3e-35   
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...    139   3e-35   
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...    139   3e-35   
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             137   3e-35   
gb|KJB55516.1|  hypothetical protein B456_009G080300                    139   3e-35   
tpg|DAA41639.1|  TPA: serine carboxypeptidase 1                         139   3e-35   
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  137   3e-35   
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg                139   3e-35   
gb|KEH17669.1|  serine carboxypeptidase-like protein                    137   3e-35   
ref|XP_003592367.1|  Serine carboxypeptidase-like protein               139   3e-35   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       139   4e-35   
ref|XP_008357633.1|  PREDICTED: serine carboxypeptidase-like 45         136   4e-35   
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g             139   4e-35   
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g             139   4e-35   
ref|XP_006434837.1|  hypothetical protein CICLE_v10003343mg             138   4e-35   
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...    139   4e-35   
ref|XP_002876371.1|  predicted protein                                  139   4e-35   
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       139   4e-35   
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45         139   4e-35   
emb|CBI32795.3|  unnamed protein product                                138   4e-35   
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             139   4e-35   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         139   4e-35   
ref|XP_010279510.1|  PREDICTED: serine carboxypeptidase-like 40         139   5e-35   
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            139   5e-35   
ref|XP_010067798.1|  PREDICTED: serine carboxypeptidase-like 40         139   5e-35   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       139   5e-35   
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       138   5e-35   
ref|XP_006345491.1|  PREDICTED: serine carboxypeptidase-like 40-like    139   5e-35   
ref|XP_004959517.1|  PREDICTED: serine carboxypeptidase II-3-like       139   5e-35   
gb|AES71591.2|  serine carboxypeptidase-like protein                    139   5e-35   
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    138   6e-35   
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...    138   6e-35   
gb|KDO83297.1|  hypothetical protein CISIN_1g015244mg                   137   6e-35   
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45         138   6e-35   
ref|XP_008218862.1|  PREDICTED: serine carboxypeptidase-like 45         138   7e-35   
emb|CDP16360.1|  unnamed protein product                                138   7e-35   
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         138   7e-35   
ref|XP_006473888.1|  PREDICTED: serine carboxypeptidase-like 40-like    138   7e-35   
sp|P52711.1|CBP23_HORVU  RecName: Full=Serine carboxypeptidase II...    138   7e-35   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         138   7e-35   
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             136   7e-35   
ref|XP_008378990.1|  PREDICTED: serine carboxypeptidase-like 45         136   8e-35   
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45         138   8e-35   
emb|CDP16362.1|  unnamed protein product                                138   8e-35   
gb|KJB49314.1|  hypothetical protein B456_008G112500                    138   8e-35   
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg             137   8e-35   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       138   9e-35   
ref|XP_006423055.1|  hypothetical protein CICLE_v10028330mg             138   9e-35   
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       137   9e-35   
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         137   9e-35   
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            138   9e-35   
emb|CDP02851.1|  unnamed protein product                                138   9e-35   
ref|XP_001751694.1|  predicted protein                                  138   1e-34   
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like    137   1e-34   
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         137   1e-34   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            137   1e-34   
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45         137   1e-34   
ref|XP_007028221.1|  Serine carboxypeptidase 45                         137   1e-34   
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             137   1e-34   
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         137   1e-34   
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         137   1e-34   
ref|XP_009400122.1|  PREDICTED: serine carboxypeptidase II-3-like       137   1e-34   
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    137   1e-34   
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             137   1e-34   
ref|XP_006470494.1|  PREDICTED: serine carboxypeptidase-like 40-like    137   1e-34   
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            137   1e-34   
gb|KDO66312.1|  hypothetical protein CISIN_1g039871mg                   137   2e-34   
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    137   2e-34   
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             137   2e-34   
ref|XP_010055737.1|  PREDICTED: serine carboxypeptidase-like 45         137   2e-34   
ref|XP_010067819.1|  PREDICTED: serine carboxypeptidase-like 40         137   2e-34   
gb|KEH33266.1|  serine carboxypeptidase-like protein                    136   2e-34   
gb|ADE76785.1|  unknown                                                 133   2e-34   
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                137   2e-34   
gb|EMS58238.1|  Serine carboxypeptidase-like 45                         137   2e-34   
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            137   2e-34   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    137   2e-34   
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       137   2e-34   
ref|NP_001242846.1|  uncharacterized protein LOC100819443 precursor     137   2e-34   
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                137   2e-34   
ref|XP_009354385.1|  PREDICTED: serine carboxypeptidase-like 40         137   2e-34   
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       137   2e-34   
ref|NP_001169369.1|  uncharacterized protein LOC100383236 precursor     137   2e-34   
ref|XP_009392029.1|  PREDICTED: putative serine carboxypeptidase-...    137   2e-34   
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         136   2e-34   
ref|XP_004514571.1|  PREDICTED: serine carboxypeptidase-like 40-like    137   2e-34   
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         136   2e-34   
ref|XP_010324807.1|  PREDICTED: serine carboxypeptidase-like 40 i...    137   2e-34   
ref|XP_002271490.3|  PREDICTED: serine carboxypeptidase-like 40 i...    137   2e-34   
ref|XP_004231125.1|  PREDICTED: serine carboxypeptidase-like 40 i...    137   2e-34   
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         136   2e-34   
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...    136   2e-34   
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...    136   3e-34   
gb|KDO49122.1|  hypothetical protein CISIN_1g044068mg                   137   3e-34   
ref|XP_004238587.1|  PREDICTED: putative serine carboxypeptidase-...    136   3e-34   
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like    136   3e-34   
emb|CAN82217.1|  hypothetical protein VITISV_020424                     137   3e-34   
ref|XP_008363303.1|  PREDICTED: serine carboxypeptidase-like 40         137   3e-34   
ref|XP_012065630.1|  PREDICTED: serine carboxypeptidase-like 40         137   3e-34   
gb|KEH17668.1|  serine carboxypeptidase-like protein                    137   3e-34   
emb|CBI32445.3|  unnamed protein product                                136   3e-34   
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         136   3e-34   
emb|CDP16351.1|  unnamed protein product                                136   3e-34   
ref|XP_010315498.1|  PREDICTED: serine carboxypeptidase II-3-like       137   3e-34   
ref|XP_004488543.1|  PREDICTED: serine carboxypeptidase-like 45-like    137   3e-34   
ref|XP_006346529.1|  PREDICTED: serine carboxypeptidase II-3-like       136   3e-34   
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40         136   3e-34   
gb|KHG12237.1|  Serine carboxypeptidase-like 40                         136   3e-34   
ref|XP_009777076.1|  PREDICTED: putative serine carboxypeptidase-...    136   3e-34   
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    135   3e-34   
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             136   3e-34   
gb|KDP43595.1|  hypothetical protein JCGZ_16882                         136   3e-34   
ref|XP_012065708.1|  PREDICTED: serine carboxypeptidase-like 40         136   3e-34   
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    136   3e-34   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         136   3e-34   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       136   3e-34   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               136   3e-34   
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         136   3e-34   
gb|AAQ63884.1|  putative serine carboxypeptidase                        136   3e-34   
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              136   4e-34   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         136   4e-34   
ref|XP_004488374.1|  PREDICTED: serine carboxypeptidase-like 45-like    136   4e-34   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         136   4e-34   
emb|CDP19962.1|  unnamed protein product                                137   4e-34   
emb|CDP16358.1|  unnamed protein product                                136   4e-34   
gb|KHN30339.1|  Serine carboxypeptidase-like 45                         136   4e-34   
ref|XP_009590317.1|  PREDICTED: serine carboxypeptidase-like 26         136   4e-34   
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         136   4e-34   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       136   4e-34   
emb|CBI29056.3|  unnamed protein product                                136   4e-34   
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       136   4e-34   
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         136   4e-34   
emb|CDY13387.1|  BnaA03g51050D                                          136   4e-34   
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase II-2            136   4e-34   
ref|XP_008652807.1|  PREDICTED: serine carboxypeptidase-like 26         136   4e-34   
ref|XP_002285022.1|  PREDICTED: putative serine carboxypeptidase-...    136   4e-34   
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            136   4e-34   
emb|CDY23258.1|  BnaA08g12880D                                          136   4e-34   
tpg|DAA61817.1|  TPA: hypothetical protein ZEAMMB73_814931              136   5e-34   
ref|XP_008220190.1|  PREDICTED: serine carboxypeptidase II-3-like       136   5e-34   
gb|ABR16596.1|  unknown                                                 136   5e-34   
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               136   5e-34   
gb|ABR16997.1|  unknown                                                 136   5e-34   
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         135   5e-34   
gb|KJB24944.1|  hypothetical protein B456_004G169200                    135   5e-34   
ref|XP_006354958.1|  PREDICTED: serine carboxypeptidase-like 40-like    136   5e-34   
ref|XP_002528403.1|  serine carboxypeptidase, putative                  135   5e-34   
emb|CBI19568.3|  unnamed protein product                                139   5e-34   
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         136   5e-34   
ref|XP_003576614.1|  PREDICTED: serine carboxypeptidase II-3-like       135   5e-34   
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       136   5e-34   
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         135   5e-34   
emb|CDP01380.1|  unnamed protein product                                135   6e-34   
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         135   6e-34   
emb|CDP16361.1|  unnamed protein product                                135   6e-34   
ref|XP_011041420.1|  PREDICTED: serine carboxypeptidase-like 45         136   7e-34   
emb|CBI36578.3|  unnamed protein product                                135   7e-34   
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            135   7e-34   
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         135   7e-34   
ref|XP_004959513.1|  PREDICTED: serine carboxypeptidase-like 40-like    135   7e-34   
ref|XP_007131400.1|  hypothetical protein PHAVU_011G010600g             135   7e-34   
gb|EAZ09402.1|  hypothetical protein OsI_31676                          135   7e-34   
ref|XP_003559864.1|  PREDICTED: serine carboxypeptidase II-3-like       135   8e-34   
gb|KJB24943.1|  hypothetical protein B456_004G169200                    135   8e-34   
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         135   8e-34   
ref|XP_003557803.1|  PREDICTED: serine carboxypeptidase-like 27         135   9e-34   
ref|XP_010023699.1|  PREDICTED: serine carboxypeptidase-like 45         135   9e-34   
ref|XP_004985385.1|  PREDICTED: serine carboxypeptidase II-3-like       135   1e-33   
ref|XP_006657371.1|  PREDICTED: serine carboxypeptidase-like 34-like    135   1e-33   
ref|XP_012071557.1|  PREDICTED: serine carboxypeptidase II-2-like       135   1e-33   



>ref|XP_006431097.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
 gb|ESR44337.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
Length=477

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQPS+VSF Q+SGYIVTD   GRALFYYFA AQS D LS PLTLWL GG  C
Sbjct  19   AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G+F EHGPF+P ++GKL+KN YSWNL SNMLYVD+PI V YS+SNT+SDY+ W D
Sbjct  79   SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL+F+  WF  F +Y++ +F++AG
Sbjct  139  AATAEDNLRFIVNWFKEFPQYKDSEFFLAG  168



>gb|KDO72510.1| hypothetical protein CISIN_1g039529mg [Citrus sinensis]
Length=477

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQPS+VSF Q+SGYIVTD   GRALFYYFA AQS D LS PLTLWL GG  C
Sbjct  19   AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G+F EHGPF+P ++GKL+KN YSWNL SNMLYVD+PI V YS+SNT+SDY+ W D
Sbjct  79   SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL+F+  WF  F +Y++ +F++AG
Sbjct  139  AATAEDNLRFIVNWFKEFPQYKDSEFFLAG  168



>ref|XP_006482672.1| PREDICTED: serine carboxypeptidase-like 46-like [Citrus sinensis]
Length=477

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQPS+VSF Q+SGYIVTD   GRALFYYFA AQS D LS PLTLWL GG  C
Sbjct  19   AELIKALPGQPSNVSFNQYSGYIVTDAEHGRALFYYFAEAQSPDHLSLPLTLWLNGGPGC  78

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G+F EHGPF+P ++GKL+KN YSWNL SNMLYVD+PI V YS+SNT+SDY+ W D
Sbjct  79   SSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVDSPIGVGYSYSNTSSDYKLWND  138

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL+F+  WF  F +Y++ +F++AG
Sbjct  139  AATAEDNLRFIVNWFKEFPQYKDSEFFLAG  168



>ref|XP_004228389.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=490

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            E+I SLPGQP ++ F Q SGYIVT+   GRALFYYF  A SE+  S PLTLWL GG  CS
Sbjct  20   ELITSLPGQPPNIFFKQHSGYIVTNSQNGRALFYYFVEADSENATSLPLTLWLNGGPGCS  79

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G+F EHGPF+P KDG+L+KN YSWNL SNMLYV++PI V +S+SNT+SDY  W D 
Sbjct  80   SVGFGVFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVESPIGVGFSYSNTSSDYVNWDDV  139

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA ENL+FL  W  +F EYRNLD ++AG
Sbjct  140  ATAKENLQFLLNWLEKFPEYRNLDLFLAG  168



>ref|XP_009627244.1| PREDICTED: serine carboxypeptidase-like 46 [Nicotiana tomentosiformis]
Length=479

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I SLPGQP ++ F Q+SGYIVT+   GRALFYYF  A SE+  S PLT+WL GG  C
Sbjct  21   AELITSLPGQPPNIFFKQYSGYIVTNAQHGRALFYYFVDADSENAASLPLTVWLNGGPGC  80

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F EHGPF+P  DG L+KN YSWNLVSNMLYV++PI V +S+SNT+SDY  W D
Sbjct  81   SSVGFGAFMEHGPFQPRIDGSLIKNKYSWNLVSNMLYVESPIGVGFSYSNTSSDYTNWDD  140

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA ENL+F+  WF +F +YRN D Y+AG
Sbjct  141  TATAKENLQFILNWFKKFPQYRNSDVYLAG  170



>ref|XP_009762845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=486

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 116/167 (69%), Gaps = 2/167 (1%)
 Frame = +1

Query  85   WFLLVNTLCSI-SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            WF ++    S    + + E+I SLPGQP ++ F Q+SGYIVT+   GRALFYYF  A SE
Sbjct  4    WFYVITIFSSFFYYKSSAELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSE  63

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            +  S PLTLWL GG  CS    G F EHGPF+P  DG L+KN YSWNLVSNMLYV++PI 
Sbjct  64   NAASLPLTLWLNGGPGCSSVGFGAFMEHGPFQPGIDGNLMKNKYSWNLVSNMLYVESPIG  123

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+SNT+SDY  W D  TA ENL+F+  WF +F +YRN D Y+AG
Sbjct  124  VGFSYSNTSSDYINWDDTATAKENLQFILNWFKKFPQYRNSDVYLAG  170



>ref|XP_006363923.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=480

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 116/172 (67%), Gaps = 9/172 (5%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            + +F+ + L   + C        E+I SLPGQP ++ F Q+SGYIVT+   GR+LFYYF 
Sbjct  5    LCIFVSYLLFYKSSC--------ELITSLPGQPPNIFFKQYSGYIVTNSQHGRSLFYYFV  56

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A SE+  S PLTLWL GG  CS    G F EHGPFRP KDG L+KN +SWNL SNMLYV
Sbjct  57   EADSENAASLPLTLWLNGGPGCSSVGYGAFMEHGPFRPGKDGSLIKNNFSWNLESNMLYV  116

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D+PI V +S+SNT+SD+  W D  TA ENL+F+ KWF +F  YRN D Y+ G
Sbjct  117  DSPIGVGFSYSNTSSDHINWDDTATAKENLQFILKWFKKFPRYRNSDVYLTG  168



>ref|XP_006363922.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=496

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            E+I SLPGQP ++ F Q+SGYI+T+   GR+LFYYF  A SE+  S PLTLWL GG  CS
Sbjct  23   ELITSLPGQPPNIIFKQYSGYIITNSQHGRSLFYYFVEADSENATSLPLTLWLNGGPGCS  82

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPF+P KDG+L+KN YSWNL SNMLYV++PI V +S+SNT+SDY  W D 
Sbjct  83   SVGFGAFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVESPIGVGFSYSNTSSDYTNWDDV  142

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA ENL+F+  W  +F EY+N + ++AG
Sbjct  143  ATAKENLQFILNWLEKFPEYKNSELFLAG  171



>ref|XP_006363924.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=493

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            E+I SLPGQP ++ F Q+SGYIVT+   GR+LFYYF  A SE+  S PLTLWL GG  CS
Sbjct  20   ELITSLPGQPPNIFFKQYSGYIVTNSQHGRSLFYYFVEADSENATSLPLTLWLNGGPGCS  79

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPF+P KDG+L+KN YSWNL SNMLY+++PI V +S+SNT+SDY  W D 
Sbjct  80   SVGFGAFKEHGPFQPGKDGRLIKNKYSWNLESNMLYIESPIRVGFSYSNTSSDYTNWDDV  139

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA ENL+F+  W  +F EY+N + ++AG
Sbjct  140  ATAKENLQFILNWLEKFPEYKNSELFLAG  168



>ref|XP_004228838.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            E+I SLPGQP ++ F Q+SGYIVT+   GRALFYYF  A SE+  S PLT+WL G   CS
Sbjct  22   ELITSLPGQPPNIFFKQYSGYIVTNSQHGRALFYYFVEADSENAASLPLTIWLNGAPGCS  81

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPF+P KDG+L+KN +SWNL SNMLYVD+PI V +S+SNT+SD   W D 
Sbjct  82   SLGYGAFMEHGPFQPGKDGRLIKNNFSWNLESNMLYVDSPIGVGFSYSNTSSDNINWDDT  141

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA ENL+F+ KWF +F +YRN D Y+ G
Sbjct  142  ATAKENLQFILKWFKKFPQYRNSDVYLTG  170



>ref|XP_006431096.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
 gb|ESR44336.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
Length=473

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQP++V F Q+SGYI+TD + GRALFYYF  AQS + LS PLTLWL GG  C
Sbjct  18   AELISALPGQPNNVPFKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGC  77

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F EHGPF+P ++G+L+KN YSWNL SNMLYV++PI V +S+SNT+SDY  W D
Sbjct  78   SSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWND  137

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL+F+  W   F +Y++ +F++ G
Sbjct  138  SNTAGDNLRFIVNWLEEFPQYKDSEFFLTG  167



>ref|XP_010068797.1| PREDICTED: serine carboxypeptidase-like 46 [Eucalyptus grandis]
Length=481

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = +1

Query  76   FLLWF--LLVNTLCSI--SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYF  243
             ++W+  ++VN +  +  S     E+I  LPGQP  VSF Q SGYI TD  RG ALFYYF
Sbjct  1    MMIWYFIVIVNGVIPLFSSCTSTAELIKKLPGQPDGVSFKQHSGYITTDPRRGHALFYYF  60

Query  244  AGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLY  423
              A + D LS PLTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLY
Sbjct  61   VEADARDPLSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  424  VDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V++PI V +S+SNTTSDY  W D +TA  N++FL  W+  + EYR+ D Y++G
Sbjct  121  VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSG  173



>ref|XP_010068798.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = +1

Query  76   FLLWF--LLVNTLCSI--SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYF  243
             ++W+  ++VN +  +  S     E+I  LPGQP  VSF Q SGYIVTD  RG ALFYYF
Sbjct  1    MMIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYF  60

Query  244  AGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLY  423
              A + D  S PLTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLY
Sbjct  61   VEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  424  VDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V++PI V +S+SNTTSDY  W D +TA  N++FL  W+  + EYR+ D Y++G
Sbjct  121  VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSG  173



>gb|KCW64996.1| hypothetical protein EUGRSUZ_G02538 [Eucalyptus grandis]
Length=480

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 113/172 (66%), Gaps = 5/172 (3%)
 Frame = +1

Query  79   LLWF--LLVNTLCSI--SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++W+  ++VN +  +  S     E+I  LPGQP  VSF Q SGYIVTD  RG ALFYYF 
Sbjct  1    MIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYFV  60

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A + D  S PLTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV
Sbjct  61   EADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYV  120

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++PI V +S+SNTTSDY  W D +TA  N++FL  W+  + EYR+ D Y++G
Sbjct  121  ESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSG  172



>ref|XP_010068795.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = +1

Query  76   FLLWF--LLVNTLCSI--SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYF  243
             ++W+  ++VN +  +  S     E+I  LPGQP  VSF Q SGYIVTD  RG ALFYYF
Sbjct  1    MMIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYF  60

Query  244  AGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLY  423
              A + D  S PLTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLY
Sbjct  61   VEADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLY  120

Query  424  VDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V++PI V +S+SNTTSDY  W D +TA  N++FL  W+  + EYR+ D Y++G
Sbjct  121  VESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSG  173



>gb|KCW64994.1| hypothetical protein EUGRSUZ_G02536 [Eucalyptus grandis]
Length=480

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 113/172 (66%), Gaps = 5/172 (3%)
 Frame = +1

Query  79   LLWF--LLVNTLCSI--SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++W+  ++VN +  +  S     E+I  LPGQP  VSF Q SGYIVTD  RG ALFYYF 
Sbjct  1    MIWYFIVIVNGVIPLFFSSTSTAELIKKLPGQPDGVSFKQHSGYIVTDPRRGHALFYYFV  60

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A + D  S PLTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV
Sbjct  61   EADARDPSSYPLTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYV  120

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++PI V +S+SNTTSDY  W D +TA  N++FL  W+  + EYR+ D Y++G
Sbjct  121  ESPIGVGFSYSNTTSDYVNWTDADTARANMQFLLGWYKEYPEYRDSDLYLSG  172



>gb|KDO72509.1| hypothetical protein CISIN_1g037032mg [Citrus sinensis]
Length=473

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQP++V   Q+SGYI+TD + GRALFYYF  AQS + LS PLTLWL GG  C
Sbjct  18   AELISALPGQPNNVPVKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGC  77

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F EHGPF+P ++G+L+KN YSWNL SNMLYV++PI V +S+SNT+SDY  W D
Sbjct  78   SSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWND  137

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL+F+  W   F +Y++ +F++ G
Sbjct  138  SNTAGDNLRFIVNWLEEFPQYKDSEFFLTG  167



>gb|KHG07552.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=476

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +1

Query  109  CSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTL  288
            CS S     E+I +LPGQP++V F Q+SGYI+     GRALFYYF  A S + L+ PLTL
Sbjct  16   CSASC----EVIKALPGQPANVGFKQYSGYILVQPQHGRALFYYFVEADSANPLANPLTL  71

Query  289  WLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTT  465
            WL GG  CS    G F EHGPF+P +DG LVKN YSWNL SNMLY+++PI V +S+SNT+
Sbjct  72   WLNGGPGCSSLGFGAFMEHGPFQPREDGHLVKNQYSWNLESNMLYLESPIGVGFSYSNTS  131

Query  466  SDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            SDY    D  TA +N++FL  WF  F +YRN D Y++G
Sbjct  132  SDYLGLNDATTAKDNMQFLLNWFEEFPQYRNSDLYLSG  169



>ref|XP_006482671.1| PREDICTED: serine carboxypeptidase-like 44-like [Citrus sinensis]
Length=552

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            E+I +LPGQP++V   Q+SGYI+TD + GRALFYYF  AQS + LS PLTLWL GG  CS
Sbjct  19   ELISALPGQPNNVPVKQYSGYILTDANHGRALFYYFVEAQSTNPLSLPLTLWLNGGPGCS  78

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPF+P ++G+L+KN YSWNL SNMLYV++PI V +S+SNT+SDY  W D 
Sbjct  79   SLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVESPIGVGFSYSNTSSDYNLWNDS  138

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL+F+  W   F +Y++ +F++ G
Sbjct  139  NTAGDNLRFIVNWLEEFPQYKDSEFFLTG  167



>ref|XP_010265020.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=474

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            + +LPGQP+ VSF Q+SGYIVTD + GRALFYY   A S   LS+PLTLWL GG  CS  
Sbjct  27   VTTLPGQPTHVSFKQYSGYIVTDAAHGRALFYYLVEADSAHPLSRPLTLWLNGGPGCSSV  86

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
              G+  EHGPF+P  +  L KN YSWNL SNMLYVD+PI V +S+SNT+SDY ++ D  T
Sbjct  87   GFGVLMEHGPFQPKDNRLLAKNKYSWNLESNMLYVDSPIGVGFSYSNTSSDYTSYNDTTT  146

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NLKFL  W  +F +Y+N D Y+AG
Sbjct  147  AEDNLKFLLNWLEKFPKYKNSDLYLAG  173



>ref|XP_007046207.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY02039.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=478

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  124  RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGG  303
            + + E+I  LP QP++V F Q+SGYIVTD   GRALFYYF    + D L  PLTLWL GG
Sbjct  14   KASAELITRLPSQPANVGFKQYSGYIVTDAKHGRALFYYFVEVDAADPLLHPLTLWLNGG  73

Query  304  HDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQA  480
              CS    G F EHGPF+P +DG LVKN YSWNL SNMLYV++PI V +S+SNT+SDY  
Sbjct  74   PGCSSLGYGAFMEHGPFQPGEDGFLVKNQYSWNLESNMLYVESPIGVGFSYSNTSSDYIG  133

Query  481  WCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              D  TA ENL+FL  WF  F +YRN D Y+ G
Sbjct  134  VNDTFTAEENLQFLVNWFKEFPQYRNSDLYLTG  166



>ref|XP_011629134.1| PREDICTED: serine carboxypeptidase-like 45, partial [Amborella 
trichopoda]
Length=421

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +1

Query  121  IRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGG  300
            I  N ++I  LPGQP + SF Q+SGY++TD + GRALFYYF  A + D +S+PLTLWL G
Sbjct  19   IPFNSDLITQLPGQPPNSSFKQYSGYVLTDTNHGRALFYYFVEADAHDSISRPLTLWLNG  78

Query  301  GHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQ  477
            G  CS    G F EHGPF+P  +  L+ N YSWNL SN+LYV++PI V +S+SNT+SDY 
Sbjct  79   GPGCSSLGFGAFMEHGPFQPGDNFTLIHNKYSWNLESNVLYVESPIGVGFSYSNTSSDYI  138

Query  478  AWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             W D  TA +NL+FL  WF +F  YR+ D Y+ G
Sbjct  139  HWNDTTTAKDNLRFLINWFEKFPAYRDSDLYLTG  172



>gb|ERM96771.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
Length=442

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +1

Query  121  IRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGG  300
            I  N ++I  LPGQP + SF Q+SGY++TD + GRALFYYF  A + D +S+PLTLWL G
Sbjct  19   IPFNSDLITQLPGQPPNSSFKQYSGYVLTDTNHGRALFYYFVEADAHDSISRPLTLWLNG  78

Query  301  GHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQ  477
            G  CS    G F EHGPF+P  +  L+ N YSWNL SN+LYV++PI V +S+SNT+SDY 
Sbjct  79   GPGCSSLGFGAFMEHGPFQPGDNFTLIHNKYSWNLESNVLYVESPIGVGFSYSNTSSDYI  138

Query  478  AWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             W D  TA +NL+FL  WF +F  YR+ D Y+ G
Sbjct  139  HWNDTTTAKDNLRFLINWFEKFPAYRDSDLYLTG  172



>ref|XP_007046209.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
 gb|EOY02041.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
Length=401

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 118/179 (66%), Gaps = 11/179 (6%)
 Frame = +1

Query  64   KIMVFLLWFLLVNTL------CSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGR  225
            K M FLL F +++        CS S     E+I +LPGQP++V+F Q+SGYIVT+   GR
Sbjct  3    KRMRFLLAFRVISCFFLFFFFCSAS----AELIKALPGQPANVTFKQYSGYIVTEPKHGR  58

Query  226  ALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNL  405
            ALFYYF    S +    PLTLWL GG  CS    G F EHGPF+P ++G L+KN YSWNL
Sbjct  59   ALFYYFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNL  118

Query  406  VSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             SNMLY+++PI V +S+SNT+SDY    D  TA ENL F+  WF +F +YR+ D Y++G
Sbjct  119  ESNMLYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSG  177



>ref|XP_007046208.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
 gb|EOY02040.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
Length=488

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 118/179 (66%), Gaps = 11/179 (6%)
 Frame = +1

Query  64   KIMVFLLWFLLVN------TLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGR  225
            K M FLL F +++        CS S     E+I +LPGQP++V+F Q+SGYIVT+   GR
Sbjct  3    KRMRFLLAFRVISCFFLFFFFCSAS----AELIKALPGQPANVTFKQYSGYIVTEPKHGR  58

Query  226  ALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNL  405
            ALFYYF    S +    PLTLWL GG  CS    G F EHGPF+P ++G L+KN YSWNL
Sbjct  59   ALFYYFVEVDSANPGLHPLTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNL  118

Query  406  VSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             SNMLY+++PI V +S+SNT+SDY    D  TA ENL F+  WF +F +YR+ D Y++G
Sbjct  119  ESNMLYLESPIGVGFSYSNTSSDYLGVNDTITAGENLIFILNWFKKFPQYRDSDLYLSG  177



>ref|XP_010256545.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=471

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
            GE+   LPGQP+ VSF Q+SGYIVTD + GRALFYYF  A S   LS+PLTLWL GG  C
Sbjct  23   GELATILPGQPTHVSFKQYSGYIVTDAAHGRALFYYFVEADSAHPLSRPLTLWLSGGPGC  82

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F E+GPF+    G L KN YSWNL SNMLYV++PI V +S+SNT+ DY +W D
Sbjct  83   SSLGEGAFTENGPFQSKDSGHLAKNIYSWNLESNMLYVESPIGVGFSYSNTSLDYISWND  142

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NLKFL  W  +F +Y++ D Y+AG
Sbjct  143  TTTAEDNLKFLLNWLEKFPKYKHSDLYLAG  172



>ref|XP_003633850.1| PREDICTED: serine carboxypeptidase-like 46 [Vitis vinifera]
 emb|CBI22165.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 122/183 (67%), Gaps = 14/183 (8%)
 Frame = +1

Query  34   AFTFIIDIIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDK  213
            A  FI+++I  + +F L+F           +   E+I SLPGQP++VSF Q++GYIVTD 
Sbjct  2    ASGFILEVIS-LFLFFLYF-----------KSFAELITSLPGQPANVSFKQYAGYIVTDA  49

Query  214  SRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPY  393
              GRALFYYF  A++ D LS+PLTLW  GG  CS    G F E+GPF+P ++G LVKN +
Sbjct  50   RHGRALFYYFVEAKTADPLSRPLTLWFNGGPGCSSLGFGAFMENGPFQPGENGILVKNKH  109

Query  394  SWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFY  570
            SWNL SNMLYV++PI V +S+SNT+SDY  W D  TA +NL+F+  W   F  Y++ + +
Sbjct  110  SWNLESNMLYVESPIGVGFSYSNTSSDY-FWNDTRTAEDNLRFVINWLEEFPNYKDSELF  168

Query  571  IAG  579
            + G
Sbjct  169  LTG  171



>gb|KJB11409.1| hypothetical protein B456_001G257100 [Gossypium raimondii]
Length=420

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  124  RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGG  303
            ++  E+I SLPGQ   +SF Q+SGYIVTD   GRALFYYF    S +++  PLTLWL GG
Sbjct  16   KVRSELIPSLPGQHGHLSFRQYSGYIVTDAEHGRALFYYFVECSSNEDVLHPLTLWLNGG  75

Query  304  HDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQA  480
              CS    G F E+GPF+P ++G L+KNPYSWN+ S+MLY+++PI V +S+SNT+ DY  
Sbjct  76   PGCSSLGFGAFMENGPFQPGENGTLIKNPYSWNIESHMLYLESPIGVGFSYSNTSKDYID  135

Query  481  WCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            W D +TA +N +F+ KW   F ++++ DF++AG
Sbjct  136  WNDTQTAEDNYRFILKWLEEFPQFKDCDFFLAG  168



>ref|XP_007099702.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY20317.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=475

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 2/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I  LPGQ  +VSF Q+SGYIVTD   GRALFYYF  A S  +  KPLTLWL GG  C
Sbjct  19   AELIHFLPGQHKNVSFNQYSGYIVTDARHGRALFYYFVEADSNTDELKPLTLWLNGGPGC  78

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F EHGPF+P +DG L+KN YSWNL SNMLYV++PI V +S+SNT+ +Y  W D
Sbjct  79   SSLGFGAFMEHGPFQPGEDGTLIKNEYSWNLESNMLYVESPIGVGFSYSNTSKNY-LWND  137

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +NL F+  W   F +Y+  DF++AG
Sbjct  138  TQTAQDNLMFILNWLEEFPQYKESDFFLAG  167



>ref|XP_006838780.1| PREDICTED: serine carboxypeptidase-like 45 [Amborella trichopoda]
 gb|ERN01349.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
Length=478

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +1

Query  127  INGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGH  306
            ++ ++I  LPGQP + SF Q+SGYIVTD   GRALFYYF  A +    S+PLTLWL GG 
Sbjct  26   LHPDLIKRLPGQPPNPSFNQYSGYIVTDTHHGRALFYYFVEADTHHRASRPLTLWLNGGP  85

Query  307  DCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAW  483
             CS   +G   EHGP+    +  LV N YSWNL SNMLYV++PI V +S+SNT+SDY  W
Sbjct  86   GCSSLGIGALMEHGPYLVHDNSSLVNNKYSWNLASNMLYVESPIGVGFSYSNTSSDYINW  145

Query  484  CDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             D +TA +NL+FL  WF +F  YR  D Y+ G
Sbjct  146  NDTKTAEDNLRFLINWFEKFPAYRGSDLYLTG  177



>ref|XP_002277201.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Vitis 
vinifera]
Length=479

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQP++VSF Q+SGYI TD   GRALFYYF  A++   LS+PLTLWL GG  C
Sbjct  23   AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLTLWLNGGPGC  82

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F E+GPF+P ++G LVKN +SWN+ SNMLYV++PI V +S+SNT+S+Y  W D
Sbjct  83   SSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNTSSNY-FWND  141

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL+F+  WF  F  Y++ + ++ G
Sbjct  142  TRTAEDNLRFIVNWFEEFPYYKDSELFLTG  171



>emb|CBI22166.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQP++VSF Q+SGYI TD   GRALFYYF  A++   LS+PLTLWL GG  C
Sbjct  94   AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLTLWLNGGPGC  153

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F E+GPF+P ++G LVKN +SWN+ SNMLYV++PI V +S+SNT+S+Y  W D
Sbjct  154  SSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNTSSNY-FWND  212

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL+F+  WF  F  Y++ + ++ G
Sbjct  213  TRTAEDNLRFIVNWFEEFPYYKDSELFLTG  242



>ref|XP_007162064.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
 gb|ESW34058.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
Length=459

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 108/171 (63%), Gaps = 3/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  +  +LV TL S+S     + I SLPGQP  V F Q+SGYI  D    RALFYYF  
Sbjct  8    MIATIIIVLVQTLVSVSSLPEADKISSLPGQP-HVKFQQYSGYITVDDQHQRALFYYFVE  66

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            AQ +D  SKP+ LWL GG  CS   VG   EHGPF+P     LVKN YSWN V+N+LY++
Sbjct  67   AQ-KDPTSKPVVLWLNGGPGCSSIGVGALIEHGPFKPRDSNVLVKNHYSWNKVANVLYLE  125

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S+ TS Y    D  TA +NL FL++WF+ F EY N DF+I G
Sbjct  126  SPAGVGFSYSSNTSFYTLVTDEITARDNLVFLQRWFIEFPEYSNNDFFITG  176



>ref|XP_010661029.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Vitis 
vinifera]
Length=481

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 4/152 (3%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             E+I +LPGQP++VSF Q+SGYI TD   GRALFYYF  A++   LS+PLTLWL GG  C
Sbjct  23   AELITALPGQPANVSFKQYSGYIATDDQHGRALFYYFVEAETAHPLSRPLTLWLNGGPGC  82

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F E+GPF+P ++G LVKN +SWN+ SNMLYV++PI V +S+SNT+S+Y  W D
Sbjct  83   SSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVESPIGVGFSYSNTSSNY-FWND  141

Query  490  FET--AYENLKFLRKWFLRFYEYRNLDFYIAG  579
              T  A +NL+F+  WF  F  Y++ + ++ G
Sbjct  142  TRTVAAEDNLRFIVNWFEEFPYYKDSELFLTG  173



>emb|CAJ91147.1| serine carboxypeptidase II [Platanus x acerifolia]
Length=252

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 4/153 (3%)
 Frame = +1

Query  124  RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGG  303
             +  + I+ LPGQP  VSF QFSGYI  D+ + RALFYYF  A+ +D  SKPL LWL GG
Sbjct  31   HLEADRINKLPGQP-QVSFQQFSGYITVDERKQRALFYYFVEAE-KDPASKPLVLWLNGG  88

Query  304  HDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQA  480
              CS   VG F EHGPFRP+ +  L++N YSWN  +NMLY++TP  V +S+S  TS Y+A
Sbjct  89   PGCSSIGVGAFSEHGPFRPSGE-ILIRNEYSWNKEANMLYLETPAGVGFSYSTNTSFYKA  147

Query  481  WCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              D  TA +NL FL++WF++F  Y++ D ++AG
Sbjct  148  VDDEITAKDNLVFLQRWFIKFPLYKDRDLFLAG  180



>gb|KHN08898.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=453

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++  ++  +L  TL  +      + I +LPGQP  V F Q+SGY+  D    RALFYYF 
Sbjct  1    MIATIIIIVLAQTLVGVISLPEADKISNLPGQP-QVEFQQYSGYVTVDDQHQRALFYYFV  59

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+ ED  SKPL LWL GG  CS   VG F EHGPFRP+ +  L +N YSWN V+N+LY+
Sbjct  60   EAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKVANVLYL  118

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S+  S Y +  D  TA +NL FL++WF +F EY N DF+I G
Sbjct  119  ESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFFITG  170



>gb|KJB40058.1| hypothetical protein B456_007G044700 [Gossypium raimondii]
Length=315

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 110/172 (64%), Gaps = 9/172 (5%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            +++  LWF + ++L       + + I  LPGQP  +SF QFSGY+  D  + +ALFYYF 
Sbjct  13   LLLIELWFTIESSLA------HPDKIVKLPGQPPRLSFQQFSGYVTVDYKKHKALFYYFV  66

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +  LVKN YSWN  +NMLY+
Sbjct  67   EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LVKNDYSWNREANMLYL  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +TPI V +S+S  TS Y+A  D  TA +NL FL+ W+ +F  YR+ D YI G
Sbjct  125  ETPIGVGFSYSTNTSSYEAVDDEITARDNLVFLQNWYNKFPNYRHRDLYITG  176



>ref|XP_003554110.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++  ++  +L  TL  +      + I +LPGQP  V F Q+SGY+  D    RALFYYF 
Sbjct  10   MIATIIIIVLAQTLVGVISLPEADKISNLPGQP-QVEFQQYSGYVTVDDQHQRALFYYFV  68

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+ ED  SKPL LWL GG  CS   VG F EHGPFRP+ +  L +N YSWN V+N+LY+
Sbjct  69   EAE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKVANVLYL  127

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S+  S Y +  D  TA +NL FL++WF +F EY N DF+I G
Sbjct  128  ESPAGVGFSYSSNKSFYASVTDEITARDNLVFLQRWFTKFPEYSNNDFFITG  179



>ref|XP_007162065.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
 gb|ESW34059.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
Length=459

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 106/171 (62%), Gaps = 3/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  +  +L  TL  +S     + I +LPGQP  V F Q+SG+I  D    RALFYYF  
Sbjct  8    MIATIIIVLAQTLVGVSSLPESDQISNLPGQP-QVKFQQYSGHITVDDQHQRALFYYFVE  66

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+ ED  SKPL LWL GG  CS   VG F EHGPFRP+ +  L KN YSWN  +N+LY++
Sbjct  67   AE-EDPASKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEKNDYSWNKEANVLYLE  125

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S+  S Y    D  TA +NL FL++WF +F EY N DF+I G
Sbjct  126  SPAGVGFSYSSNKSFYILVTDEITARDNLVFLQRWFTKFPEYSNNDFFITG  176



>ref|XP_012088729.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
 ref|XP_012088730.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
 gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = +1

Query  49   IDIIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRA  228
            I+++   MV L     +  +C   +    + I  LPGQP  V F Q+SGY++ D    RA
Sbjct  6    IEVMALAMVLLQLCFFMKVVCHPFLF---DRITQLPGQP-QVGFQQYSGYVIVDNKEQRA  61

Query  229  LFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLV  408
            LFYYFA A++ D  SKPL LWL GG  CS   VG F E+GPFRP+ +  LVKN +SWN  
Sbjct  62   LFYYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNQHSWNRE  119

Query  409  SNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +NMLY++TPI V +S+S  TS Y+   D  TA +NL FL+KWF++F +YRN   +I+G
Sbjct  120  ANMLYLETPIGVGFSYSTDTSSYETVNDKITARDNLVFLQKWFIKFPQYRNRSLFISG  177



>gb|KJB40057.1| hypothetical protein B456_007G044700 [Gossypium raimondii]
Length=374

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 110/172 (64%), Gaps = 9/172 (5%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            +++  LWF + ++L       + + I  LPGQP  +SF QFSGY+  D  + +ALFYYF 
Sbjct  13   LLLIELWFTIESSLA------HPDKIVKLPGQPPRLSFQQFSGYVTVDYKKHKALFYYFV  66

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +  LVKN YSWN  +NMLY+
Sbjct  67   EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LVKNDYSWNREANMLYL  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +TPI V +S+S  TS Y+A  D  TA +NL FL+ W+ +F  YR+ D YI G
Sbjct  125  ETPIGVGFSYSTNTSSYEAVDDEITARDNLVFLQNWYNKFPNYRHRDLYITG  176



>ref|XP_003520484.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 103/171 (60%), Gaps = 3/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  L  +L  TL  +S     + I +LPGQP  V F Q+SGY+  D    RALFYYF  
Sbjct  10   MIATLIIVLAQTLVGVSSLPEADKIINLPGQPK-VKFQQYSGYVTVDDQHQRALFYYFVE  68

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+ ED  SKPL LWL GG  CS    G F EHGPFRP+ +  L KN YSWN  +NMLY++
Sbjct  69   AE-EDPSSKPLVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  127

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S   S Y    D  TA +NL FL++WF +F EY   DF+I G
Sbjct  128  SPAGVGFSYSRNKSFYALVTDEITARDNLLFLQRWFTKFPEYSKRDFFITG  178



>gb|KHN30341.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=459

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 103/171 (60%), Gaps = 3/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  L  +L  TL  +S     + I +LPGQP  V F Q+SGY+  D    RALFYYF  
Sbjct  8    MIATLIIVLAQTLVGVSSLPEADKIINLPGQPK-VKFLQYSGYVTVDDQHQRALFYYFVE  66

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+ ED  SKPL LWL GG  CS    G F EHGPFRP+ +  L KN YSWN  +NMLY++
Sbjct  67   AE-EDPSSKPLVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  125

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S   S Y    D  TA +NL FL++WF +F EY   DF+I G
Sbjct  126  SPAGVGFSYSRNKSFYALVTDEITARDNLVFLQRWFTKFPEYSKRDFFITG  176



>ref|XP_006495375.1| PREDICTED: serine carboxypeptidase-like 45-like, partial [Citrus 
sinensis]
Length=302

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            +L++    I +     ++D   +LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ 
Sbjct  14   ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            D  SKPL LWL GG  CS   VG F E+GPFRP     LV+N YSWN  +NML+++TPI 
Sbjct  72   DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLETPIG  130

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S   S YQ   D  TA +NL FL+ WFL+F +YRN   +I G
Sbjct  131  VGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITG  177



>gb|KDO83183.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=311

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            +L++    I +     ++D   +LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ 
Sbjct  14   ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            D  SKPL LWL GG  CS   VG F E+GPFRP     LV+N YSWN  +NML+++TPI 
Sbjct  72   DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLETPIG  130

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S   S YQ   D  TA +NL FL+ WFL+F +YRN   +I G
Sbjct  131  VGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITG  177



>ref|XP_006380972.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58769.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=467

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 107/175 (61%), Gaps = 7/175 (4%)
 Frame = +1

Query  58   IKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFY  237
            I+  M   L FL   T       +  + I  LPGQP  VSF QFSGYI  D+ + R+LFY
Sbjct  5    IQAWMAIALIFLCSRT----ESLLEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFY  59

Query  238  YFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNM  417
            YF  A++    SKPL LWL GG  CS   VG F EHGPFRPT    LV+N YSWN  +NM
Sbjct  60   YFVEAETSPA-SKPLVLWLNGGPGCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANM  118

Query  418  LYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            LY+++P  V +S+S   + Y    D  TA +NL FLR+WF++F +Y+  DF+IAG
Sbjct  119  LYLESPAGVGFSYSANQTFYSYVNDEMTARDNLVFLRRWFVKFPQYKQRDFFIAG  173



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 110/176 (63%), Gaps = 7/176 (4%)
 Frame = +1

Query  55   IIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            II      L  F  +    S+S+    + I  LPGQP  VSF QFSGY+  D  R R LF
Sbjct  43   IIATATALLQLFQFMGIAASLSL---SDRITELPGQP-QVSFQQFSGYVTVDDKRRRDLF  98

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            YYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +N
Sbjct  99   YYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNREAN  156

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY++TP+ V +S+S  TS Y A  D  TA +NL FL++WFL+F +Y++ D +I G
Sbjct  157  MLYLETPVGVGFSYSTDTSSYVAVDDKITARDNLVFLQRWFLKFPQYKHKDLFITG  212



>ref|XP_006380973.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58770.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=478

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 107/175 (61%), Gaps = 7/175 (4%)
 Frame = +1

Query  58   IKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFY  237
            I+  M   L FL   T       +  + I  LPGQP  VSF QFSGYI  D+ + R+LFY
Sbjct  5    IQAWMAIALIFLCSRT----ESLLEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFY  59

Query  238  YFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNM  417
            YF  A++    SKPL LWL GG  CS   VG F EHGPFRPT    LV+N YSWN  +NM
Sbjct  60   YFVEAETSPA-SKPLVLWLNGGPGCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANM  118

Query  418  LYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            LY+++P  V +S+S   + Y    D  TA +NL FLR+WF++F +Y+  DF+IAG
Sbjct  119  LYLESPAGVGFSYSANQTFYSYVNDEMTARDNLVFLRRWFVKFPQYKQRDFFIAG  173



>ref|XP_011040750.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=499

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 103/160 (64%), Gaps = 4/160 (3%)
 Frame = +1

Query  106  LCS-ISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPL  282
            LCS I   +  + I  LPGQP  VSF QFSGYI  D+ + R+LFYYF  A+S    SKPL
Sbjct  37   LCSRIEPLLEADRIVRLPGQPP-VSFQQFSGYITVDEKQHRSLFYYFVEAESSPA-SKPL  94

Query  283  TLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSN  459
             LWL GG  CS    G F EHGPFRPT    LV+N YSWN  +N+LY+++P  V +S+S 
Sbjct  95   VLWLNGGPGCSSVGAGAFVEHGPFRPTTGNNLVRNEYSWNKEANLLYLESPAGVGFSYSA  154

Query  460  TTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              + Y    D  TA +NL FLR+WF++F +Y+  DF+IAG
Sbjct  155  NQTFYSYVNDEMTARDNLVFLRRWFVKFPQYKQRDFFIAG  194



>gb|KJB40056.1| hypothetical protein B456_007G044700 [Gossypium raimondii]
Length=462

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 110/172 (64%), Gaps = 9/172 (5%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            +++  LWF + ++L       + + I  LPGQP  +SF QFSGY+  D  + +ALFYYF 
Sbjct  13   LLLIELWFTIESSLA------HPDKIVKLPGQPPRLSFQQFSGYVTVDYKKHKALFYYFV  66

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +  LVKN YSWN  +NMLY+
Sbjct  67   EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LVKNDYSWNREANMLYL  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +TPI V +S+S  TS Y+A  D  TA +NL FL+ W+ +F  YR+ D YI G
Sbjct  125  ETPIGVGFSYSTNTSSYEAVDDEITARDNLVFLQNWYNKFPNYRHRDLYITG  176



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 111/181 (61%), Gaps = 14/181 (8%)
 Frame = +1

Query  70   MVFLLWFLLVNTL-------CSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSR  219
            M+ L W  +V TL        S+    +  ++D    LPGQP  V F Q+SGY+  D  +
Sbjct  1    MISLPWNTIVLTLILFHITSSSVEAEASPSLLDRITGLPGQPP-VGFQQYSGYVTVDAKK  59

Query  220  GRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSW  399
             RALFYYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP K   LV+N +SW
Sbjct  60   QRALFYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSW  117

Query  400  NLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIA  576
            N  +NMLY++TPI V +S+S  TS Y+A  D  TA +NL FL+KWF +F +YRN   YI 
Sbjct  118  NREANMLYLETPIGVGFSYSTDTSSYEAVADHITARDNLLFLQKWFEKFPQYRNRSLYIT  177

Query  577  G  579
            G
Sbjct  178  G  178



>gb|KDO83182.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=345

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            +L++    I +     ++D   +LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ 
Sbjct  14   ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            D  SKPL LWL GG  CS   VG F E+GPFRP     LV+N YSWN  +NML+++TPI 
Sbjct  72   DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLETPIG  130

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S   S YQ   D  TA +NL FL+ WFL+F +YRN   +I G
Sbjct  131  VGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITG  177



>ref|XP_002972549.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26635.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 106/150 (71%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            +++  LPGQP DVSF Q++GY+  D+  G+ALFYYF  A+ ED  SKPL+LWL GG  CS
Sbjct  28   DLVKDLPGQP-DVSFKQYAGYVTIDQRSGKALFYYFVEAE-EDPTSKPLSLWLNGGPGCS  85

Query  316  IATVGMFYEHGPFRP-TKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G F E GPF P +K   LV+N  +WN  SN+L+VD+PI V +S+SNT+SDYQ + D
Sbjct  86   SLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTYND  145

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +T+ + +KFL  WF++F EYR+ +FYI G
Sbjct  146  EKTSRDLVKFLHGWFIKFPEYRHREFYITG  175



>ref|XP_012072731.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
Length=477

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 109/175 (62%), Gaps = 12/175 (7%)
 Frame = +1

Query  85   WFLLVNTLCSISIRI---------NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFY  237
            W   +  +C + ++I           + I SLPGQP  VSF Q++GY+  ++ + RALFY
Sbjct  6    WITAMAVICVLLMQIFRAVGSSSKEEDKILSLPGQPK-VSFKQYAGYVTINERQQRALFY  64

Query  238  YFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNM  417
            YF  A+  D  SKPL LWL GG  CS    G F EHGPFRP+  G LV+N YSWN  +N+
Sbjct  65   YFVEAE-RDTASKPLVLWLNGGPGCSSLGAGAFSEHGPFRPSGKGNLVRNEYSWNKEANI  123

Query  418  LYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +Y+++P+ V +S+S   S Y +  D  TA +N  F++KWF++F EYRN D +IAG
Sbjct  124  IYLESPVGVGFSYSANASFYDSVNDTITAQDNFIFMQKWFIKFPEYRNRDLFIAG  178



>ref|XP_011086871.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=466

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 100/150 (67%), Gaps = 3/150 (2%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             + I  LPGQP  VSF QFSGY+  D+   RALFYYF  A++ D  SKPL LWL GG  C
Sbjct  33   ADRISQLPGQPR-VSFQQFSGYVNVDEKEERALFYYFVEAET-DPASKPLVLWLNGGPGC  90

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S   VG F E+GPFRP+ +  LV+N YSWN  +N+LY+++PI V +S+S  +S Y+   D
Sbjct  91   SSLGVGAFSENGPFRPSGNAALVRNEYSWNKEANILYLESPIGVGFSYSVNSSSYEGVND  150

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL FL+ WFL+F +YRN   YI G
Sbjct  151  KITARDNLVFLQNWFLKFPQYRNRSLYITG  180



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 110/172 (64%), Gaps = 4/172 (2%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            +   L+ FL   +L S ++    + I  LPGQP  V F Q+SGY+  D+ + RALFYY A
Sbjct  9    VATALILFLQTLSLVSSTVLSRADRITRLPGQP-QVGFQQYSGYVTVDEKKQRALFYYLA  67

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+++  +SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY+
Sbjct  68   EAETKP-ISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYL  125

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +TP+ V +S++  +S Y+   D  TA +NL FL+KWFL+F +Y N   +I G
Sbjct  126  ETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITG  177



>ref|XP_007043816.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 ref|XP_007043817.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99647.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99648.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 110/171 (64%), Gaps = 8/171 (5%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            +V  +WF  V   CS+++    + I  LPGQP  V F Q+SGY+  D+ + RALFYYFA 
Sbjct  14   IVLEVWFC-VQVECSLALF---DRITQLPGQPK-VGFQQYSGYVTVDEKKQRALFYYFAE  68

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+  D  SKPL LWL GG  CS   VG F E+GPFRP+ +  LVKN YSWN  +NMLY++
Sbjct  69   AEV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMLYLE  126

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             PI V +S+S   S Y+A  D  TA +NL F++ WFL+F +YRN   +I G
Sbjct  127  APIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITG  177



>gb|KDP37688.1| hypothetical protein JCGZ_06345 [Jatropha curcas]
Length=468

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 3/149 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I SLPGQP  VSF Q++GY+  ++ + RALFYYF  A+  D  SKPL LWL GG  CS
Sbjct  23   DKILSLPGQPK-VSFKQYAGYVTINERQQRALFYYFVEAE-RDTASKPLVLWLNGGPGCS  80

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPFRP+  G LV+N YSWN  +N++Y+++P+ V +S+S   S Y +  D 
Sbjct  81   SLGAGAFSEHGPFRPSGKGNLVRNEYSWNKEANIIYLESPVGVGFSYSANASFYDSVNDT  140

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +N  F++KWF++F EYRN D +IAG
Sbjct  141  ITAQDNFIFMQKWFIKFPEYRNRDLFIAG  169



>ref|XP_006477516.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=293

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I +LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ D  SKPL LWL GG  CS  
Sbjct  16   ITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-DPASKPLVLWLNGGPGCSSL  73

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
             VG F E+GPFRP     LV+N YSWN  +NML+++TPI V +S+S   S YQ   D  T
Sbjct  74   GVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLETPIGVGFSYSKDASSYQGVGDKIT  132

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NL FL+ WFL+F +YRN   +I G
Sbjct  133  ARDNLVFLKNWFLKFPQYRNRSLFITG  159



>gb|KHG09716.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=462

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 110/172 (64%), Gaps = 9/172 (5%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            +++  LWF + +++       + + I  LPGQP  +SF QFSGY+  D  + +ALFYYF 
Sbjct  13   LLLIELWFTIESSVA------HPDKIVKLPGQPPRLSFQQFSGYVTVDYKKHKALFYYFV  66

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +  LVKN YSWN  +NMLY+
Sbjct  67   EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LVKNDYSWNREANMLYL  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +TPI V +S+S  TS Y+A  D  TA +NL FL+ W+ +F  YR+ D YI G
Sbjct  125  ETPIGVGFSYSTNTSSYEAVDDEITARDNLVFLQNWYNKFPNYRHRDLYITG  176



>ref|XP_007043818.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 ref|XP_007043819.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99649.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99650.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
Length=462

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 110/171 (64%), Gaps = 8/171 (5%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            +V  +WF  V   CS+++    + I  LPGQP  V F Q+SGY+  D+ + RALFYYFA 
Sbjct  14   IVLEVWFC-VQVECSLALF---DRITQLPGQPK-VGFQQYSGYVTVDEKKQRALFYYFAE  68

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+  D  SKPL LWL GG  CS   VG F E+GPFRP+ +  LVKN YSWN  +NMLY++
Sbjct  69   AEV-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMLYLE  126

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             PI V +S+S   S Y+A  D  TA +NL F++ WFL+F +YRN   +I G
Sbjct  127  APIGVGFSYSTDASSYEAVDDKITARDNLVFMQNWFLKFPQYRNRSLFITG  177



>ref|XP_010938742.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=489

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 101/170 (59%), Gaps = 9/170 (5%)
 Frame = +1

Query  97   VNTLCSISIRI-------NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQ  255
             N L  +S ++        G+ I  LPGQP  + F Q+ GY+  D   GRALFYYFA A 
Sbjct  51   TNALSDLSFKVYPQQGLKEGDKIGKLPGQPERIDFDQYGGYVTVDAEAGRALFYYFAEAV  110

Query  256  SEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDT  432
            S D  SKPL LWL GG  CS    G   E GPFR   DGK L +NPY+WN V+N+L++++
Sbjct  111  SADPSSKPLVLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLES  170

Query  433  PI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            P  V +S+SNTTSDY    D  TA +   FL  W  RF EY+  DF+IAG
Sbjct  171  PAGVGFSYSNTTSDYDKSGDRRTAEDAYVFLVNWMERFPEYKGRDFFIAG  220



>gb|KGN59522.1| hypothetical protein Csa_3G824190 [Cucumis sativus]
Length=215

 Score =   146 bits (368),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 7/169 (4%)
 Frame = +1

Query  88   FLLVNT-LCS-ISIRINGEMIDSLPGQPSD--VSFTQFSGYIVTDKSRGRALFYYFAGAQ  255
             LLV   LCS I      + I  LPGQPS   V+F QFSGYI  D  + RALFYYF  A 
Sbjct  13   LLLVGVILCSRIECSKESDRILRLPGQPSSSTVNFQQFSGYITVDDYQNRALFYYFVEAY  72

Query  256  SEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTP  435
            + D  SKPL LWL GG  CS   VG F EHGPFRP  D  L+ N +SWN V+N+LYV++P
Sbjct  73   T-DPSSKPLLLWLDGGPGCSSLGVGAFVEHGPFRPEGD-VLIHNRFSWNNVANILYVESP  130

Query  436  I-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              V +SFS   + Y    D  TA +NL FL +WF +F EY+N DF+I+G
Sbjct  131  AGVGFSFSENITFYTTVNDTITAQDNLVFLERWFKKFPEYKNRDFFISG  179



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 99/147 (67%), Gaps = 4/147 (3%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I  LPGQP  V F QFSGY+  D    RALF+YFA A+ +D LSKPL LWL GG  CS  
Sbjct  32   ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
             VG F E+GPFRP  +G LV+N +SWN  +NMLY++TPI V +S+S  TS Y+   D  T
Sbjct  90   GVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYEGVNDKIT  148

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NL FL+ WF++F EYRN   +I G
Sbjct  149  AGDNLVFLQNWFMKFPEYRNRSLFIVG  175



>ref|XP_002517286.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45079.1| serine carboxypeptidase, putative [Ricinus communis]
Length=434

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I SLPGQP  VSF Q++GYI  D+++ RALF+YF  A++ D  SKPL LWL GG  CS  
Sbjct  11   IVSLPGQPR-VSFQQYAGYITIDENQQRALFFYFVEAEA-DPASKPLVLWLNGGPGCSSV  68

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
              G F EHGPFRP+    LV N YSWN  +NMLY++ P  V +S+S  TS Y +  D  T
Sbjct  69   GAGAFSEHGPFRPSGGDNLVVNEYSWNKEANMLYLEAPAGVGFSYSGNTSFYHSVNDTIT  128

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NL FL++WF +F EY N DFYI G
Sbjct  129  AQDNLVFLQQWFAKFPEYMNRDFYITG  155



>emb|CDO98312.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            +MI  LPGQP  V F QFSGY+  D  +G+ALFYYF  A+  D  SKPL LWL GG  CS
Sbjct  23   DMITQLPGQP-QVGFQQFSGYVTVDDKKGKALFYYFVEAEI-DCASKPLVLWLNGGPGCS  80

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP   G LV+N +SWN  +N+LY++TP+ V +SF++ +S Y A  D 
Sbjct  81   SLGVGAFSENGPFRPNGQG-LVRNEHSWNREANVLYLETPVGVGFSFADDSSSYDAVSDA  139

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++WFL+F +YR+ + +I G
Sbjct  140  ITARDNLVFLQRWFLQFPQYRDRNLFITG  168



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I  LPGQP  V F QFSGY+  D    RALF+YFA A+ +D LSKPL LWL GG  CS  
Sbjct  32   ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
             VG F E+GPFRP   G LV+N +SWN  +NMLY++TPI V +S+S  TS Y+   D  T
Sbjct  90   GVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGVNDKIT  148

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NL FL+ WF++F EYRN   +I G
Sbjct  149  ARDNLVFLQSWFIKFPEYRNRSLFIVG  175



>ref|XP_009143848.1| PREDICTED: serine carboxypeptidase-like 46 [Brassica rapa]
 emb|CDY17183.1| BnaA05g10050D [Brassica napus]
Length=462

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 109/171 (64%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            MV  L  L   TL S ++    + I SLPGQP  V F Q+SGY+  D+ + RALFYY A 
Sbjct  9    MVTCLILLQALTLVSSTVMSRADRITSLPGQP-KVVFQQYSGYVSIDEKKQRALFYYLAE  67

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+++  +SKPL LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  68   AETKP-ISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  125

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TP+ V +S++  +S Y+   D  TA +NL FL+KWF RF +Y N   +I G
Sbjct  126  TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITG  176



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 111/177 (63%), Gaps = 9/177 (5%)
 Frame = +1

Query  61   KKIMVFLLWFLLVNTLCSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRAL  231
            K I++ L+ F +  T  SI    +  ++D    LPGQP  V F  +SGY+  D  + RAL
Sbjct  7    KTIVLTLILFHV--TSSSIEAEASPSLLDRITGLPGQPP-VGFQHYSGYVTVDAKKQRAL  63

Query  232  FYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVS  411
            FYYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +
Sbjct  64   FYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSWNREA  121

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            NMLY++TPI V +S+S  TS Y+A  D  TA +NL FL+KWF +F +YRN   YI G
Sbjct  122  NMLYLETPIGVGFSYSTDTSSYEAVTDHITARDNLLFLQKWFEKFPQYRNRSLYITG  178



>ref|XP_006576775.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=426

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 104/171 (61%), Gaps = 3/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  L  +L  TL  ++     + I +LPGQP  V F Q+SGYI  D    RALFYYF  
Sbjct  10   MIVTLIIVLAQTLVVVNSLPEADKITNLPGQP-HVKFQQYSGYITVDDQNQRALFYYFVE  68

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+ +   SKP+ LWL GG  CS   VG   EHGPF+P  +  LVKN YSWN V+N+LY++
Sbjct  69   AE-KHPTSKPVVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKVANVLYLE  127

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S+ TS Y    D  TA +NL FL++WF  F EY   DF+I G
Sbjct  128  SPAGVGFSYSSNTSFYTLVTDEITARDNLIFLQRWFTEFPEYSKNDFFITG  178



>ref|XP_002972012.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26929.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            +++  LPGQP +VSF Q++GY+  D+  G+ALFYYF  A+ ED  SKPL+LWL GG  CS
Sbjct  28   DLVKDLPGQP-EVSFKQYAGYVTIDQRSGKALFYYFVEAE-EDPTSKPLSLWLNGGPGCS  85

Query  316  IATVGMFYEHGPFRP-TKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G F E GPF P +K   LV+N  +WN  SN+L+VD+PI V +S+SNT+SDYQ + D
Sbjct  86   SLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTYND  145

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +T+ + +KFL  WF++F EYR+ +FYI G
Sbjct  146  EKTSRDLVKFLHGWFIKFPEYRHREFYITG  175



>ref|XP_010055754.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW90022.1| hypothetical protein EUGRSUZ_A02225 [Eucalyptus grandis]
Length=474

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 111/176 (63%), Gaps = 7/176 (4%)
 Frame = +1

Query  64   KIMVFLLWFLLVNTLCSISI---RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            +++ +L    L  TLCS S        + I SLPGQP  VSF Q++GY+  D+ + RALF
Sbjct  4    QLVPWLAAATLCATLCSSSTLGTTSEADKIASLPGQP-KVSFGQYAGYVTVDEKQQRALF  62

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            YYFA A++ D  SKPL LWL GG  CS    G F EHGPF+P+ D  L+KN YSWN  +N
Sbjct  63   YYFAEAEA-DPASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-VLLKNDYSWNKEAN  120

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY+++P  V +S+S  TS Y +  D  TA +NL FLR WF +F EY+  D +I G
Sbjct  121  MLYLESPAGVGFSYSVNTSYYSSVDDKMTARDNLAFLRNWFEKFPEYKERDLFITG  176



>ref|XP_006844530.2| PREDICTED: serine carboxypeptidase-like 45 [Amborella trichopoda]
Length=464

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%), Gaps = 4/150 (3%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             + I SLPGQP+ ++F QF+GYI  D+++ RALFYYFA A++ D + KPL +WL GG  C
Sbjct  32   ADKITSLPGQPT-INFQQFAGYITVDEAKPRALFYYFAEAET-DPVLKPLVIWLNGGPGC  89

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S   VG F E+GPFRP+ +  LVKN YSWN  +NMLY++TP  V +S+S   S Y+   D
Sbjct  90   SSLGVGAFSENGPFRPSGN-VLVKNHYSWNREANMLYIETPAGVGFSYSTDISFYEGVDD  148

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +NL FL++WF++F EYR  D +I G
Sbjct  149  EKTARDNLVFLKRWFIKFPEYRTRDLFITG  178



>ref|XP_006483005.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=464

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            +L++    I +     ++D   +LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ 
Sbjct  14   ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            D  SKPL LWL GG  CS   VG F E+GPFRP     LV+N YSWN  +NML+++TPI 
Sbjct  72   DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLETPIG  130

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S   S YQ   D  TA +NL FL+ WFL+F +YRN   +I G
Sbjct  131  VGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITG  177



>ref|XP_008443350.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=479

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 110/177 (62%), Gaps = 7/177 (4%)
 Frame = +1

Query  58   IKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSD--VSFTQFSGYIVTDKSRGRAL  231
            +  ++V  +  LL +++  + +    + I SLP QPSD   +F QF GY+  D+ +GRAL
Sbjct  7    VVSLVVIHVAILLFSSVLGVPLE---DEIRSLPSQPSDSKANFKQFGGYVTVDEKQGRAL  63

Query  232  FYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVS  411
            FYYF  AQ+    SKPL LWL GG  CS   VG F EHGPF+   +  LVKN YSWN  +
Sbjct  64   FYYFVEAQTPQPTSKPLVLWLNGGPGCSSVGVGAFIEHGPFKINGE-VLVKNEYSWNTEA  122

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            NMLYV++P  V +S+S+  S Y    D  TA +N+ FL+ WF +F EY+N DFYI G
Sbjct  123  NMLYVESPAGVGFSYSSNKSFYFKIDDKITARDNMLFLQNWFDKFPEYKNADFYITG  179



>gb|KDO83181.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=464

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            +L++    I +     ++D   +LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ 
Sbjct  14   ILIHICLRIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            D  SKPL LWL GG  CS   VG F E+GPFRP     LV+N YSWN  +NML+++TPI 
Sbjct  72   DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLETPIG  130

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S   S YQ   D  TA +NL FL+ WFL+F +YRN   +I G
Sbjct  131  VGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITG  177



>gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%), Gaps = 4/150 (3%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             + I SLPGQP+ ++F QF+GYI  D+++ RALFYYFA A++ D + KPL +WL GG  C
Sbjct  28   ADKITSLPGQPT-INFQQFAGYITVDEAKPRALFYYFAEAET-DPVLKPLVIWLNGGPGC  85

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S   VG F E+GPFRP+ +  LVKN YSWN  +NMLY++TP  V +S+S   S Y+   D
Sbjct  86   SSLGVGAFSENGPFRPSGN-VLVKNHYSWNREANMLYIETPAGVGFSYSTDISFYEGVDD  144

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +NL FL++WF++F EYR  D +I G
Sbjct  145  EKTARDNLVFLKRWFIKFPEYRTRDLFITG  174



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 113/176 (64%), Gaps = 9/176 (5%)
 Frame = +1

Query  64   KIMVFLLWFLLVNTLCSISIRINGEMIDS---LPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            +IM F +  L +  L  + +  N  + D    LPGQP  + F Q+SGY+  D+ + RALF
Sbjct  2    EIMAFAVVLLQICFL--MGVNSNPSLFDKIVKLPGQP-QIGFHQYSGYVTVDEKKQRALF  58

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            YYFA A++ D  SKPL LWL GG  CS   VG F E+GPFRP+    LVKN YSWN  +N
Sbjct  59   YYFAEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNREAN  116

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY+++PI V +S+S  TS Y+A  D  TA +NL FL+KWF++F +YRN   +I G
Sbjct  117  MLYLESPIGVGFSYSVDTSFYEAVNDKTTARDNLVFLQKWFVKFPQYRNRSLFITG  172



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            +L++    I +     ++D   +LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ 
Sbjct  14   ILIHICLCIQVEAYASLLDRITALPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAET-  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            D  SKPL LWL GG  CS   VG F E+GPFRP     LV+N YSWN  +NML+++TPI 
Sbjct  72   DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLETPIG  130

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S   S YQ   D  TA +NL FL+ WFL+F +YRN   +I G
Sbjct  131  VGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITG  177



>ref|XP_009391583.1| PREDICTED: serine carboxypeptidase II-3 [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 96/150 (64%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP+ V F Q+ GY+  D   GRALFYYFA A  +   SKPL LWL GG  CS
Sbjct  68   DRIVELPGQPAGVDFVQYGGYVTVDDRNGRALFYYFAEAAGKQSSSKPLLLWLNGGPGCS  127

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
               +G   E GPFR   DG+ L +NPY+WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  128  SFGIGAMQELGPFRVMSDGRTLYRNPYAWNSVANVLFLESPAGVGFSYSNTTSDYSKSGD  187

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +   FL  W  RF EY+  DFYIAG
Sbjct  188  KKTAEDAFVFLVNWMERFPEYKGRDFYIAG  217



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 110/172 (64%), Gaps = 4/172 (2%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            +   L+ FL   +L S ++    + I  LPGQP  V F Q+SGY+  D+ + RALFYY A
Sbjct  10   VATALILFLQTLSLVSSTVLSRADRITRLPGQPR-VGFQQYSGYVNIDEKKQRALFYYLA  68

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+++  +SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY+
Sbjct  69   EAETKP-ISKPLVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYL  126

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +TP+ V +S++  +S Y+   D  TA +NL FL+KWFL+F +Y N   +I G
Sbjct  127  ETPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITG  178



>ref|XP_003520486.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 104/171 (61%), Gaps = 3/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  L  +L  TL  ++     + I +LPGQP  V F Q+SGYI  D    RALFYYF  
Sbjct  10   MIVTLIIVLAQTLVVVNSLPEADKITNLPGQP-HVKFQQYSGYITVDDQNQRALFYYFVE  68

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+ +   SKP+ LWL GG  CS   VG   EHGPF+P  +  LVKN YSWN V+N+LY++
Sbjct  69   AE-KHPTSKPVVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKVANVLYLE  127

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S+ TS Y    D  TA +NL FL++WF  F EY   DF+I G
Sbjct  128  SPAGVGFSYSSNTSFYTLVTDEITARDNLIFLQRWFTEFPEYSKNDFFITG  178



>ref|XP_008800209.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=498

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q+ GY+  D   GRALFYYFA A S D  S+PL LWL GG  CS
Sbjct  80   DKIIKLPGQPEGVDFDQYGGYVTVDMEAGRALFYYFAEAASADPSSRPLVLWLNGGPGCS  139

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L +NPY+WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  140  SLGYGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTSDYGNSGD  199

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +   FL  W  RF EY+  DFYIAG
Sbjct  200  SKTAKDAYVFLVNWMERFPEYKGRDFYIAG  229



>gb|KHN30340.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=460

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++  L+   L  TL  +S     + I +LPGQP  V F Q+SGY+  D    RALFYYF 
Sbjct  8    MIATLIIIFLAQTLVGVSSLPEADKITNLPGQPR-VEFQQYSGYVTVDDQNQRALFYYFV  66

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+ E+  SKPL LWL GG  CS   VG F EHGPFRP+ +  L  N  SWN V+N+LY+
Sbjct  67   EAE-ENPSSKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYL  125

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S+  S Y    D  TA +NL FL++WF +F EY N DF+I+G
Sbjct  126  ESPAGVGFSYSSNESFYALVTDEITARDNLVFLQRWFTKFPEYSNNDFFISG  177



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 101/159 (64%), Gaps = 3/159 (2%)
 Frame = +1

Query  109  CSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTL  288
            C++S R   + +  LPGQ  +VSF  +SGY+   +  GRALFY+F  A  ED  SKPL L
Sbjct  27   CALSSRQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALFYWFFEA-VEDPDSKPLLL  85

Query  289  WLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNT  462
            WL GG  CS    G+  E GPF    DGK L  NPYSWN V+N+L++D P+ V +S+SNT
Sbjct  86   WLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSWNQVANVLFLDMPVGVGFSYSNT  145

Query  463  TSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +SD     D  TA ++LKFL KW  RF +Y+  DFYIAG
Sbjct  146  SSDLLTNGDKRTAQDSLKFLLKWLDRFPKYKERDFYIAG  184



>ref|XP_003521119.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++  L+   L  TL  +S     + I +LPGQP  V F Q+SGY+  D    RALFYYF 
Sbjct  10   MIATLIIIFLAQTLVGVSSLPEADKITNLPGQPR-VEFQQYSGYVTVDDQNQRALFYYFV  68

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+ E+  SKPL LWL GG  CS   VG F EHGPFRP+ +  L  N  SWN V+N+LY+
Sbjct  69   EAE-ENPSSKPLVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYL  127

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S+  S Y    D  TA +NL FL++WF +F EY N DF+I+G
Sbjct  128  ESPAGVGFSYSSNESFYALVTDEITARDNLVFLQRWFTKFPEYSNNDFFISG  179



>ref|XP_002517289.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45082.1| serine carboxypeptidase, putative [Ricinus communis]
Length=464

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 112/172 (65%), Gaps = 12/172 (7%)
 Frame = +1

Query  88   FLLVNTLCSISIRINGE------MIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            ++++ T+C+ ++ +  E       I +LPGQP +VSF Q++GYI  D+ + RALFYYF  
Sbjct  6    WMIIATICATALFLTAESVSETDKIGTLPGQP-EVSFKQYAGYITIDEKQQRALFYYFVE  64

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYV  426
            A++ D  SKPL LWL GG  CS    G F EHGPF+P+  GK L+KN YSWN  +NMLY+
Sbjct  65   AET-DPSSKPLVLWLNGGPGCSSIGAGAFCEHGPFKPS--GKILLKNDYSWNREANMLYL  121

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+    S Y +  D  TA +NL FL +WF +F EYRN DF+I G
Sbjct  122  ESPAGVGFSYCANKSFYNSVNDEMTAIDNLAFLERWFSKFPEYRNRDFFITG  173



>ref|XP_002463311.1| hypothetical protein SORBIDRAFT_02g041610 [Sorghum bicolor]
 gb|EER99832.1| hypothetical protein SORBIDRAFT_02g041610 [Sorghum bicolor]
Length=526

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 99/154 (64%), Gaps = 2/154 (1%)
 Frame = +1

Query  124  RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGG  303
            R   + +D LPGQPS V F Q+SGY+  D + GRALFYY A A      +KPL LWL GG
Sbjct  79   RKEDDRVDKLPGQPSGVDFEQYSGYVTVDAAAGRALFYYLAEAVGGGSAAKPLLLWLNGG  138

Query  304  HDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQ  477
              CS    G   E GPFR   DGK L +NPY+WN  +N+L++++P  V +S+SNTT+DY 
Sbjct  139  PGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAANVLFLESPAGVGFSYSNTTADYG  198

Query  478  AWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             + D +TA + L+FL  W  +F EY+  DFY+AG
Sbjct  199  RFGDNKTAEDALQFLLNWMDKFPEYKGRDFYLAG  232



>ref|XP_010653630.1| PREDICTED: serine carboxypeptidase-like 45, partial [Vitis vinifera]
Length=301

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 104/172 (60%), Gaps = 9/172 (5%)
 Frame = +1

Query  85   WFLLVNTLCSISIRINGEMID------SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            W +++ TLC   +    E +       SLPGQP  VSF QF GY+  D+ +GRALFYYF 
Sbjct  7    WMVVLATLCVAPLCFAMEPVSESDKLGSLPGQPH-VSFQQFGGYVTIDEKQGRALFYYFV  65

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A ++   SKPL LWL GG  CS    G F EHGPFRP +   L++N +SWN  +NMLYV
Sbjct  66   EAVTDPTASKPLVLWLTGGPGCSSLGGGAFMEHGPFRP-RGNTLLRNKHSWNREANMLYV  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S   S Y    D  TA +NL FL  WF++F +YRN + +I G
Sbjct  125  ESPAGVGFSYSRNKSFYDDINDEVTARDNLAFLEGWFMKFPKYRNRELFITG  176



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = +1

Query  94   LVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELS  273
            L+    ++    + + I SLPGQP  V F QF+GYI  D+ + R LFYYF  A++ D  S
Sbjct  8    LIQICLTVESPPSADKIVSLPGQP-QVGFQQFAGYITVDEKQQRHLFYYFVEAET-DPAS  65

Query  274  KPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYS  450
            KPL LWL GG  CS    G F EHGPF+P+ +  LV N YSWN V+NMLY+++P  V +S
Sbjct  66   KPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILVNNDYSWNKVANMLYLESPAGVGFS  124

Query  451  FSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +S  TS Y    D  TA +NLKFL++WFL+F EY+N D ++ G
Sbjct  125  YSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTG  167



>ref|XP_004136677.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis sativus]
 gb|KGN59516.1| hypothetical protein Csa_3G823640 [Cucumis sativus]
Length=479

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 98/149 (66%), Gaps = 5/149 (3%)
 Frame = +1

Query  142  IDSLPGQPSD--VSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            I SLP QPSD   +F QF GY+  D+ +GRALFYYF  AQ++   SKPL LWL GG  CS
Sbjct  33   IRSLPSQPSDSKANFKQFGGYVTIDEKQGRALFYYFVEAQTQ-PTSKPLVLWLNGGPGCS  91

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPF+   +  LVKN YSWN  +NMLYV++P  V +S+S+  S Y    D 
Sbjct  92   SVGAGAFIEHGPFKINGE-TLVKNEYSWNTEANMLYVESPAGVGFSYSSNKSFYSKINDK  150

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+ WF++F EY+N DFYI G
Sbjct  151  ITARDNLLFLQNWFVKFPEYKNADFYITG  179



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 109/172 (63%), Gaps = 4/172 (2%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            I++  +   L+    ++    + + I SLPGQP  V F QF+GYI  D+ + R LFYYF 
Sbjct  7    IIMATISAFLIQICLTVESPPSADKIVSLPGQP-QVGFQQFAGYITVDEKQQRHLFYYFV  65

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D  SKPL LWL GG  CS    G F EHGPF+P+ +  LV N YSWN V+NMLY+
Sbjct  66   EAET-DPASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILVNNDYSWNKVANMLYL  123

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S  TS Y    D  TA +NLKFL++WFL+F EY+N D ++ G
Sbjct  124  ESPAGVGFSYSANTSFYAFVNDEMTARDNLKFLQRWFLKFPEYKNRDLFLTG  175



>ref|XP_010938508.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  + F Q+ GY+  D   GRALFYYF  A S+D  SKPL LWL GG  CS
Sbjct  75   DKISKLPGQPEGIDFDQYGGYVTVDAEAGRALFYYFTEAVSDDPSSKPLVLWLNGGPGCS  134

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L +NPY+WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  135  SLGYGAMEELGPFRVMSDGKTLFRNPYAWNTVANVLFLESPAGVGFSYSNTTSDYGENGD  194

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA ++  FL  W  RF EY+  DF+IAG
Sbjct  195  SRTAEDSYVFLVNWMDRFPEYKGRDFFIAG  224



>emb|CDY11750.1| BnaC03g58280D [Brassica napus]
Length=461

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 107/165 (65%), Gaps = 4/165 (2%)
 Frame = +1

Query  88   FLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDE  267
            F L+  L S ++  + +++  LPGQP  V F Q+SGY+  D+ +  ALFYYFA A++E  
Sbjct  14   FALIFFLSSATVLSHSDLVTRLPGQP-QVGFKQYSGYVTVDEKKHSALFYYFAEAETEPT  72

Query  268  LSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VA  444
             SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V 
Sbjct  73   -SKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  445  YSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +S+S  +S Y++  D  TA +NL FL +WFL+F  Y N   +I G
Sbjct  131  FSYSTQSSSYESVNDKITARDNLVFLERWFLKFPHYLNRSLFITG  175



>ref|XP_007145476.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
 gb|ESW17470.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
Length=465

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 108/167 (65%), Gaps = 4/167 (2%)
 Frame = +1

Query  82   LWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
            L F++  ++  ++     + I +LPGQP  V F Q++GYI  D+ + RALFYYF  A+ E
Sbjct  13   LLFVIAQSVVGVNSASQADKITTLPGQPP-VKFQQYAGYITVDEKQKRALFYYFVEAEVE  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
               SKPL LWL GG  CS    G F EHGPF+P+++G L+KN +SWN  +NMLY+++P  
Sbjct  72   PA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEFSWNKEANMLYLESPAG  129

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S   S Y    D  TA +NL FL++WF +F E++N DF+I G
Sbjct  130  VGFSYSANKSFYDYVNDEMTARDNLVFLQRWFTKFPEFKNSDFFITG  176



>ref|XP_002520628.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF41764.1| serine carboxypeptidase, putative [Ricinus communis]
Length=467

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 107/175 (61%), Gaps = 12/175 (7%)
 Frame = +1

Query  85   WFLLVNTLCSISIRINGEM---------IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFY  237
            W ++V    ++ I+ N  +         I SLP QP  VSF Q++GYI  D+ + RALFY
Sbjct  6    WIVMVVICITLIIKCNAAVGSSSKEDDKIVSLPRQP-QVSFQQYAGYITIDEKQQRALFY  64

Query  238  YFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNM  417
            YF  A++ D  SKPL LWL GG  CS    G F EHGPFRP+    LV N YSWN  +NM
Sbjct  65   YFVEAET-DPASKPLVLWLNGGPGCSSLGAGAFSEHGPFRPSSGESLVINEYSWNKEANM  123

Query  418  LYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            LY++TP  V +S+S  TS Y    D  TA +NL FL++WFL+F EY + DF+I G
Sbjct  124  LYLETPAGVGFSYSVNTSFYDNVNDTITAQDNLVFLQQWFLKFPEYMSRDFFITG  178



>ref|XP_008783277.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=499

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q+ GY+  DK  GRALFYY   A + D  S+PL LWL GG  CS
Sbjct  81   DKIIKLPGQPEGVDFDQYGGYVTVDKEAGRALFYYLTEAATADPSSRPLVLWLNGGPGCS  140

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
               +G   E GPFR   DGK L +NPY+WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  141  SFGIGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTSDYGNSGD  200

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +   FL  W  RF EY+  DFYIAG
Sbjct  201  SKTAKDAYVFLVNWMERFPEYKGRDFYIAG  230



>gb|KEH40983.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=417

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 109/173 (63%), Gaps = 6/173 (3%)
 Frame = +1

Query  64   KIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYF  243
            ++ VF   F+ +  L  ++  +  + I  LP QP  V F QFSG+I  D++  RALFYYF
Sbjct  7    ELCVFSTIFMFI--LGGVNSTLESDKITRLPDQPK-VDFQQFSGHITIDETHQRALFYYF  63

Query  244  AGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLY  423
              A+  D  SKP+ LWL GG  CS    G F EHGPF+PT+ G LVKN +SWN V+NM+Y
Sbjct  64   VEAEV-DPASKPVVLWLNGGPGCSSVGQGSFSEHGPFKPTRKG-LVKNSFSWNKVANMIY  121

Query  424  VDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +D+PI V +S+S   SDY    D  TA +NL FL+ WF RF  +R+ DF+I G
Sbjct  122  LDSPIGVGFSYSANKSDYFLVNDQITARDNLLFLQGWFSRFPMHRSSDFFITG  174



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 103/151 (68%), Gaps = 7/151 (5%)
 Frame = +1

Query  139  MIDS---LPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHD  309
            M+DS   LPGQP  V F Q+SGY+  D+ + RALFYYFA A+  D  SKPL LWL GG  
Sbjct  40   MLDSIPRLPGQPP-VGFRQYSGYVTVDEKQQRALFYYFAEAEL-DPASKPLVLWLNGGPG  97

Query  310  CSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            CS   VG F E+GPFRP+ D  LV+N YSWN  +NMLY++ PI V +S+S  TS Y+A  
Sbjct  98   CSSLGVGAFSENGPFRPSGDA-LVRNEYSWNREANMLYLEAPIGVGFSYSTDTSSYEAVN  156

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA +NL FL+ WF++F +Y+N + +I G
Sbjct  157  DKITARDNLVFLQGWFVKFPQYKNSNLFITG  187



>ref|XP_009368797.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=467

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 6/148 (4%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I SLPGQP  V F QFSGYI  D    +ALFYYFA A+  +  SKPL LWL GG  CS  
Sbjct  39   ITSLPGQP-HVGFQQFSGYITVDDHNHKALFYYFAEAEI-NPASKPLVLWLNGGPGCSSL  96

Query  322  TVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFE  495
             VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++TP+ V +S+S + S Y A  D  
Sbjct  97   GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYSKSNSSYMAVDDEA  154

Query  496  TAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TA +NL FL++WF +F +YR++D ++AG
Sbjct  155  TARDNLVFLQRWFNKFPQYRHMDLFLAG  182



>ref|XP_006304410.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
 gb|EOA37308.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
Length=459

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = +1

Query  88   FLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDE  267
            F L+  L S ++  + + +  LPGQP  V F Q+SGY+  D  + RALFYYFA A++ D 
Sbjct  12   FALILFLSSSTVLSHSDRVTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAET-DP  69

Query  268  LSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VA  444
             SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V 
Sbjct  70   TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVGVG  128

Query  445  YSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +S+S  +S Y+   D  TA +NL FL++WFL+F  Y N   +I G
Sbjct  129  FSYSTQSSSYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITG  173



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 108/168 (64%), Gaps = 7/168 (4%)
 Frame = +1

Query  79   LLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQS  258
            LL   ++   CS+S     + I  LPGQP  V F Q+SGY+  D    +ALFYYFA A+ 
Sbjct  7    LLVCFIIGVECSLS---QLDRITQLPGQPP-VWFQQYSGYVTVDDKNQKALFYYFAEAEI  62

Query  259  EDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI  438
             D  SKPL LWL GG  CS   VG F E+GPFRP+ +G LVKN YSWN  +NMLY++TPI
Sbjct  63   -DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLETPI  120

Query  439  -VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             V +S+S  TS Y+   D  TA +NL FL++WF++F +YR+   +I G
Sbjct  121  GVGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYRSRSLFITG  168



>gb|KEH33274.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=457

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I SLP QP  V F Q++GYI  D+ + RALFYYF  A+ E   SKP+ LWL GG  CS
Sbjct  29   DKISSLPQQPK-VGFQQYAGYITVDEVQKRALFYYFVEAEVEPA-SKPVVLWLNGGPGCS  86

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPF+PTK+G L+KN YSWN  +NMLY+++P  V +S+S   S Y +  D+
Sbjct  87   SVGAGAFVEHGPFKPTKNG-LIKNDYSWNKEANMLYLESPAGVGFSYSTNESFYDSVNDY  145

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+ WF +F EY+N +F+I G
Sbjct  146  LTARDNLIFLQHWFTKFSEYKNNEFFITG  174



>ref|XP_002322611.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
 gb|EEF04372.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
Length=442

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 96/145 (66%), Gaps = 3/145 (2%)
 Frame = +1

Query  148  SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATV  327
            SLPGQP  VSF Q++GY+  D+++ RALFYYF  A++ D  SKPL LWL GG  CS    
Sbjct  25   SLPGQPR-VSFQQYAGYVTVDENQDRALFYYFVEAET-DPASKPLVLWLNGGPGCSSVGA  82

Query  328  GMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAY  504
            G F EHGPFRP+  G LV+N YSWN  +NMLY+++P  V +S+S   S Y    D  T  
Sbjct  83   GAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLESPAGVGFSYSANQSFYDLVNDTITVQ  142

Query  505  ENLKFLRKWFLRFYEYRNLDFYIAG  579
            +N  FL+ WFL+F EY+N D +I G
Sbjct  143  DNFVFLQNWFLKFPEYKNRDLFITG  167



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q+SGY+  D+ + RALFYYFA A+++  + KPL LWL GG  CS
Sbjct  32   DKILELPGQP-QVGFQQYSGYVAVDEKQQRALFYYFAEAETDPAI-KPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LV+N YSWN  +NMLY++TPI V +S+S  +S Y A  D 
Sbjct  90   SLGVGAFSENGPFRPSGE-LLVRNEYSWNREANMLYLETPIGVGFSYSTDSSSYAAVNDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+KW L+F +Y+N D +I G
Sbjct  149  ITARDNLVFLQKWLLKFPQYKNRDLFITG  177



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 109/171 (64%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            +V  L  L   +L S ++    + I SLPGQP  V F Q+SGY+  D+ + RALFYY A 
Sbjct  10   IVTALILLHALSLVSSTVMSRADRITSLPGQP-KVGFQQYSGYVSIDEKKQRALFYYLAE  68

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+++  +SKPL LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  69   AEAKP-ISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  126

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TP+ V +S++  +S Y+   D  TA +NL FL+KWF RF +Y N   +I G
Sbjct  127  TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITG  177



>ref|XP_010938507.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Elaeis 
guineensis]
Length=492

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  + F Q+ GY+  D   GRALFYYF  A S+D  SKPL LWL GG  CS
Sbjct  75   DKISKLPGQPEGIDFDQYGGYVTVDAEAGRALFYYFTEAVSDDPSSKPLVLWLNGGPGCS  134

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L +NPY+WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  135  SLGYGAMEELGPFRVMSDGKTLFRNPYAWNTVANVLFLESPAGVGFSYSNTTSDYGENGD  194

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA ++  FL  W  RF EY+  DF+IAG
Sbjct  195  SRTAEDSYVFLVNWMDRFPEYKGRDFFIAG  224



>ref|XP_012072739.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
Length=449

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 109/171 (64%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            +V  L  +    +C  S + + +++ SLPGQP  VSF Q++GYI  D+ + RALFYYF  
Sbjct  7    LVMALICMSFMQICRASSKEDNKIV-SLPGQP-QVSFQQYAGYITVDEKQQRALFYYFVE  64

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A++ +  SKPL LWL GG  CS    G F EHGPFRP     L +N YSWN  +N+LY++
Sbjct  65   AET-NPASKPLVLWLNGGPGCSSVGAGAFSEHGPFRPAGGVNLTRNEYSWNKEANILYLE  123

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S  TS Y +  D  TA +NL FL++WF +F +Y+N DF+I G
Sbjct  124  SPAGVGFSYSANTSFYDSVNDTITAQDNLVFLQQWFEKFPDYKNRDFFITG  174



>ref|XP_008802653.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase II-3-like 
[Phoenix dactylifera]
Length=490

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA-GAQSEDELSKPLTLWLGGGHDC  312
            + I  LPGQP  V F Q+ GY+  D   GRALFYYFA  A S D  SKPL LWL GG  C
Sbjct  72   DKISKLPGQPEGVDFDQYGGYVTVDAESGRALFYYFAEAAASADTSSKPLVLWLNGGPGC  131

Query  313  SIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            S    G   E GPFR   DGK L +NPY+WN V+N+L++++P  V +S+SNTTSDY    
Sbjct  132  SSLGYGAMEELGPFRVMSDGKTLFRNPYAWNRVANVLFLESPAGVGFSYSNTTSDYDKSG  191

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA +   FL  W  RF EY+  DF+IAG
Sbjct  192  DSRTAADAYVFLENWMERFPEYKGRDFFIAG  222



>ref|XP_006410496.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
 gb|ESQ51949.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
Length=462

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 109/171 (64%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M   L+ L   +  S +++   + I  LPGQP  V F Q+SGY+  D+ + RALFYY A 
Sbjct  9    MATALFLLQALSSVSSTVQSRADQITRLPGQPR-VGFQQYSGYVSIDEKKQRALFYYLAE  67

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A++E  +SK L LWL GG  CS   VG F E+GPFRP K   LV+N +SWNL +NMLY++
Sbjct  68   AETEP-ISKSLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSDLVRNQHSWNLEANMLYLE  125

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TP+ V +S++  +S Y+   D  TA +NL FL+KWFLRF +Y N   ++ G
Sbjct  126  TPVGVGFSYATESSLYEGVNDKITAKDNLVFLQKWFLRFPQYLNRSLFLTG  176



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I  LPGQP  V F QFSGY+  D    +ALF+YFA A+ +D  SKPL LWL GG  CS  
Sbjct  32   ITHLPGQP-QVEFQQFSGYVTVDDRNQQALFFYFAEAE-KDAASKPLVLWLNGGPGCSSL  89

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
             VG F E+GPFRP K   LV+N +SWN  +NMLY++TPI V +S+S  TS Y+   D  T
Sbjct  90   GVGAFSENGPFRP-KGEALVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGVNDEIT  148

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NL FL+ WF++F EYRN   +I G
Sbjct  149  ARDNLVFLKNWFIKFPEYRNRSLFIVG  175



>ref|XP_010478165.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + + SLPGQP  V F Q+SGY+  D  + RALFYYFA A++ D  SKPL LWL GG  CS
Sbjct  60   DRVTSLPGQP-QVGFQQYSGYVTVDDKKQRALFYYFAEAET-DPTSKPLVLWLNGGPGCS  117

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +S Y+   D 
Sbjct  118  SLGVGAFSENGPFRP-KGPILVKNHHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDK  176

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++WFL+F  Y N   YI G
Sbjct  177  ITARDNLVFLQRWFLKFPHYLNRSLYITG  205



>gb|KDP37687.1| hypothetical protein JCGZ_06344 [Jatropha curcas]
Length=463

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 4/159 (3%)
 Frame = +1

Query  106  LCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLT  285
            +C  S + + +++ SLPGQP  VSF Q++GYI  D+ + RALFYYF  A++ +  SKPL 
Sbjct  3    ICRASSKEDNKIV-SLPGQP-QVSFQQYAGYITVDEKQQRALFYYFVEAET-NPASKPLV  59

Query  286  LWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNT  462
            LWL GG  CS    G F EHGPFRP     L +N YSWN  +N+LY+++P  V +S+S  
Sbjct  60   LWLNGGPGCSSVGAGAFSEHGPFRPAGGVNLTRNEYSWNKEANILYLESPAGVGFSYSAN  119

Query  463  TSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TS Y +  D  TA +NL FL++WF +F +Y+N DF+I G
Sbjct  120  TSFYDSVNDTITAQDNLVFLQQWFEKFPDYKNRDFFITG  158



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I +LPGQP  V F QFSGY+  D+ + RALFYYF  A+  D  SKPL LWL GG  CS
Sbjct  63   DKIIALPGQP-QVGFQQFSGYVTVDEKKERALFYYFVEAEI-DPSSKPLVLWLNGGPGCS  120

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LV+N YSWN  +NMLY++TP+ V +S+S  TS Y A  D 
Sbjct  121  SLGVGAFSENGPFRPSGE-VLVRNEYSWNSEANMLYLETPVGVGFSYSTDTSSYVAVDDK  179

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++WFL+F +Y++ D +I G
Sbjct  180  ITARDNLVFLQRWFLKFPQYKHRDLFITG  208



>gb|KJB31549.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=306

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q++GY+  DK + RALFYYFA A+  D  SKPL LWL GG  CS
Sbjct  32   DRISRLPGQP-KVGFQQYAGYVTVDKRKQRALFYYFAEAEV-DPASKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LVKN YSWN  +NM+Y++ P+ V +S+S   S Y+A  D 
Sbjct  90   SLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMVYLEAPVGVGFSYSADDSSYEAVNDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+ WFL+F +Y+N   +I G
Sbjct  149  ITARDNLVFLQNWFLKFPQYKNRSLFITG  177



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M   L  L   +L S +I    + I  LPGQP  V F Q+SGY+  D  + RALFYY A 
Sbjct  1    MATALILLQALSLVSSTILSRADRITRLPGQPR-VGFQQYSGYVTIDDKKQRALFYYLAE  59

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+++  +SKPL LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  60   AETK-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNLHSWNQEANMLYLE  117

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TP+ V +S++  +S Y+   D  TA +NL FL+KWFL+F +Y N   +I G
Sbjct  118  TPVGVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITG  168



>ref|XP_011040753.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=482

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 110/172 (64%), Gaps = 7/172 (4%)
 Frame = +1

Query  79   LLWFLLVNTLCSISIRINGEMID----SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++  ++  T   IS  ++   +D    SLPGQP  VSF Q++GY+  D+++ RALFYYF 
Sbjct  7    IIMVVICATFMQISRAVDSSSVDDKILSLPGQPP-VSFQQYAGYVTVDENQDRALFYYFV  65

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+S D  SKPL LWL GG  CS   +G F E+GPFRP   G LV+N YSWN  +NMLY+
Sbjct  66   EAES-DPASKPLVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYSWNKEANMLYL  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S   S Y    D  TA ++  FL++WF++F EY++ DFYI G
Sbjct  125  ESPAGVGFSYSANQSFYDLVNDTITAQDSYIFLQQWFVKFPEYKDRDFYITG  176



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 112/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  61   KKIMVFLLWFL---LVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRAL  231
            K++M   L  L   ++   CS+S     + I  LPGQP  V F Q+SGY+  D    +AL
Sbjct  6    KEMMALPLGLLVCFIIGVECSLS---QLDRITQLPGQPP-VWFQQYSGYVTVDDKNQKAL  61

Query  232  FYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVS  411
            FYYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP+ +G LVKN YSWN  +
Sbjct  62   FYYFAEAEI-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNREA  119

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            NMLY++TPI V +S+S  TS Y+   D  TA +NL FL++WF++F +Y++   +I G
Sbjct  120  NMLYLETPIGVGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYKSRSLFITG  176



>ref|XP_002517750.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF44557.1| serine carboxypeptidase, putative [Ricinus communis]
Length=513

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 99/150 (66%), Gaps = 3/150 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+ LPGQP DV FTQ+ GY+ TDKS GRAL+YYF  AQ   + S PL LWL GG  CS
Sbjct  88   DRIERLPGQP-DVEFTQYGGYVTTDKSAGRALYYYFVEAQHYAKESFPLLLWLNGGPGCS  146

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L KN YSWN  +N+L++++P  V +S+SNT+SDY+   D
Sbjct  147  SLGYGAMQELGPFRVHSDGKTLYKNRYSWNYAANVLFLESPAGVGFSYSNTSSDYEKCGD  206

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY++ DFYI+G
Sbjct  207  KATAEDNYLFLVNWLERFPEYKDRDFYISG  236



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 112/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  61   KKIMVFLLWFL---LVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRAL  231
            K++M   L  L   ++   CS+S     + I  LPGQP  V F Q+SGY+  D    +AL
Sbjct  6    KEMMALPLGLLVCFIIGVECSLS---QLDRITQLPGQPP-VWFQQYSGYVTVDDKNQKAL  61

Query  232  FYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVS  411
            FYYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP+ +G LVKN YSWN  +
Sbjct  62   FYYFAEAEI-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNREA  119

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            NMLY++TPI V +S+S  TS Y+   D  TA +NL FL++WF++F +Y++   +I G
Sbjct  120  NMLYLETPIGVGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYKSRSLFITG  176



>ref|XP_002277420.3| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=457

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 104/172 (60%), Gaps = 9/172 (5%)
 Frame = +1

Query  85   WFLLVNTLCSISIRINGEMID------SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            W +++ TLC   +    E +       SLPGQP  VSF QF GY+  D+ +GRALFYYF 
Sbjct  20   WMVVLATLCVAPLCFAMEPVSESDKLGSLPGQP-HVSFQQFGGYVTIDEKQGRALFYYFV  78

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A ++   SKPL LWL GG  CS    G F EHGPFRP +   L++N +SWN  +NMLYV
Sbjct  79   EAVTDPTASKPLVLWLTGGPGCSSLGGGAFMEHGPFRP-RGNTLLRNKHSWNREANMLYV  137

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S   S Y    D  TA +NL FL  WF++F +YRN + +I G
Sbjct  138  ESPAGVGFSYSRNKSFYDDINDEVTARDNLAFLEGWFMKFPKYRNRELFITG  189



>ref|XP_006589008.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=464

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 106/168 (63%), Gaps = 4/168 (2%)
 Frame = +1

Query  79   LLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQS  258
            LL F++   +  ++     + I +LPGQP  V F Q++GYI  D  + RALFYYF  A+ 
Sbjct  13   LLLFVIAQCVVGVNSLSQADKISTLPGQPP-VKFQQYAGYITVDDKQKRALFYYFVEAEV  71

Query  259  EDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI  438
            E   SKPL LWL GG  CS    G F EHGPF+P+++G L+KN +SWN  +NMLY+++P 
Sbjct  72   EPA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLESPA  129

Query  439  -VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             V +S+S   S Y    D  TA +NL FL++WF +F E +N DF+I G
Sbjct  130  GVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITG  177



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            ++I  LPGQP  V F Q+SGY+  D+ + RALFYYFA A+  D  SKPL LWL GG  CS
Sbjct  35   DIIALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCS  92

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LV+N +SWN  +NMLY++TPI V +S+S  TS Y+A  D 
Sbjct  93   SLGVGAFSENGPFRPSGE-VLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVNDH  151

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+KW  +F +Y+N   +I G
Sbjct  152  ITARDNLLFLQKWLEKFPQYKNRSLFITG  180



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            ++I  LPGQP  V F Q+SGY+  D+ + RALFYYFA A+  D  SKPL LWL GG  CS
Sbjct  35   DIIALLPGQP-QVGFQQYSGYVTVDEKKQRALFYYFAEAEI-DPASKPLVLWLNGGPGCS  92

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LV+N +SWN  +NMLY++TPI V +S+S  TS Y+A  D 
Sbjct  93   SLGVGAFSENGPFRPSGE-VLVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVNDH  151

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+KW  +F +Y+N   +I G
Sbjct  152  ITARDNLLFLQKWLEKFPQYKNRSLFITG  180



>gb|KHN07932.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=464

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 106/168 (63%), Gaps = 4/168 (2%)
 Frame = +1

Query  79   LLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQS  258
            LL F++   +  ++     + I +LPGQP  V F Q++GYI  D  + RALFYYF  A+ 
Sbjct  13   LLLFVIAQCVVGVNSLSQADKISTLPGQPP-VKFQQYAGYITVDDKQKRALFYYFVEAEV  71

Query  259  EDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI  438
            E   SKPL LWL GG  CS    G F EHGPF+P+++G L+KN +SWN  +NMLY+++P 
Sbjct  72   EPA-SKPLVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLESPA  129

Query  439  -VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             V +S+S   S Y    D  TA +NL FL++WF +F E +N DF+I G
Sbjct  130  GVGFSYSANKSFYDFVNDEMTARDNLVFLQRWFTKFPELKNNDFFITG  177



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRING----------EMIDSLPGQPSDVSFTQFSGYIVTDKSR  219
            M+ L W  +V TL  + I  +           + I  LPGQP  V F Q+SGY+  D+ R
Sbjct  1    MISLPWKTIVLTLLLLHITSSSFEAEAFPSLLDRITGLPGQPP-VGFQQYSGYVTVDEKR  59

Query  220  GRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSW  399
             +A+FYY A A+  D  SKPL LWL GG  CS   VG F E+GPFRP K   LV+N +SW
Sbjct  60   QKAMFYYLAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSW  117

Query  400  NLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIA  576
            N  +NMLY++TPI V +S+S  TS Y+   D  TA +NL FL+KW  +F +YRN   YI 
Sbjct  118  NTEANMLYLETPIGVGFSYSTDTSSYEGVTDRITARDNLLFLQKWLEKFPQYRNRSLYIT  177

Query  577  G  579
            G
Sbjct  178  G  178



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 104/157 (66%), Gaps = 4/157 (3%)
 Frame = +1

Query  112  SISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLW  291
            S +I    + I  LPGQP  V F Q+SGY+  D+ + RALFYY A A+++  +SKPL LW
Sbjct  24   SSTILSRADRITRLPGQPR-VGFQQYSGYVTIDEKKQRALFYYLAEAETKP-ISKPLVLW  81

Query  292  LGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTS  468
            L GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++TP+ V +S++N +S
Sbjct  82   LNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLETPVGVGFSYANESS  140

Query  469  DYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             Y+   D  TA +NL FL+KWFL+F +Y N   +I G
Sbjct  141  SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITG  177



>gb|ERN14540.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
Length=494

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = +1

Query  94   LVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELS  273
            +   L    ++   E++  L GQP  V F Q++GY+  D++ GRALFYYFA  ++ D LS
Sbjct  59   VARALPQHGLKEKDEIVGGLHGQPEGVEFKQYAGYVTLDETAGRALFYYFA--EAVDPLS  116

Query  274  KPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAY  447
            KPL LWL GG  CS    G   E GPFR   DGK L KN Y+WN  +N+L++++P  V +
Sbjct  117  KPLLLWLNGGPGCSSLGYGAMEELGPFRVQSDGKTLYKNRYAWNKAANVLFLESPAGVGF  176

Query  448  SFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S+SNTTSDY+   D  TA +   FL  WF RF EY+N DFYI+G
Sbjct  177  SYSNTTSDYELSGDSRTASDAYTFLINWFERFPEYKNRDFYISG  220



>gb|KJB31550.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=344

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q++GY+  DK + RALFYYFA A+  D  SKPL LWL GG  CS
Sbjct  32   DRISRLPGQPK-VGFQQYAGYVTVDKRKQRALFYYFAEAEV-DPASKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LVKN YSWN  +NM+Y++ P+ V +S+S   S Y+A  D 
Sbjct  90   SLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMVYLEAPVGVGFSYSADDSSYEAVNDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+ WFL+F +Y+N   +I G
Sbjct  149  ITARDNLVFLQNWFLKFPQYKNRSLFITG  177



>ref|XP_002314061.1| hypothetical protein POPTR_0009s06080g [Populus trichocarpa]
 gb|EEE88016.1| hypothetical protein POPTR_0009s06080g [Populus trichocarpa]
Length=499

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 101/150 (67%), Gaps = 3/150 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+SLPGQP  V F+Q+ GY+  DKS GRAL+YYFA AQ  ++ S PL LWL GG  CS
Sbjct  74   DRIESLPGQPK-VEFSQYGGYVTVDKSTGRALYYYFAEAQHSNKESLPLLLWLNGGPGCS  132

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
              + G   E GPFR   DG+ L KN +SWN  +N+L++++P  V +S+SNTTSDY+   D
Sbjct  133  SLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGD  192

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY++ DFYI+G
Sbjct  193  KMTAEDNYVFLVNWLERFPEYKDRDFYISG  222



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 104/157 (66%), Gaps = 4/157 (3%)
 Frame = +1

Query  112  SISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLW  291
            S +I    + I  LPGQP  V F Q+SGY+  D+ + RALFYY A A+++  +SKPL LW
Sbjct  24   SSTILSRADRITRLPGQPR-VGFQQYSGYVTIDEKKQRALFYYLAEAETKP-ISKPLVLW  81

Query  292  LGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTS  468
            L GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++TP+ V +S++N +S
Sbjct  82   LNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLETPVGVGFSYANESS  140

Query  469  DYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             Y+   D  TA +NL FL+KWFL+F +Y N   +I G
Sbjct  141  SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITG  177



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 104/164 (63%), Gaps = 4/164 (2%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDEL  270
            ++  +  S+S   + + I  LPGQP  V F QFSGY+  D  + RALFYYF  A+  D  
Sbjct  14   MMFQSCISLSSSFHSDKIVRLPGQP-HVGFQQFSGYVSVDDKKHRALFYYFVEAEI-DPA  71

Query  271  SKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAY  447
            SKPL LWL GG  CS   VG F E+GPFRP K   LV+N YSWN  +NMLY++TP+ V +
Sbjct  72   SKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGKVLVRNEYSWNKEANMLYLETPVGVGF  130

Query  448  SFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S++  +S Y A  D  TA +NL FL+ W+ RF +YR+ D +I G
Sbjct  131  SYATDSSSYLAVDDEATARDNLVFLKHWYNRFPQYRHRDLFITG  174



>ref|XP_011075459.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=472

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 108/170 (64%), Gaps = 4/170 (2%)
 Frame = +1

Query  73   VFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGA  252
            V  + F+L   + +   +  G+ I SLPGQP  VSF Q+SGYI+    + R+ FYYF  A
Sbjct  10   VLAMIFVLQIYVAAGKAQNQGDKIVSLPGQPK-VSFQQYSGYIIIGGKQQRSYFYYFVEA  68

Query  253  QSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDT  432
            ++E   SKPL LWL GG  CS    G F EHGPF+P+ +  LV+N YSWN  +NMLY+++
Sbjct  69   ETEPA-SKPLVLWLNGGPGCSSVGAGAFSEHGPFQPSGN-VLVRNNYSWNKAANMLYLES  126

Query  433  PI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            P  V +S+S   S Y++  D  TA +NL FL KWF +F EY+N +FYI G
Sbjct  127  PAGVGFSYSANKSFYESVDDEMTARDNLNFLEKWFDKFPEYKNREFYITG  176



>gb|KJB31551.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=375

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q++GY+  DK + RALFYYFA A+  D  SKPL LWL GG  CS
Sbjct  32   DRISRLPGQPK-VGFQQYAGYVTVDKRKQRALFYYFAEAEV-DPASKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LVKN YSWN  +NM+Y++ P+ V +S+S   S Y+A  D 
Sbjct  90   SLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMVYLEAPVGVGFSYSADDSSYEAVNDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+ WFL+F +Y+N   +I G
Sbjct  149  ITARDNLVFLQNWFLKFPQYKNRSLFITG  177



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = +1

Query  61   KKIMVFLLWFLLVNTLCSISIRINGEMIDS---LPGQPSDVSFTQFSGYIVTDKSRGRAL  231
            K I+V L+  LL  T  S+  R +   +D    LPGQP  V F Q+SGY+  D+ + RAL
Sbjct  9    KTIVVALV--LLHITSSSMKARASLSELDRIALLPGQP-QVGFQQYSGYVTVDEKKQRAL  65

Query  232  FYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVS  411
            FYYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP+ +  LV+N +SWN  +
Sbjct  66   FYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNREA  123

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            NMLY++TPI V +S+S  TS Y+A  D  TA +NL FL+ W  +F +Y+N   +I G
Sbjct  124  NMLYLETPIGVGFSYSTDTSSYEAVNDHITARDNLLFLQNWLEKFPQYKNRSLFITG  180



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = +1

Query  61   KKIMVFLLWFLLVNTLCSISIRINGEMIDS---LPGQPSDVSFTQFSGYIVTDKSRGRAL  231
            K I+V L+  LL  T  S+  R +   +D    LPGQP  V F Q+SGY+  D+ + RAL
Sbjct  9    KTIVVALV--LLHITSSSMKARASLSELDRIALLPGQP-QVGFQQYSGYVTVDEKKQRAL  65

Query  232  FYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVS  411
            FYYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP+ +  LV+N +SWN  +
Sbjct  66   FYYFAEAEI-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNREA  123

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            NMLY++TPI V +S+S  TS Y+A  D  TA +NL FL+ W  +F +Y+N   +I G
Sbjct  124  NMLYLETPIGVGFSYSTDTSSYEAVNDHITARDNLLFLQNWLEKFPQYKNRSLFITG  180



>ref|XP_006415698.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
 gb|ESQ34051.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
Length=463

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 106/167 (63%), Gaps = 6/167 (4%)
 Frame = +1

Query  88   FLLVNTLCSISIRI--NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSE  261
             +L +TL S S  +  + + +  LPGQP  V F Q+SGY+  D  + RALFYYFA A+  
Sbjct  14   LILFHTLLSSSSTVLPHSDRVTRLPGQPR-VGFQQYSGYVTVDDRKQRALFYYFAEAEI-  71

Query  262  DELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-  438
            D  SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ 
Sbjct  72   DPTSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLETPVG  130

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+S  +S Y+   D  TA +NL FL++WFL+F  Y N   +I G
Sbjct  131  VGFSYSTQSSSYEGVTDKITAKDNLVFLQRWFLKFPHYLNRSLFITG  177



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 113/181 (62%), Gaps = 8/181 (4%)
 Frame = +1

Query  58   IKKIMVFLLWFLLV--NTLCSISIRINGEMIDS---LPGQPSDVSFTQFSGYIVTDKSRG  222
            +K + V  + F L+  NT  S S  +  + +D    LPGQ  ++SF  +SGY+  +++ G
Sbjct  4    LKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNENSG  63

Query  223  RALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSW  399
            RALFY+F  A +ED  SKPL LWL GG  CS    G   E GPF   +DGK L  NPYSW
Sbjct  64   RALFYWFIEA-AEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  122

Query  400  NLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIA  576
            N V+N+L++D+P+ V +S+SNT+SD     D  TA ++L FL KWF RF +Y+  DFYI 
Sbjct  123  NQVANILFLDSPVGVGFSYSNTSSDVSTNGDIRTAKDSLAFLLKWFERFPQYKGRDFYIT  182

Query  577  G  579
            G
Sbjct  183  G  183



>ref|XP_010942380.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F QFSGY+  D  + RALFYYFA A+  D  +KPL LWL GG  CS
Sbjct  32   DKISKLPGQP-QVDFQQFSGYVTIDDRKQRALFYYFAEAEL-DPPTKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP++   LV+N YSWN  +NMLY++TP  V +S++N TS Y+   D 
Sbjct  90   SVGVGAFSENGPFRPSEQ-VLVRNEYSWNEEANMLYLETPAGVGFSYANDTSCYEGVNDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL +WF +F +Y++ D YI G
Sbjct  149  MTARDNLVFLLRWFTKFPQYKDRDLYITG  177



>gb|ABK25236.1| unknown [Picea sitchensis]
Length=469

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 116/183 (63%), Gaps = 11/183 (6%)
 Frame = +1

Query  49   IDIIKKIMVFLLWFLLVNTLCSISIRING----EMIDSLPGQPSDVSFTQFSGYIVTDKS  216
            +D+  K+  +L   L++  L  I+++I+G    ++ID LPGQP  V+F Q++GYI  D+ 
Sbjct  1    MDVQPKLQRWLC--LVMYILFGIAVQISGGPAEDLIDRLPGQPK-VNFKQYAGYITVDEH  57

Query  217  RGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPY  393
             GRALFYYFA A+ +D  SKP+ LWL GG  CS    G F E GPF P  DG  L KN  
Sbjct  58   AGRALFYYFAEAE-DDSDSKPVALWLNGGPGCSSVGGGAFTELGPFYPRDDGHGLRKNLQ  116

Query  394  SWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFY  570
            SWN VSN+L+V++P  V +S+SNTTSDY    D  TA   L FL KWF RF EY + D +
Sbjct  117  SWNKVSNLLFVESPAGVGWSYSNTTSDYTC-GDESTARNMLVFLSKWFKRFPEYASRDLF  175

Query  571  IAG  579
            + G
Sbjct  176  LTG  178



>ref|XP_010271869.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=465

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 4/150 (3%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             + I+ LPGQP DV+F QFSGYI  D+S+ RALFYYF  A++ D  SKPL LWL GG  C
Sbjct  33   ADRINKLPGQP-DVNFQQFSGYITVDESQQRALFYYFVEAET-DPASKPLVLWLNGGPGC  90

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S   VG F EHGPF+P+ D  LV+N YSWN  +NMLY++TP  V +S+S  +S Y    D
Sbjct  91   SSVGVGAFSEHGPFKPSGD-ILVRNDYSWNREANMLYLETPAGVGFSYSTNSSYYSNVND  149

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL FL++WF++F +YR+ D +I G
Sbjct  150  EMTAMDNLIFLQRWFIKFPQYRDRDLFITG  179



>ref|XP_006853074.2| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
Length=456

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = +1

Query  94   LVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELS  273
            +   L    ++   E++  L GQP  V F Q++GY+  D++ GRALFYYFA  ++ D LS
Sbjct  23   VARALPQHGLKEKDEIVGGLHGQPEGVEFKQYAGYVTLDETAGRALFYYFA--EAVDPLS  80

Query  274  KPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAY  447
            KPL LWL GG  CS    G   E GPFR   DGK L KN Y+WN V+N+L++++P  V Y
Sbjct  81   KPLLLWLNGGPGCSSLGYGAMEELGPFRVQSDGKTLYKNRYAWNKVANVLFLESPAGVGY  140

Query  448  SFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S+SNTT+DY    D  TA +   FL  WF RF EY+N +FYI+G
Sbjct  141  SYSNTTTDYALSGDQRTASDAYIFLINWFERFPEYKNREFYISG  184



>gb|KGN59518.1| hypothetical protein Csa_3G823660 [Cucumis sativus]
Length=378

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 98/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
            G +I SLPGQP  V+F QF GYI  D+ + R+LFYYF  AQS D  SKPL LWL GG  C
Sbjct  10   GHLIKSLPGQPI-VNFKQFGGYITIDELQSRSLFYYFVEAQS-DPTSKPLVLWLNGGPGC  67

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F E+GPFRP  D  L+ N +SWN V+N+LY+++P  V +SFS  T+ Y    D
Sbjct  68   SSLGAGAFIENGPFRPKGD-VLILNEFSWNNVANVLYLESPAGVGFSFSKNTTFYDTVND  126

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N+ FL +W  +F EY+N +FYI G
Sbjct  127  KITAQDNIVFLERWLEKFPEYKNREFYITG  156



>emb|CAN70439.1| hypothetical protein VITISV_011900 [Vitis vinifera]
Length=453

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 103/172 (60%), Gaps = 9/172 (5%)
 Frame = +1

Query  85   WFLLVNTLCSISIRINGEMID------SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            W +++ TLC   +    E +       SLPGQP  VSF QF GY+  D+ +GRALFYYF 
Sbjct  7    WMVVLATLCVAPLCFAMEPVSESDKLGSLPGQP-HVSFQQFGGYVTIDEKQGRALFYYFV  65

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A ++   SKPL LWL GG  CS    G F EHGPFRP +   L +N +SWN  +NMLYV
Sbjct  66   EAVTDPTASKPLVLWLTGGPGCSSLGGGAFMEHGPFRP-RGNTLXRNKHSWNREANMLYV  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S   S Y    D  TA +NL FL  WF++F +YRN + +I G
Sbjct  125  ESPAGVGFSYSRNKSFYDDINDEVTARDNLAFLEGWFMKFPKYRNRELFITG  176



>ref|XP_012090605.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Jatropha 
curcas]
Length=462

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 111/175 (63%), Gaps = 7/175 (4%)
 Frame = +1

Query  61   KKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYY  240
            K + V LLW  +     S+S   + + I  LPGQP  V F QFSGY+  D+ + RA FYY
Sbjct  7    KTLAVVLLWISM-EVESSLSSLSHLDKISRLPGQP-QVGFQQFSGYVTVDEKKHRAFFYY  64

Query  241  FAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNM  417
            F  A+  D +SKPL LWL GG  CS   VG F E+GPFRP  +GK LV+N YSWN  +NM
Sbjct  65   FVEAEL-DPVSKPLVLWLNGGPGCSSLGVGAFSENGPFRP--NGKVLVRNEYSWNREANM  121

Query  418  LYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            LY++TP+ V +S++  +S Y A  D  TA +NL FL++WF +F +YR  D +I G
Sbjct  122  LYLETPVGVGFSYATDSSSYVAVDDEATARDNLIFLQRWFNKFPQYRRRDLFITG  176



>ref|XP_010279514.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=491

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 97/150 (65%), Gaps = 5/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            +MI+ LPGQP  V F Q+ GY+  D+S GRALFYYFA AQ  D  SKPL LWL GG  CS
Sbjct  72   DMIERLPGQPP-VGFKQYGGYVTVDESAGRALFYYFAEAQ--DAKSKPLLLWLNGGPGCS  128

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L +N YSWN V+N++++++P  V +S+SN TSDY    D
Sbjct  129  SFGYGAMVELGPFRVHSDGKTLYENHYSWNRVANVVFLESPAGVGFSYSNKTSDYNTRGD  188

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY+  DFYIAG
Sbjct  189  GNTAQDNYVFLVNWLERFPEYKTRDFYIAG  218



>ref|XP_010653632.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI32796.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 103/172 (60%), Gaps = 9/172 (5%)
 Frame = +1

Query  85   WFLLVNTLCSISIRINGEMID------SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            W +++ TLC   +    E +       SLPGQP  VSF QF GY+  D+ +GRALFYYF 
Sbjct  7    WMVVLATLCVAPLCFAMEPVSESDKLGSLPGQP-HVSFQQFGGYVTIDEKQGRALFYYFV  65

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A ++   SKPL LWL GG  CS    G F EHGPFRP +   L +N +SWN  +NMLYV
Sbjct  66   EAVTDPTASKPLVLWLTGGPGCSSLGGGAFMEHGPFRP-RGNTLFRNKHSWNREANMLYV  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S   S Y    D  TA +NL FL  WF++F +YRN + +I G
Sbjct  125  ESPAGVGFSYSRNKSFYDDINDEVTARDNLAFLEGWFMKFPKYRNRELFITG  176



>ref|XP_010055750.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Eucalyptus 
grandis]
Length=414

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 105/161 (65%), Gaps = 7/161 (4%)
 Frame = +1

Query  100  NTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKP  279
            +TL +IS   + + I SLPGQP  VSF+Q++GYI  D+ + RALFYYF  A+++  L KP
Sbjct  25   STLSTIS---DADKIASLPGQPK-VSFSQYAGYITVDEKQQRALFYYFTEAEADPAL-KP  79

Query  280  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFS  456
            L LWL GG  CS   VG F EHGPF+P+ D  L+KN YSWN  +NMLY+++P  V +S+S
Sbjct  80   LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-VLLKNDYSWNKEANMLYIESPAGVGFSYS  138

Query  457  NTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
               S Y    D  TA +NL FL  WF +F +YR  D +I G
Sbjct  139  VNNSFYNLVDDKMTARDNLAFLCNWFEKFPQYRERDLFITG  179



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 103/157 (66%), Gaps = 4/157 (3%)
 Frame = +1

Query  112  SISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLW  291
            S ++    + I  LPGQP  V F Q+SGY+  D+ + RALFYY A A+++  +SKPL LW
Sbjct  24   SSTVLSRADRITRLPGQPR-VGFQQYSGYVTVDEKQQRALFYYLAEAETKP-ISKPLVLW  81

Query  292  LGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTS  468
            L GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S++  +S
Sbjct  82   LNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVGFSYATESS  140

Query  469  DYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             Y+   D  TA +NL FL+KWFL+F +Y N   +I G
Sbjct  141  SYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITG  177



>gb|EYU21824.1| hypothetical protein MIMGU_mgv1a006099mg [Erythranthe guttata]
Length=457

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +1

Query  73   VFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGA  252
            +FL++   +     +    + + I  LPGQP  V F QFSGY+  D+ R +ALFYYF  A
Sbjct  5    LFLVFSCFICIASCLPTHHHPDRIARLPGQPP-VDFQQFSGYVSVDEKREKALFYYFVEA  63

Query  253  QSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDT  432
            +  D  SKPL LWL GG  CS   VG F E+GPFRP  +  L++N YSWN  +NMLY+DT
Sbjct  64   EI-DPPSKPLVLWLNGGPGCSSIGVGAFSENGPFRPNVE-VLLRNEYSWNREANMLYLDT  121

Query  433  PI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            P+ V +S+S   S Y+   D  TA +NL FL+KWFL F +YRN   +I G
Sbjct  122  PVGVGFSYSTGASSYETVNDEITAKDNLVFLQKWFLDFPQYRNSSLFITG  171



>ref|XP_008783276.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=485

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 96/150 (64%), Gaps = 3/150 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+ LPGQP  V F +++GY+  D+  GRALFYYF  A   D  SKPL LWL GG  CS
Sbjct  71   DRIEYLPGQPGGVDFDEYAGYVTVDQKAGRALFYYFVLAVG-DSSSKPLLLWLNGGPGCS  129

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L +NP++WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  130  SLGYGAMQELGPFRVMSDGKTLFRNPFAWNRVANVLFLESPAGVGFSYSNTTSDYSKGGD  189

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY+  DFYIAG
Sbjct  190  RRTAEDNYVFLVNWMERFPEYKGRDFYIAG  219



>ref|XP_011652217.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
45 [Cucumis sativus]
Length=468

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 99/156 (63%), Gaps = 5/156 (3%)
 Frame = +1

Query  121  IRINGEMIDSLPGQPSD--VSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWL  294
            I    + I  LPGQPS   V+F QFSGYI  D  + RALFYYF  A + D  SKPL LWL
Sbjct  29   IVTKSDRILRLPGQPSSSTVNFQQFSGYITVDDYQNRALFYYFVEAYT-DPSSKPLLLWL  87

Query  295  GGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSD  471
             GG  CS   VG F EHGPFRP  D  L+ N +SWN V+N+LYV++P  V +SFS   + 
Sbjct  88   DGGPGCSSLGVGAFVEHGPFRPEGD-VLIHNRFSWNNVANILYVESPAGVGFSFSENITF  146

Query  472  YQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            Y    D  TA +NL FL +WF +F EY+N DF+I+G
Sbjct  147  YTTVNDTITAQDNLVFLERWFKKFPEYKNRDFFISG  182



>ref|XP_010678341.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  VSF QF+GY+  D  + ++LFYYF  AQ  D  SKPL LWL GG  CS
Sbjct  41   DKITILPGQPK-VSFKQFAGYVTVDHKKHKSLFYYFVEAQV-DPSSKPLVLWLNGGPGCS  98

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  T+ Y A  D 
Sbjct  99   SLGVGAFSENGPFRP-KGNILVKNEHSWNTEANMLYLETPVGVGFSYSIDTTGYDAVSDA  157

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FLR+WF +F +Y++ D +I G
Sbjct  158  VTARDNLVFLRRWFNKFPQYKHRDLFITG  186



>ref|XP_008240683.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=456

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = +1

Query  88   FLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDE  267
            +LL+    S +     + I SLPGQP  VSF Q++GY+  D+ + RALFYYF  A++ D 
Sbjct  9    YLLIGLSISSNSLPEADKITSLPGQPQ-VSFQQYAGYVTVDEKQQRALFYYFVEAET-DA  66

Query  268  LSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VA  444
             SKPL LWL GG  CS    G F EHGPF+P+ D  L+KN +SWN  +NMLY+++P  V 
Sbjct  67   ASKPLVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVG  125

Query  445  YSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +S+S+  S Y    D  TA +NL FL +WF +F E++N DF+I G
Sbjct  126  FSYSSNQSFYDFVNDAITANDNLVFLERWFDKFPEFKNRDFFITG  170



>ref|XP_009399958.1| PREDICTED: serine carboxypeptidase II-3-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 93/150 (62%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q++GY+  D   GRALFYYFA A   D  SKPL LW  GG  CS
Sbjct  80   DKIVKLPGQPQGVDFDQYAGYVTVDARSGRALFYYFAEAVGRDNSSKPLLLWFNGGPGCS  139

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DG+ L +NPY+WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  140  SFGYGAMEELGPFRVMSDGRTLYRNPYAWNAVANVLFLESPAGVGFSYSNTTSDYDKSGD  199

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +   FL  W  RF EY+  DFY+AG
Sbjct  200  QRTAEDAYVFLLNWMERFPEYKGRDFYLAG  229



>gb|AES77859.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=460

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = +1

Query  109  CSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTL  288
            CS ++  +   I +LPGQP  V F QFSGY+  D    +ALF+YF  A++ D +SKPL L
Sbjct  21   CSFAVS-HPNKITNLPGQP-HVDFHQFSGYVNVDDQNKKALFFYFVEAKN-DAVSKPLVL  77

Query  289  WLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTT  465
            WL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY+++PI V +S+S  T
Sbjct  78   WLNGGPGCSSLGVGAFSENGPFRP-KGEALVKNQFSWNTEANMLYLESPIGVGFSYSTDT  136

Query  466  SDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S Y+   D  TA +NL FL+ WF++F EYRN   +I G
Sbjct  137  SSYEGVNDKITARDNLIFLQNWFVKFPEYRNRSLFIVG  174



>gb|KJB31548.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=463

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q++GY+  DK + RALFYYFA A+  D  SKPL LWL GG  CS
Sbjct  32   DRISRLPGQPK-VGFQQYAGYVTVDKRKQRALFYYFAEAEV-DPASKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LVKN YSWN  +NM+Y++ P+ V +S+S   S Y+A  D 
Sbjct  90   SLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMVYLEAPVGVGFSYSADDSSYEAVNDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+ WFL+F +Y+N   +I G
Sbjct  149  ITARDNLVFLQNWFLKFPQYKNRSLFITG  177



>ref|XP_011008273.1| PREDICTED: serine carboxypeptidase-like 40 [Populus euphratica]
Length=496

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 98/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+SLPGQP  V F+Q+ GY+  DKS GRAL+YYF  AQ   E S PL LWL GG  CS
Sbjct  72   DRIESLPGQPK-VEFSQYGGYVTVDKSAGRALYYYFVEAQHSKE-SSPLLLWLNGGPGCS  129

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L KN YSWN  +N+L++++P  V +S+SNTTSDY+   D
Sbjct  130  SLAYGAMQELGPFRVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDYEKSGD  189

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY++ +FYI+G
Sbjct  190  KRTAEDNYVFLVNWLERFSEYKDREFYISG  219



>ref|XP_002298413.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
 gb|EEE83218.2| putative serine carboxypeptidase family protein [Populus trichocarpa]
Length=496

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 98/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+SLPGQP  V F+Q+ GY+  DKS GRAL+YYF  AQ   E S PL LWL GG  CS
Sbjct  72   DRIESLPGQPK-VEFSQYGGYVTVDKSAGRALYYYFVEAQHSKE-SSPLLLWLNGGPGCS  129

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L KN YSWN  +N+L++++P  V +S+SNTTSDY+   D
Sbjct  130  SLAYGAMQELGPFRVYSDGKKLYKNRYSWNYAANVLFLESPAGVGFSYSNTTSDYEKSGD  189

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY++ +FYI+G
Sbjct  190  KRTAEDNYVFLVNWLERFSEYKDREFYISG  219



>ref|XP_010549305.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 102/158 (65%), Gaps = 4/158 (3%)
 Frame = +1

Query  109  CSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTL  288
             S S+    + +  LPGQP  V F Q+SGY+  D  + RALFYYFA A++ D  SKPL L
Sbjct  26   VSSSVLSRVDRVAQLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAEA-DPASKPLVL  83

Query  289  WLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTT  465
            WL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +
Sbjct  84   WLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLETPVGVGFSYSTDS  142

Query  466  SDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S Y+   D  TA +NL FL++WFL+F +Y N   +I G
Sbjct  143  SSYEGVNDKITARDNLVFLQRWFLKFPQYLNRSLFITG  180



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 9/176 (5%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEM-----IDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            M+ L W  +   L  + I     +     I  LPGQP  V F  +SGY+  D+ + RALF
Sbjct  1    MISLPWKTIAMALVLLQITEASPLSRLDRITRLPGQP-QVGFQHYSGYVTVDEKKQRALF  59

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            YYFA A+ E   SKPL LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +N
Sbjct  60   YYFAEAEVEPA-SKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNREAN  117

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY++TPI V +S+S  T+ Y++  D  TA +NL FL+KW  +F +YRN   +I G
Sbjct  118  MLYLETPIGVGFSYSTDTASYESVNDRITARDNLMFLQKWLDKFPQYRNRSLFITG  173



>ref|XP_010549304.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 102/158 (65%), Gaps = 4/158 (3%)
 Frame = +1

Query  109  CSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTL  288
             S S+    + +  LPGQP  V F Q+SGY+  D  + RALFYYFA A++ D  SKPL L
Sbjct  26   VSSSVLSRVDRVAQLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAEA-DPASKPLVL  83

Query  289  WLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTT  465
            WL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +
Sbjct  84   WLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLETPVGVGFSYSTDS  142

Query  466  SDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S Y+   D  TA +NL FL++WFL+F +Y N   +I G
Sbjct  143  SSYEGVNDKITARDNLVFLQRWFLKFPQYLNRSLFITG  180



>ref|XP_010906017.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=485

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 103/167 (62%), Gaps = 7/167 (4%)
 Frame = +1

Query  97   VNTLCSISIRING----EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSED  264
            ++ L SIS    G    + I+ LPGQP  V F +++GY+  D+  GRALFYYF  A   D
Sbjct  54   ISNLRSISYPQQGLKKKDRIEYLPGQPEGVDFDEYAGYVTVDQKAGRALFYYFVQAVG-D  112

Query  265  ELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-  438
              SKPL LWL GG  CS    G   E GPFR   DGK L +NP++WN V+N+L++++P  
Sbjct  113  SSSKPLLLWLNGGPGCSSLGYGAMQEIGPFRVMSDGKTLFRNPFAWNGVANVLFLESPAG  172

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V +S+SNTTSDY    D  TA +N  FL  W  RF EY+  DFYIAG
Sbjct  173  VGFSYSNTTSDYSKSGDSRTAEDNYVFLVNWMERFPEYKGRDFYIAG  219



>ref|XP_006341487.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=463

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 111/178 (62%), Gaps = 4/178 (2%)
 Frame = +1

Query  49   IDIIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRA  228
            + I K + + +  FLL   +  +S   + + I  LPGQP  V F QFSGY+  D  + R+
Sbjct  3    LQISKPMAMAVFLFLLYVCVGIVSALPHPDKIIKLPGQP-QVGFQQFSGYVTVDDKKQRS  61

Query  229  LFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLV  408
            LFYYF  A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +G LVKN +SWN  
Sbjct  62   LFYYFVEAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVKNEHSWNKE  119

Query  409  SNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +NMLY+++PI V +S+S+ TS Y+   D  TA +N+ FL +WF +F +Y   + ++ G
Sbjct  120  ANMLYLESPIGVGFSYSSDTSSYETVNDEVTARDNVVFLLRWFHKFPQYSKSNLFLTG  177



>ref|XP_009759845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=463

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 109/174 (63%), Gaps = 4/174 (2%)
 Frame = +1

Query  61   KKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYY  240
            K + + +  FL   +L  ++   + + I  LPGQP  V F QFSGY+  D  + ++LFYY
Sbjct  7    KTMAMAIFLFLFCVSLGIVAALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQKSLFYY  65

Query  241  FAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNML  420
            F  A++ +  SKPL LWL GG  CS   VG F E+GPFRP +   LV+N YSWN  +NML
Sbjct  66   FVEAET-NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEYSWNKEANML  123

Query  421  YVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            Y+++PI V +S+SN TS Y+   D  TA +NL FL +WF +F +YR  + ++ G
Sbjct  124  YLESPIGVGFSYSNNTSSYETVNDEVTARDNLVFLLRWFQKFPQYRKSNLFLTG  177



>ref|XP_004136792.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis sativus]
Length=436

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 98/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
            G +I SLPGQP  V+F QF GYI  D+ + R+LFYYF  AQS D  SKPL LWL GG  C
Sbjct  10   GHLIKSLPGQPI-VNFKQFGGYITIDELQSRSLFYYFVEAQS-DPTSKPLVLWLNGGPGC  67

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F E+GPFRP  D  L+ N +SWN V+N+LY+++P  V +SFS  T+ Y    D
Sbjct  68   SSLGAGAFIENGPFRPKGD-VLILNEFSWNNVANVLYLESPAGVGFSFSKNTTFYDTVND  126

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N+ FL +W  +F EY+N +FYI G
Sbjct  127  KITAQDNIVFLERWLEKFPEYKNREFYITG  156



>ref|XP_010460580.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + + SLPGQP  V F Q+SGY+  D  + RALFYYFA A++ D  SKPL LWL GG  CS
Sbjct  60   DRVTSLPGQP-QVGFQQYSGYVTVDDKKQRALFYYFAEAET-DPTSKPLVLWLNGGPGCS  117

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +S Y+   D 
Sbjct  118  SLGVGAFSENGPFRP-KGPILVKNYHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDK  176

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++WFL+F  Y N   +I G
Sbjct  177  ITARDNLVFLQRWFLKFPHYLNRSLFITG  205



>ref|XP_002307961.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
 gb|EEE91484.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
Length=482

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 108/172 (63%), Gaps = 7/172 (4%)
 Frame = +1

Query  79   LLWFLLVNTLCSISIRINGEMID----SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++  ++  T   IS  ++   +D    SLPGQP  VSF Q+SGY+  D+++ RALFYYF 
Sbjct  7    IIMVVICATFMQISRAVDSSSVDDKILSLPGQPP-VSFQQYSGYVTVDENQDRALFYYFV  65

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A+S D  SKPL LWL GG  CS   +G F E+GPFRP   G LV+N Y WN  +NMLY+
Sbjct  66   EAES-DPASKPLVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYRWNKEANMLYL  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S   S Y    D  TA ++  FL+ WF++F EY++ DFYI G
Sbjct  125  ESPAGVGFSYSANQSFYDLVNDTITAQDSYIFLQLWFVKFPEYKDRDFYITG  176



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 97/147 (66%), Gaps = 11/147 (7%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I  LPGQP  V F QFSGY+  D    RALF+YFA A+ +D LSKPL LWL GG  CS  
Sbjct  32   ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
             VG F E+GPFRP  +G LV+N +SWN  +NMLY++TPI V +S+S  TS Y+A      
Sbjct  90   GVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYEAG-----  143

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
              +NL FL+ WF++F EYRN   +I G
Sbjct  144  --DNLVFLQNWFMKFPEYRNRSLFIVG  168



>ref|XP_008369640.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=463

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q+SGY+  D+ + +ALFYY A A+  D  SKPL LWL GG  CS
Sbjct  33   DRITGLPGQPP-VGFQQYSGYVTVDEKKQKALFYYLAEAEI-DPASKPLVLWLNGGPGCS  90

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP  +  LV+N +SWN  +NMLY++TPI V +S+S  TS Y+   D 
Sbjct  91   SLGVGAFSENGPFRPQGE-VLVRNEHSWNTEANMLYLETPIGVGFSYSTDTSSYEGVTDH  149

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+KW  +F +YRN   YI G
Sbjct  150  ITARDNLLFLQKWLEKFPQYRNRSLYITG  178



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F  FSGY+  D+ + +ALFYYF  A+  D LSKPL LWL GG  CS
Sbjct  27   DKITQLPGQPP-VEFQHFSGYVTVDEKKEKALFYYFVEAEI-DPLSKPLVLWLNGGPGCS  84

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP     L++N YSWN  +NMLY+DTPI V +S+S   S Y    D 
Sbjct  85   SIGVGAFSENGPFRPNGQ-VLLRNEYSWNREANMLYLDTPIGVGFSYSTGASSYVTVNDE  143

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++WFL+F +YRN   +I G
Sbjct  144  MTAKDNLVFLQRWFLKFPQYRNSSLFITG  172



>ref|XP_010055744.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Eucalyptus 
grandis]
Length=477

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 105/161 (65%), Gaps = 7/161 (4%)
 Frame = +1

Query  100  NTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKP  279
            +TL +IS   + + I SLPGQP  VSF+Q++GYI  D+ + RALFYYF  A+++  L KP
Sbjct  25   STLSTIS---DADKIASLPGQPK-VSFSQYAGYITVDEKQQRALFYYFTEAEADPAL-KP  79

Query  280  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFS  456
            L LWL GG  CS   VG F EHGPF+P+ D  L+KN YSWN  +NMLY+++P  V +S+S
Sbjct  80   LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-VLLKNDYSWNKEANMLYIESPAGVGFSYS  138

Query  457  NTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
               S Y    D  TA +NL FL  WF +F +YR  D +I G
Sbjct  139  VNNSFYNLVDDKMTARDNLAFLCNWFEKFPQYRERDLFITG  179



>gb|ABK25202.1| unknown [Picea sitchensis]
Length=462

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 106/168 (63%), Gaps = 8/168 (5%)
 Frame = +1

Query  79   LLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQS  258
            +L FL +  L         +++D LPGQP+ V+F Q++GY+  D+  GRALFYYF  A++
Sbjct  9    ILAFLFIKVLSGPE----SDLVDRLPGQPA-VTFKQYAGYVTVDEKSGRALFYYFVEAET  63

Query  259  EDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI  438
            +  L KPL +WL GG  CS   VG   E+GPF P + GKL  N YSWN  +NMLY++TP 
Sbjct  64   DSNL-KPLVVWLNGGPGCSSFGVGALSENGPFHP-RGGKLFGNEYSWNKEANMLYLETPA  121

Query  439  -VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             V +S+SN T+ Y    D +TA +NL+FL  WF +F EY+  D Y+ G
Sbjct  122  GVGFSYSNDTTYYLGANDAKTAEDNLQFLHGWFDKFPEYKTRDLYLTG  169



>ref|XP_010499305.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
 ref|XP_010499306.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=489

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + + SLPGQP  V F Q+SGY+  D  + RA+FYYFA A++ D  SKPL LWL GG  CS
Sbjct  58   DRVTSLPGQP-QVGFQQYSGYVTVDDKKQRAMFYYFAEAET-DPTSKPLVLWLNGGPGCS  115

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +S Y+   D 
Sbjct  116  SLGVGAFSENGPFRP-KGPILVKNLHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDK  174

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++WFL+F  Y N   +I G
Sbjct  175  ITARDNLVFLQRWFLKFPHYLNRSLFITG  203



>emb|CBI32802.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 104/172 (60%), Gaps = 9/172 (5%)
 Frame = +1

Query  85   WFLLVNTLCSISIRINGEMID------SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            W +++ TLC   +    E +       SLPGQP  VSF QF GY+  D+ +GRALFYYF 
Sbjct  7    WMVVLATLCVAPLCFAMEPVSESDKLGSLPGQP-HVSFQQFGGYVTIDEKQGRALFYYFV  65

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A ++   SKPL LWL GG  CS    G F EHGPFRP +   L++N +SWN  +NMLYV
Sbjct  66   EAVTDPTASKPLVLWLTGGPGCSSLGGGAFMEHGPFRP-RGNTLLRNKHSWNREANMLYV  124

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++P  V +S+S   S Y    D  TA +NL FL  WF++F +YRN + +I G
Sbjct  125  ESPAGVGFSYSRNKSFYDDINDEVTARDNLAFLEGWFMKFPKYRNRELFITG  176


 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 104/176 (59%), Gaps = 17/176 (10%)
 Frame = +1

Query  85   WFLLVNTLCSISIRI----------NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            W +++  +C+  +              + I SLPGQP  VSF QFSGYI  D+ + R+ F
Sbjct  339  WMMILAAVCAALVHFCSSAVESHSAQADQISSLPGQPR-VSFQQFSGYITIDEKQDRSFF  397

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            YYF  A+++    KPL +W  GG  CS  +VG   +HGPFRP+ D  L+ N YSWN  +N
Sbjct  398  YYFVEAENDTTALKPLVVWFSGGPGCS--SVGA--QHGPFRPSGD-ILLTNKYSWNREAN  452

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY ++P    +S+S  TS Y    D  TA +NL FL+ WF++F +Y+N + +IAG
Sbjct  453  MLYPESPAGTGFSYSANTSFYTNLNDEITARDNLVFLKNWFIKFPQYKNSELFIAG  508



>gb|EMT05424.1| Serine carboxypeptidase II-3 [Aegilops tauschii]
Length=504

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 94/161 (58%), Gaps = 9/161 (6%)
 Frame = +1

Query  124  RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGA-------QSEDELSKPL  282
            R   + +D+LPGQP  V F Q++GY+  D + GRALFYY A A              KPL
Sbjct  68   RKEADRVDALPGQPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGCHASGDGSSSKGKPL  127

Query  283  TLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFS  456
             LWL GG  CS    G   E GPFR   DGK L +NPYSWN  +N+L++++P  V YS+S
Sbjct  128  LLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLYRNPYSWNHAANVLFLESPAGVGYSYS  187

Query  457  NTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            NTT+DY    D  TA +   FL  W  RF EY+  DFYIAG
Sbjct  188  NTTADYDRSGDNRTAEDAYAFLASWMERFPEYKGRDFYIAG  228



>ref|XP_007137891.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
 gb|ESW09885.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
Length=467

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 112/181 (62%), Gaps = 7/181 (4%)
 Frame = +1

Query  40   TFIIDIIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSR  219
            T+  + ++  +V L     +  LC  S   + + ID LPGQP  V F QFSGY+  D  +
Sbjct  5    TWKSNTMEMAVVLLYLSFSLEVLCHPS---HADRIDELPGQPY-VGFQQFSGYVTVDDKK  60

Query  220  GRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSW  399
             ++LFYYFA +++ D  SKPL LWL GG  CS   VG F E+GPFRP  +  L+KN YSW
Sbjct  61   HKSLFYYFAESET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LIKNEYSW  118

Query  400  NLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIA  576
            N  +NMLY++TP+ V +S++  +S Y    D  TA +NL FL +WF +F +YR+ D ++ 
Sbjct  119  NKEANMLYLETPVGVGFSYAKGSSSYMTVNDEATARDNLVFLLRWFNKFPQYRSRDLFLT  178

Query  577  G  579
            G
Sbjct  179  G  179



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 6/155 (4%)
 Frame = +1

Query  130  NGEMID---SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGG  300
            N +++D    LPGQ  +VSF  ++GY+  +K  GRALFY+F  A  ED  SKPL LWL G
Sbjct  34   NQQLLDRVLKLPGQNFNVSFAHYAGYVTVNKESGRALFYWFFEAD-EDPSSKPLVLWLNG  92

Query  301  GHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDY  474
            G  CS    G+  E GPF   KDGK L  NPYSWN V+N+L++D+P+ V +S+SNT+SD 
Sbjct  93   GPGCSSIAYGLAEEIGPFHVEKDGKTLYLNPYSWNKVANILFLDSPVGVGFSYSNTSSDS  152

Query  475  QAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
                D  TA +NL+FL +WF RF +YR  DFYI G
Sbjct  153  LNNGDKRTATDNLEFLLQWFERFPQYRGSDFYITG  187



>ref|XP_008454133.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=456

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I SLPGQP  V F  +SGYI       +ALFYYFA AQ  D  SKPL LWL GG  CS
Sbjct  27   DKISSLPGQPL-VGFRHYSGYINVGDRNQKALFYYFAEAQV-DPPSKPLVLWLNGGPGCS  84

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP  +  LV+N +SWN  +NMLY++TP+ V +S+S  TS Y+A  D 
Sbjct  85   SLGVGAFSENGPFRPRGE-VLVRNEHSWNTEANMLYLETPVGVGFSYSTDTSSYEAVGDK  143

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL+FL KWF+RF  YRN   +I G
Sbjct  144  ITARDNLEFLEKWFVRFPHYRNRSLFITG  172



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 96/147 (65%), Gaps = 11/147 (7%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I  LPGQP  V F QFSGY+  D    RALF+YFA A+ +D LSKPL LWL GG  CS  
Sbjct  32   ITRLPGQP-HVQFHQFSGYVTVDDKNQRALFFYFAEAE-KDALSKPLVLWLNGGPGCSSL  89

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
             VG F E+GPFRP   G LV+N +SWN  +NMLY++TPI V +S+S  TS Y+       
Sbjct  90   GVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYE-------  141

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NL FL+ WF++F EYRN   +I G
Sbjct  142  ARDNLVFLQSWFIKFPEYRNRSLFIVG  168



>emb|CBI32801.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 96/149 (64%), Gaps = 3/149 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + + SLPGQP  VSF QF GY+  D+ +GRALFYYF  A ++   SKPL LWL GG  CS
Sbjct  8    DKLGSLPGQPH-VSFQQFGGYVTIDEKQGRALFYYFVEAVTDPTASKPLVLWLTGGPGCS  66

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
                G F EHGPFRP +   L++N +SWN  +NMLYV++P  V +S+S   S Y    D 
Sbjct  67   SLGGGAFMEHGPFRP-RGNTLLRNKHSWNREANMLYVESPAGVGFSYSRNKSFYDDINDE  125

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL  WF++F +YRN + +I G
Sbjct  126  VTARDNLAFLEGWFMKFPKYRNRELFITG  154



>ref|XP_011041403.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=476

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = +1

Query  148  SLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATV  327
            SLPGQP  VSF Q++GY+  D+++ +ALFYYF  A++ D  SKPL LWL GG  CS    
Sbjct  33   SLPGQPR-VSFQQYAGYVTVDENQDKALFYYFVEAET-DPASKPLVLWLNGGPGCSSVGA  90

Query  328  GMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAY  504
            G F EHGPFRP+  G LV+N YSWN  +NMLY+++P  V +S+S   S Y    D  T  
Sbjct  91   GAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLESPAGVGFSYSANQSFYDLVNDTITVQ  150

Query  505  ENLKFLRKWFLRFYEYRNLDFYIAG  579
            +N  FL+ WF +F EY+N D +I G
Sbjct  151  DNFVFLQNWFQKFPEYKNRDLFITG  175



>gb|EMS60816.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=506

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDEL  270
            LL++  C +S+ +  + I +LPGQP  VSF Q+SGY+  D  R R+LFYYFA A+  D  
Sbjct  17   LLISNGC-LSMAMVEDKITALPGQPP-VSFAQYSGYVEVDAMRKRSLFYYFAEAEL-DPA  73

Query  271  SKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAY  447
            +KPL LWL GG  CS   VG F E+GPFRP+ +  LV N YSWN  +NMLY+++P  V +
Sbjct  74   TKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LVGNEYSWNKEANMLYLESPAGVGF  132

Query  448  SFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S+S   S Y    D  TA +NL+FL  WF +F +Y+  D YIAG
Sbjct  133  SYSTDPSFYGGVGDSMTARDNLRFLEGWFAKFPQYKGRDLYIAG  176



>ref|XP_010906016.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=487

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F Q+ GYI  DK  GRALFYY A A S +  S+PL LWL GG  CS
Sbjct  80   DKITKLPGQPQGVDFDQYGGYITVDKEAGRALFYYLAEAASANSSSRPLVLWLNGGPGCS  139

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L KNPY+WN V+N+L++++P  V +S+SNTTSDY    D
Sbjct  140  SLGFGAMEELGPFRVMSDGKTLFKNPYAWNTVANVLFLESPAGVGFSYSNTTSDYDKSGD  199

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +   FL  W  RF EY+  DFYIAG
Sbjct  200  NKTAADAYVFLVNWMERFPEYKGRDFYIAG  229



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (64%), Gaps = 7/168 (4%)
 Frame = +1

Query  88   FLLVNTL---CSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQS  258
             +L+ TL    S ++    + I  LPGQP  V F Q+SGY+  D  + RALFYY A A++
Sbjct  13   LILLQTLSLTVSSTVLSRADRITRLPGQPR-VGFQQYSGYVNIDDKKQRALFYYLAEAET  71

Query  259  EDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI  438
            +  +SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+
Sbjct  72   K-PISKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVKNQHSWNQEANMLYLETPV  129

Query  439  -VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             V +S++  +S Y+   D  TA +NL FL+KWFL+F +Y N   +I G
Sbjct  130  GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITG  177



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 107/178 (60%), Gaps = 6/178 (3%)
 Frame = +1

Query  49   IDIIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRA  228
            +D I   +      L+ N    +S+    + I  LPGQP  VSF Q+SGY+  D +R R+
Sbjct  3    LDTIAAAVCAATVLLITNGF--LSMASAEDEIRGLPGQPP-VSFAQYSGYVAVDAARKRS  59

Query  229  LFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLV  408
            LFYYFA A+  D  +KPL LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  
Sbjct  60   LFYYFAEAEL-DPATKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LVRNEYSWNKE  117

Query  409  SNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +NMLY+++P  V +S+S   S Y    D  TA +NLKFL+ WF +F  Y+  D YI G
Sbjct  118  ANMLYLESPAGVGFSYSTDPSFYGGVGDSMTARDNLKFLQGWFAKFPRYKGRDLYITG  175



>ref|XP_006830191.1| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
 gb|ERM97607.1| hypothetical protein AMTR_s00173p00045470 [Amborella trichopoda]
Length=489

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 96/150 (64%), Gaps = 3/150 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+ LPGQP  V F Q+SGY+  D + GRALFYYF  + + D  +KPL +WL GG  CS
Sbjct  76   DKIEKLPGQPQGVDFEQYSGYVTVDPTAGRALFYYFVESPA-DSATKPLVIWLNGGPGCS  134

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L +NPY+WN V+NML++++P  V +S+SNT+SDY+   D
Sbjct  135  SLGYGAMEELGPFRVMSDGKTLFRNPYAWNQVANMLFLESPAGVGFSYSNTSSDYKLSGD  194

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +   FL  W  RF EY+  DF+I G
Sbjct  195  KRTARDAYTFLVNWLERFPEYKTRDFFITG  224



>ref|XP_008667417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA38060.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=472

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGE--MIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSED  264
            LL+    S+S +   E   I +LPGQP  V F Q+SGYI  D +  R+LFYYFA A++ D
Sbjct  21   LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  265  ELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-V  441
              +KPL LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY+++P  V
Sbjct  79   PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  442  AYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +S+S   + Y+   D  TA +NLKFL+ WF RF +Y+  D YI G
Sbjct  138  GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITG  183



>ref|XP_008667418.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF78622.1| unknown [Zea mays]
 gb|ACF84275.1| unknown [Zea mays]
 tpg|DAA38061.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=471

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGE--MIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSED  264
            LL+    S+S +   E   I +LPGQP  V F Q+SGYI  D +  R+LFYYFA A++ D
Sbjct  21   LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  265  ELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-V  441
              +KPL LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY+++P  V
Sbjct  79   PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  442  AYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +S+S   + Y+   D  TA +NLKFL+ WF RF +Y+  D YI G
Sbjct  138  GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITG  183



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = +1

Query  103  TLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA-GAQSEDELSKP  279
            T CS   +   + I  LPG+P+DVSF+ FSGYI  ++S GRALFY+      S++  SKP
Sbjct  16   TFCSRHEQ-EKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKP  74

Query  280  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSF  453
            L LWL GG  CS    G   E GPFR   DGK L  NPYSWN V+N+L++++P  V +S+
Sbjct  75   LVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSY  134

Query  454  SNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            SNTTSD     D  TA +   FL KWF RF +Y++ +FYIAG
Sbjct  135  SNTTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAG  176



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = +1

Query  103  TLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA-GAQSEDELSKP  279
            T CS   +   + I  LPG+P+DVSF+ FSGYI  ++S GRALFY+      S++  SKP
Sbjct  16   TFCSRHEQ-EKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKP  74

Query  280  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSF  453
            L LWL GG  CS    G   E GPFR   DGK L  NPYSWN V+N+L++++P  V +S+
Sbjct  75   LVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSY  134

Query  454  SNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            SNTTSD     D  TA +   FL KWF RF +Y++ +FYIAG
Sbjct  135  SNTTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAG  176



>gb|KEH35690.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=448

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 102/156 (65%), Gaps = 4/156 (3%)
 Frame = +1

Query  118  SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLG  297
            S   + + I +LPGQP +++F QFSGY+  D  + ++LFYYFA +++ D  SKPL LWL 
Sbjct  7    SPHFHADKIVTLPGQPQNIAFQQFSGYVTVDNKKHKSLFYYFAESET-DPSSKPLVLWLN  65

Query  298  GGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDY  474
            GG  CS   VG F E+GPFRP  D  L+KN +SWN  +NMLY++TP  V +S+   +S Y
Sbjct  66   GGPGCSSLGVGAFSENGPFRPNGDF-LIKNEHSWNKEANMLYLETPAGVGFSYVKGSSAY  124

Query  475  QAWC-DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
                 D ETA +NL FL +WF +F +YRN D ++ G
Sbjct  125  TTTVNDDETARDNLVFLERWFNKFPQYRNRDLFLTG  160



>tpg|DAA38059.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=466

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = +1

Query  91   LLVNTLCSISIRINGE--MIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSED  264
            LL+    S+S +   E   I +LPGQP  V F Q+SGYI  D +  R+LFYYFA A++ D
Sbjct  21   LLLGDAWSVSAQAAAEEDKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-D  78

Query  265  ELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-V  441
              +KPL LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY+++P  V
Sbjct  79   PAAKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGV  137

Query  442  AYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +S+S   + Y+   D  TA +NLKFL+ WF RF +Y+  D YI G
Sbjct  138  GFSYSTDPAFYEGVGDSMTARDNLKFLQGWFARFPQYKGRDLYITG  183



>ref|XP_011626549.1| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
Length=477

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 94/150 (63%), Gaps = 2/150 (1%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            E++  LPGQP  V+F Q++GY+  D    RALFYY   A   D  +KPL LWL GG  CS
Sbjct  56   EIVGGLPGQPEGVNFKQYAGYVTVDDQARRALFYYLTEADGADPSTKPLLLWLNGGPGCS  115

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L KN Y+WN  +N+L++++P  V +S+SNTTSDY+   D
Sbjct  116  SLGYGAMEELGPFRVYSDGKTLYKNRYAWNRAANVLFLESPAGVGFSYSNTTSDYELSGD  175

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +   FL  WF RF EY+N DFYI+G
Sbjct  176  SRTASDAYTFLINWFERFPEYKNRDFYISG  205



>ref|XP_009109757.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
Length=460

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 107/165 (65%), Gaps = 5/165 (3%)
 Frame = +1

Query  88   FLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDE  267
            F L+  L S ++  + ++I  LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ + 
Sbjct  14   FALIFFLSSSTVLSHSDLITRLPGQPR-VGFQQYSGYVTLDEKKQRALFYYFAEAET-NP  71

Query  268  LSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VA  444
             SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V 
Sbjct  72   TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  445  YSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +S+S T   Y++  D  TA +NL FL +WFL+F  Y N   +I G
Sbjct  131  FSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITG  174



>gb|KFK44682.1| hypothetical protein AALP_AA1G289900 [Arabis alpina]
Length=463

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + +  LPGQP  V F Q+SGY+  D+++ RALFYYFA A++ +  SKPL LWL GG  CS
Sbjct  31   DRVTRLPGQPL-VGFEQYSGYVTVDETKQRALFYYFAEAET-NPTSKPLVLWLNGGPGCS  88

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +S Y+   D 
Sbjct  89   SLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDK  147

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++WFL+F  Y N   +I G
Sbjct  148  ITAKDNLVFLQRWFLKFPHYLNRSLFITG  176



>ref|XP_007203526.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
 gb|EMJ04725.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
Length=461

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 105/165 (64%), Gaps = 10/165 (6%)
 Frame = +1

Query  88   FLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDE  267
            FL+ N+L         + I SLPGQP  VSF Q++GY+  D+ + RALFYYF  A++ D 
Sbjct  20   FLIANSLPE------ADKITSLPGQPQ-VSFQQYAGYVTVDEKQQRALFYYFVEAET-DA  71

Query  268  LSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VA  444
             SKPL LWL GG  CS    G F EHGPF+P+ D  L+KN +SWN  +NMLY+++P  V 
Sbjct  72   ASKPLVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLESPAGVG  130

Query  445  YSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +S+S+  S Y    D  TA +N  FL +WF +F E++N DF+I G
Sbjct  131  FSYSSNQSFYDFVNDAITANDNFVFLERWFDKFPEFKNRDFFITG  175



>ref|XP_010279511.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Nelumbo 
nucifera]
Length=493

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 95/150 (63%), Gaps = 5/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            +MI+ LPGQP  V F Q+ GY+  D+S GRALFYYF  AQ  D  SKPL LWL GG  CS
Sbjct  72   DMIERLPGQPP-VGFKQYGGYVTVDESAGRALFYYFVEAQ--DPKSKPLLLWLNGGPGCS  128

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DGK L +N YSWN V N+L++++P  V +S+SN TSDY    D
Sbjct  129  SLGYGAMEELGPFRVHSDGKTLYENRYSWNRVVNVLFLESPAGVGFSYSNRTSDYATRGD  188

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY+  DFYIAG
Sbjct  189  QSTAEDNYVFLVNWLERFPEYKTRDFYIAG  218



>ref|XP_004152156.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis sativus]
 gb|KGN52977.1| hypothetical protein Csa_4G008800 [Cucumis sativus]
Length=456

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I SLPGQP  V F  +SGY+       +ALFYYFA AQ  D  SKPL LWL GG  CS
Sbjct  27   DKISSLPGQPL-VGFRHYSGYVNVGDRNQKALFYYFAEAQV-DPPSKPLVLWLNGGPGCS  84

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP  +  LV+N +SWN  +NMLY++TP+ V +S+S  TS Y+A  D 
Sbjct  85   SLGVGAFSENGPFRPRGE-VLVRNEHSWNTEANMLYLETPVGVGFSYSTDTSSYEAVGDK  143

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL+FL KWF+RF  YRN   +I G
Sbjct  144  ITARDNLEFLEKWFVRFPHYRNRSLFITG  172



>ref|XP_010261659.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=484

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 97/150 (65%), Gaps = 5/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQPS V+F Q+ GY+  D S GRALFYYF   ++ D +S+PL LWL GG  CS
Sbjct  69   DRISMLPGQPS-VNFNQYGGYVTVDGSAGRALFYYFV--EAPDAMSRPLVLWLNGGPGCS  125

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR   DG+ L +NPY+WN V+N+L++++P  V +S+SNT+SDY    D
Sbjct  126  SLGDGAMTELGPFRVQSDGRTLYRNPYAWNQVANVLFLESPAGVGFSYSNTSSDYSTRGD  185

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY+  DFYI G
Sbjct  186  QSTAEDNYVFLVNWLERFPEYKTRDFYIVG  215



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I  LPGQP +V F  FSGY+  D    +ALF+YF  AQ +D +SKPL LWL GG  CS  
Sbjct  33   IIHLPGQP-NVEFNHFSGYVNVDDKNNKALFFYFVEAQ-QDSVSKPLVLWLNGGPGCSSI  90

Query  322  TVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFET  498
             VG F E+GPFRP  +G LV+N +SWN  +NMLY+++PI V +S+S  TS Y    D  T
Sbjct  91   GVGAFSENGPFRPKGEG-LVRNQFSWNTEANMLYLESPIGVGFSYSTDTSSYGGVNDKIT  149

Query  499  AYENLKFLRKWFLRFYEYRNLDFYIAG  579
            A +NL FL+ WF++F +YRN   +I G
Sbjct  150  ARDNLIFLQNWFVQFPQYRNRSLFIVG  176



>gb|KCW90016.1| hypothetical protein EUGRSUZ_A02215 [Eucalyptus grandis]
Length=469

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 111/177 (63%), Gaps = 8/177 (5%)
 Frame = +1

Query  64   KIMVFLLWFLLVNTLCSISI---RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            +++ +L    L  TLCS S        + I SLPGQP  VSF Q++GY+  D+ + RALF
Sbjct  4    QLVPWLAAATLCATLCSSSTLGTTSEADKIASLPGQP-KVSFGQYAGYVTVDEKQQRALF  62

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            +YFA A++ D  SKPL LWL GG  CS   +G F EHGPF+P  D  L+KN YSWN  +N
Sbjct  63   FYFAEAEA-DPASKPLVLWLNGGPGCSSIGLGSFSEHGPFKPRGD-VLLKNDYSWNKEAN  120

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAY-ENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY+++P  V +S+S  TS Y +  D  T   +NL FLR WF +F EY+  DF+I G
Sbjct  121  MLYLESPAGVGFSYSVHTSYYSSVDDEMTEQRDNLAFLRSWFEKFPEYKERDFFITG  177



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  VSF QFSGYI  D  + RALFYYFA A+  D  +KPL LWL GG  CS
Sbjct  32   DKITKLPGQP-QVSFQQFSGYITVDDRKQRALFYYFAEAEL-DPSTKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+    LV+N YSWN  +NMLY++TP  V +S++  +S Y+   D 
Sbjct  90   SVGVGAFSENGPFRPSGQ-LLVRNEYSWNKEANMLYLETPAGVGFSYATDSSYYEGVNDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL +WF +F +Y++ D YI G
Sbjct  149  MTARDNLVFLLRWFTKFPQYKDRDLYITG  177



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F QFSGYI  D  + RALFYYF  A+  D  +KPL LWL GG  CS
Sbjct  32   DKISKLPGQP-QVDFQQFSGYITVDDRKQRALFYYFTEAEL-DPSAKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP++   LV+N YSWN  +NMLY++TP  V +S++N TS Y+   D 
Sbjct  90   SVGVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLETPAGVGFSYANDTSCYEGVDDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL +WF +F +Y+  D YI G
Sbjct  149  MTARDNLVFLLRWFSKFPQYKVRDLYITG  177



>ref|XP_009599118.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana tomentosiformis]
Length=457

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 11/175 (6%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRING----EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFY  237
            M   ++F L   LC+     NG    + I  LPGQP  V F QFSGY+  D  + RALFY
Sbjct  1    MTLSIFFFL---LCAFVGIANGFPQPDKIILLPGQP-QVGFQQFSGYVTVDDKKQRALFY  56

Query  238  YFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNM  417
            YF  A+  +  SKPL LWL GG  CS   VG F E+GPFRP     LVKN YSWN  +NM
Sbjct  57   YFVEAEI-NPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVKNEYSWNKEANM  114

Query  418  LYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            LY+++PI V +S+S  TS Y+   D  TA +N+ FL++WF +F +YRN + ++ G
Sbjct  115  LYLESPIGVGFSYSTNTSSYETVNDVTTARDNVVFLQRWFNKFPQYRNSNLFLTG  169



>emb|CDX90124.1| BnaA08g18600D [Brassica napus]
Length=460

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 107/165 (65%), Gaps = 5/165 (3%)
 Frame = +1

Query  88   FLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDE  267
            F L+  L S ++  + +++  LPGQP  V F Q+SGY+  D+ + RALFYYFA A++ + 
Sbjct  14   FALIFFLSSSTVLSHSDLVTRLPGQPR-VGFQQYSGYVTLDEKKQRALFYYFAEAET-NP  71

Query  268  LSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VA  444
             SKPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V 
Sbjct  72   TSKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLETPVGVG  130

Query  445  YSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +S+S T   Y++  D  TA +NL FL +WFL+F  Y N   +I G
Sbjct  131  FSYS-TQRSYESVDDKITARDNLVFLERWFLKFPHYLNRSLFITG  174



>ref|XP_008443351.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=472

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
            G++I SLPGQP  V+F Q+ GYI  D+ + R+LFYYF  AQS D  SKPL LWL GG  C
Sbjct  18   GDLIKSLPGQPI-VNFKQYGGYITIDELQSRSLFYYFVEAQS-DPSSKPLVLWLNGGPGC  75

Query  313  SIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
            S    G F E+GPFRP K   L+ N +SWN V+N+LY+++P  V +SFS  T+ Y    D
Sbjct  76   SSLGAGAFVENGPFRP-KGNVLILNEFSWNNVANVLYLESPAGVGFSFSKNTTFYDTVND  134

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N+ FL +W  +F EY+N +FYI G
Sbjct  135  KITAQDNIVFLERWLEKFPEYKNKEFYITG  164



>gb|EAY93940.1| hypothetical protein OsI_15713 [Oryza sativa Indica Group]
Length=470

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I +LPGQP +VSF Q+SGY+  D +R R LFYYFA A+  D  +KPL LWL GG  CS
Sbjct  35   DRIVALPGQP-NVSFAQYSGYVTVDAARRRELFYYFAEAEL-DPATKPLVLWLNGGPGCS  92

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LV+N YSWN  +NMLY+++P  V +S+S   S Y    D 
Sbjct  93   SVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDS  151

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL+FL+ WF +F +Y+  D YI G
Sbjct  152  RTARDNLRFLQGWFAKFPQYKGRDLYITG  180



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 107/176 (61%), Gaps = 4/176 (2%)
 Frame = +1

Query  55   IIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            + ++IM   L  L+   +   S     + I  LPGQP  V F Q+SGY+  D+ + +ALF
Sbjct  4    VSREIMALPLALLICFFIGVESSFSQFDRITQLPGQPP-VWFQQYSGYVTVDEKKQKALF  62

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            YYFA A+  D  SKPL LWL GG  CS   VG F E+GPFRP+    LVKN YSWN  +N
Sbjct  63   YYFAEAEL-DCASKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNREAN  120

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY++TPI V +S+S   S Y+   D  TA +NL FL+KWF+ F  YRN   +I G
Sbjct  121  MLYLETPIGVGFSYSANASSYEGVNDKITARDNLVFLQKWFVNFPHYRNRSLFITG  176



>gb|KCW64995.1| hypothetical protein EUGRSUZ_G02537, partial [Eucalyptus grandis]
Length=477

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 97/174 (56%), Gaps = 29/174 (17%)
 Frame = +1

Query  79   LLWF--LLVNTLCSI--SIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            ++W+  ++VN +  +  S     E+I  LPGQP  VSF Q SGYI TD  RG ALFYYF 
Sbjct  1    MIWYFIVIVNGVIPLFSSCTSTAELIKKLPGQPDGVSFKQHSGYITTDPRRGHALFYYFV  60

Query  247  GAQSEDELSKPLTLWLGGGH------------------------DCSIATVGMFYEHGPF  354
             A + D LS PLTLW  GG                          CS    G F EHGPF
Sbjct  61   EADARDPLSYPLTLWFNGGMVVLVLVHYCLRHCLPILIYFGLGPGCSSLGFGAFEEHGPF  120

Query  355  RPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENL  513
            RP  DG L KN +SWN VSNMLYV++PI V +S+SNTTSDY  W D +T   +L
Sbjct  121  RPAGDGGLTKNEFSWNKVSNMLYVESPIGVGFSYSNTTSDYVNWTDADTGTSDL  174



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 99/150 (66%), Gaps = 6/150 (4%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F QFSGY+  D ++ RALFYYF  A+  D  SKPL LWL GG  CS
Sbjct  32   DKIAGLPGQP-HVGFQQFSGYVTVDGNKHRALFYYFVEAEI-DPASKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
               VG F E+GPFRP  +G+ L++N +SWN  +NMLY++TP+ V +S+S   S Y A  D
Sbjct  90   SLGVGAFSENGPFRP--NGRVLIRNEHSWNREANMLYLETPVGVGFSYSTDNSSYVAVDD  147

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +NL FL+ WF +F +YRN D +I G
Sbjct  148  EATARDNLVFLQGWFHKFPQYRNKDLFITG  177



>ref|NP_001052663.1| Os04g0396800 [Oryza sativa Japonica Group]
 emb|CAE05146.2| OSJNBa0039C07.2 [Oryza sativa Japonica Group]
 dbj|BAF14577.1| Os04g0396800 [Oryza sativa Japonica Group]
 gb|EAZ30581.1| hypothetical protein OsJ_14632 [Oryza sativa Japonica Group]
 dbj|BAG91822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I +LPGQP +VSF Q+SGY+  D +R R LFYYFA A+  D  +KPL LWL GG  CS
Sbjct  35   DRIVALPGQP-NVSFAQYSGYVTVDAARRRELFYYFAEAEL-DPATKPLVLWLNGGPGCS  92

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  LV+N YSWN  +NMLY+++P  V +S+S   S Y    D 
Sbjct  93   SVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLESPAGVGFSYSTDPSFYGGVGDS  151

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL+FL+ WF +F +Y+  D YI G
Sbjct  152  RTARDNLRFLQGWFAKFPQYKGRDLYITG  180



>ref|XP_009615672.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nicotiana 
tomentosiformis]
Length=463

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 108/174 (62%), Gaps = 4/174 (2%)
 Frame = +1

Query  61   KKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYY  240
            K + + +  FL   +L  +S   + + I  LPGQP  V F QFSGY+  D  + R+LFYY
Sbjct  7    KTMAMAIFLFLFCVSLGIVSALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQRSLFYY  65

Query  241  FAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNML  420
            F  A++ +  SKPL LWL GG  CS   VG F E+GPFRP +   LV+N +SWN  +NML
Sbjct  66   FVEAET-NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANML  123

Query  421  YVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            Y+++PI V +S+SN TS Y+   D  TA +NL FL +WF +F  YR  + ++ G
Sbjct  124  YLESPIGVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTG  177



>ref|XP_002462503.1| hypothetical protein SORBIDRAFT_02g026870 [Sorghum bicolor]
 gb|EER99024.1| hypothetical protein SORBIDRAFT_02g026870 [Sorghum bicolor]
Length=507

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
             + I SLPGQP  V+F QFSGY+  D+  GRALFYYF      D  SKPL LWL GG  C
Sbjct  80   ADRIKSLPGQPPRVNFEQFSGYVTVDEEHGRALFYYFV-ESPYDAASKPLVLWLNGGPGC  138

Query  313  SIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            S    G   E GPFR   DGK L +N +SWN V+N++++++P  V +S+SNT+SDY    
Sbjct  139  SSLGAGAMAELGPFRVNPDGKTLSRNRHSWNNVANVIFLESPAGVGFSYSNTSSDYDKSG  198

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA ++  F+  W  RF EY+  DFYIAG
Sbjct  199  DKRTAMDSYNFILNWLERFPEYKGRDFYIAG  229



>ref|XP_011025505.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Populus 
euphratica]
Length=453

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+SLPGQP  V F+Q+ GY+  D+S GRAL+YYFA AQ   E S PL LWL GG  CS
Sbjct  74   DRIESLPGQPK-VEFSQYGGYVTVDESAGRALYYYFAEAQHSKE-SLPLLLWLNGGPGCS  131

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
              + G   E GPFR   DG+ L KN +SWN  +N+L++++P  V +S+SNTTSDY+   D
Sbjct  132  SLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGD  191

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY++ DFYI+G
Sbjct  192  KMTAEDNYVFLVNWLERFPEYKDRDFYISG  221



>ref|XP_004513403.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I SLP QP +V F Q++GYI  D+ + RAL+YYF  A+  D  SKP+ LWL GG  CS
Sbjct  33   DKIKSLPEQP-EVEFKQYAGYITVDEVQQRALYYYFVEAEV-DPASKPVVLWLNGGPGCS  90

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F EHGPF+P K G L+KN YSWN  +NMLY+++P  V +S+S   S Y    D 
Sbjct  91   SIGVGAFVEHGPFKPAKKG-LMKNDYSWNKEANMLYLESPAGVGFSYSVNESFYDLVNDE  149

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL+ WF +F EY+N DF++ G
Sbjct  150  MTARDNLIFLQHWFTKFSEYKNNDFFLTG  178



>gb|ACN29008.1| unknown [Zea mays]
 tpg|DAA63952.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=524

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = +1

Query  124  RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELS--KPLTLWLG  297
            R   + +D LPGQPS V F Q++GY+  D + GRALFYY A A      S  KPL LWL 
Sbjct  74   RKEDDRVDRLPGQPSGVDFEQYAGYVTVDAAAGRALFYYLAEAVGGGSASAAKPLLLWLN  133

Query  298  GGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSD  471
            GG  CS    G   E GPFR   DGK L +NPY+WN  +N+L++++P  V +S+SNTT+D
Sbjct  134  GGPGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAANVLFLESPAGVGFSYSNTTAD  193

Query  472  YQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            Y    D +TA + L+FL  W  +F EY+  D Y+AG
Sbjct  194  YSRSGDNKTAEDALRFLLNWMEKFPEYKGRDLYLAG  229



>ref|XP_010068956.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
Length=489

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 98/150 (65%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F  + GY+  DKS GRA +YYFA A  +++ S PL LWL GG  CS
Sbjct  75   DRIKRLPGQPP-VEFDHYGGYVTVDKSAGRAFYYYFAEA-GQNKDSVPLLLWLNGGPGCS  132

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   EHGPFR   DGK L KN ++WN+ +NML++++P  V +S+SNTTSDY+   D
Sbjct  133  SLGYGATQEHGPFRVHSDGKTLYKNKFAWNIAANMLFLESPAGVGFSYSNTTSDYRTNGD  192

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +N  FL  W  RF EY+N DFYI+G
Sbjct  193  SKTAADNYVFLLNWLERFPEYKNRDFYISG  222



>ref|XP_008777392.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F QFSGYI  D  + RALFYYF  A+  D  +KPL LWL GG  CS
Sbjct  32   DKISKLPGQP-QVDFQQFSGYITVDDRKQRALFYYFTEAEL-DPSAKPLVLWLNGGPGCS  89

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP++   LV+N YSWN  +NMLY++TP  V +S++N TS Y+   D 
Sbjct  90   SVGVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLETPAGVGFSYANDTSCYEGVDDK  148

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL +WF +F +Y+  D YI G
Sbjct  149  MTARDNLVFLLRWFSKFPQYKVRDLYITG  177



>ref|XP_008374178.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=467

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 98/148 (66%), Gaps = 6/148 (4%)
 Frame = +1

Query  142  IDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIA  321
            I  LPGQP  V F QFSGYI  D    +ALFYYFA A   +  SKPL LWL GG  CS  
Sbjct  39   ITRLPGQP-HVGFQQFSGYITVDDHNHKALFYYFAEADI-NPASKPLVLWLNGGPGCSSL  96

Query  322  TVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFE  495
             VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++TP+ V +S+S + S Y A  D  
Sbjct  97   GVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYSKSNSSYMAVDDEA  154

Query  496  TAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TA  NL FL++W  +F +YR++D ++AG
Sbjct  155  TARXNLVFLQRWLNKFPQYRHMDLFLAG  182



>ref|XP_009615670.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nicotiana 
tomentosiformis]
Length=464

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 108/174 (62%), Gaps = 4/174 (2%)
 Frame = +1

Query  61   KKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYY  240
            K + + +  FL   +L  +S   + + I  LPGQP  V F QFSGY+  D  + R+LFYY
Sbjct  7    KTMAMAIFLFLFCVSLGIVSALPHPDKIIQLPGQP-QVGFQQFSGYVTVDDKKQRSLFYY  65

Query  241  FAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNML  420
            F  A++ +  SKPL LWL GG  CS   VG F E+GPFRP +   LV+N +SWN  +NML
Sbjct  66   FVEAET-NPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANML  123

Query  421  YVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            Y+++PI V +S+SN TS Y+   D  TA +NL FL +WF +F  YR  + ++ G
Sbjct  124  YLESPIGVGFSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTG  177



>ref|XP_010318664.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Solanum 
lycopersicum]
Length=424

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 109/172 (63%), Gaps = 6/172 (3%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            + VFL  FLL   +  +S   + + I  LPGQP  V F QFSGY+  D  + R+LFYYF 
Sbjct  3    MAVFL--FLLYAYVGIVSALPHPDKITKLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFV  59

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +G LV N +SWN  +NMLY+
Sbjct  60   EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVINEHSWNKEANMLYL  117

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++PI V +S+S+ TS Y+   D  TA +N+ FL +WF +F +YR  + ++ G
Sbjct  118  ESPIGVGFSYSSDTSSYETVNDEITARDNVVFLLRWFHKFPQYRKSNLFLTG  169



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 104/177 (59%), Gaps = 16/177 (9%)
 Frame = +1

Query  94   LVNTLCSISI-------------RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            LVN L +I++             R   + +  LPGQ  +VSF  +SG+I T++  GRALF
Sbjct  9    LVNALIAIALLATTAHLCEAGLSRKEQDKVSKLPGQNFNVSFAHYSGFITTNEKLGRALF  68

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVS  411
            Y+F  A  ED  SKPL LWL GG  CS    G   E GPF    DGK L  N YSWN  +
Sbjct  69   YWFFEA-VEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAA  127

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            N+L++D P+ V YS+SNT+SD Q   D  TA ++LKFL KW  RF EY+  DFYI G
Sbjct  128  NILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIVG  184



>ref|XP_003577529.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=468

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 106/171 (62%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            MV LL    +  L S +    G+ I  LPGQP +VSF Q+SGYI  D    RALFYYF  
Sbjct  13   MVSLLLIAALCHLGSCNGGGRGDRITKLPGQP-EVSFGQYSGYIGVDGKGSRALFYYFVE  71

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+  D +SKPL LWL GG  CS   VG F E+GPFRP+    LVKN YSWN  +N++Y++
Sbjct  72   AEL-DPISKPLVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLE  129

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TP  V YS+S   + YQ   D  TA +N+ F+++W  +F +Y+  + YIAG
Sbjct  130  TPAGVGYSYSADAAYYQGVNDKMTAMDNMVFMQRWLEKFPQYKGRELYIAG  180



>ref|XP_007052442.1| Serine carboxypeptidase-like 40 [Theobroma cacao]
 gb|EOX96599.1| Serine carboxypeptidase-like 40 [Theobroma cacao]
Length=542

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+ LPGQP DV F+Q+ GY+  DKS GRAL+YYFA AQ   E S PL LWL GG  CS
Sbjct  116  DRIEKLPGQP-DVQFSQYGGYVTVDKSAGRALYYYFAEAQHSKE-SLPLLLWLNGGPGCS  173

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
                G   E GPFR    GK L +N YSWN  +N+L++++P  V +S+SN TSDY    D
Sbjct  174  SLAYGAMQELGPFRVHSTGKTLYRNSYSWNYAANVLFLESPAGVGFSYSNRTSDYNESGD  233

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             +TA +N  FL  W  RF EY+  DFYI+G
Sbjct  234  SKTAADNYVFLLNWLERFPEYKGRDFYISG  263



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 100/167 (60%), Gaps = 4/167 (2%)
 Frame = +1

Query  88   FLLVNTLCSISI-RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSED  264
            FL    LC   + +   + +  LPGQ  DVSF  +SG++ T++  GRALFY+   A  ED
Sbjct  38   FLATAHLCEAGLSQKEQDKVSKLPGQNFDVSFAHYSGFVTTNEKLGRALFYWLFEA-VED  96

Query  265  ELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-  438
              SKPL LWL GG  CS    G   E GPF    DGK L  N YSWN  +N+L++D P+ 
Sbjct  97   AKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANILFLDAPVG  156

Query  439  VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            V YS+SNT+SD Q   D  TA ++LKFL KW  RF EY+  DFYI G
Sbjct  157  VGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIVG  203



>gb|KHN08897.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=451

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  +  +L  TL  ++     + I +LPGQP  V F Q+SGY   D    RALFYYF  
Sbjct  1    MIATIIIVLAQTLVGVNSLPEADKISNLPGQP-HVKFQQYSGYFSVDNQNQRALFYYFVE  59

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+ +   SKP+ LWL GG  CS   VG   EHGPF+P  +  LVKN +SWN V+N+LY++
Sbjct  60   AE-KHPTSKPVVLWLNGGPGCSSIGVGALVEHGPFKPDSN-VLVKNHFSWNKVANVLYLE  117

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S+  S Y    D  TA +NL FL++WF  F EY N DF+I G
Sbjct  118  SPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITG  168



>ref|NP_001147904.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG29071.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=524

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = +1

Query  124  RINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELS--KPLTLWLG  297
            R   + +D LPGQPS V F Q++GY+  D + GRALFYY A A      S  KPL LWL 
Sbjct  74   RKEDDRVDRLPGQPSGVDFEQYAGYVTVDAAAGRALFYYLAEAVGGGSASAAKPLLLWLN  133

Query  298  GGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSD  471
            GG  CS    G   E GPFR   DGK L +NPY+WN  +N+L++++P  V +S+SNTT D
Sbjct  134  GGPGCSSLGYGAMEELGPFRVKSDGKTLYRNPYAWNNAANVLFLESPAGVGFSYSNTTED  193

Query  472  YQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            Y    D +TA + L+FL  W  +F EY+  D Y+AG
Sbjct  194  YSRSGDNKTAEDALRFLLNWMEKFPEYKGRDLYLAG  229



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 110/177 (62%), Gaps = 7/177 (4%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSIS----IRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            +++FLL   L +   ++     ++   + +  LPGQ  +VSF  ++GY+  ++  GRALF
Sbjct  9    VLIFLLNLHLGSVFATVPTDPLVQQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRALF  68

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVS  411
            Y+F  A +ED  SKPL LWL GG  CS    GM  E GPF    DGK L  NPYSWN V+
Sbjct  69   YWFVEA-AEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNPYSWNQVA  127

Query  412  NMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            N+L++D+P+ V +S+SNT+SD  +  D  TA ++L FL KW  R+ +Y+  DFYI G
Sbjct  128  NILFLDSPVGVGFSYSNTSSDLMSNGDKRTASDSLAFLLKWLERYPQYKGRDFYITG  184



>ref|XP_011025504.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Populus 
euphratica]
Length=498

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 4/150 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I+SLPGQP  V F+Q+ GY+  D+S GRAL+YYFA AQ   E S PL LWL GG  CS
Sbjct  74   DRIESLPGQPK-VEFSQYGGYVTVDESAGRALYYYFAEAQHSKE-SLPLLLWLNGGPGCS  131

Query  316  IATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCD  489
              + G   E GPFR   DG+ L KN +SWN  +N+L++++P  V +S+SNTTSDY+   D
Sbjct  132  SLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGD  191

Query  490  FETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              TA +N  FL  W  RF EY++ DFYI+G
Sbjct  192  KMTAEDNYVFLVNWLERFPEYKDRDFYISG  221



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 110/184 (60%), Gaps = 3/184 (2%)
 Frame = +1

Query  34   AFTFIIDIIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDK  213
            +F F I     I V L   +  ++L     + + + +  LPGQ  DV+F  +SGY+  ++
Sbjct  10   SFEFSIATTLIIFVNLYLGVFASSLRDPVAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNE  69

Query  214  SRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNP  390
              GRALFY+F  A  ED  SKPL LWL GG  CS    GM  E GPF    DGK L  NP
Sbjct  70   KYGRALFYWFVEA-VEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNP  128

Query  391  YSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDF  567
            YSWN V+N+L++D+P+ V YS+SNT+SD     D +TA ++L FL  WF RF +Y+  DF
Sbjct  129  YSWNQVANILFLDSPVGVGYSYSNTSSDLLNNGDKKTAADSLAFLLNWFERFPQYKGRDF  188

Query  568  YIAG  579
            YI G
Sbjct  189  YITG  192



>ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69763.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 98/151 (65%), Gaps = 4/151 (3%)
 Frame = +1

Query  130  NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHD  309
            + + +  LPGQP  V F Q+SGY+  D  + RALFYYFA A++    SKPL LWL GG  
Sbjct  29   HSDRVTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPG  86

Query  310  CSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +S Y+   
Sbjct  87   CSSLGVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVN  145

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA +NL FL++WFL+F  Y N   +I G
Sbjct  146  DKITARDNLVFLQRWFLKFPHYLNRSLFITG  176



>ref|XP_004241645.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=457

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 111/178 (62%), Gaps = 15/178 (8%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRI-------NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRA  228
            M   L+F L   LC+ S+RI       + + I  LPGQP  V F QFSGY+  D  + RA
Sbjct  1    MALSLFFFL---LCA-SVRIGYAFPPHHPDKIILLPGQP-QVGFQQFSGYVTVDDKKQRA  55

Query  229  LFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLV  408
            LFYYF  A++ D  SKPL LWL GG  CS   VG F E+GPFRP +   LVKN +SWN  
Sbjct  56   LFYYFVEAET-DPASKPLVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVKNEHSWNKE  113

Query  409  SNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +NMLY+++P+ V +S+S  TS Y+   D  TA +N+ FL++WF +F +YR  + ++ G
Sbjct  114  ANMLYLESPVGVGFSYSTNTSSYETVNDEITARDNVVFLQRWFNKFPQYRENNLFLTG  171



>ref|XP_004235841.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=455

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 109/172 (63%), Gaps = 6/172 (3%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            + VFL  FLL   +  +S   + + I  LPGQP  V F QFSGY+  D  + R+LFYYF 
Sbjct  3    MAVFL--FLLYAYVGIVSALPHPDKITKLPGQP-QVGFQQFSGYVTVDDKKQRSLFYYFV  59

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +G LV N +SWN  +NMLY+
Sbjct  60   EAET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVINEHSWNKEANMLYL  117

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            ++PI V +S+S+ TS Y+   D  TA +N+ FL +WF +F +YR  + ++ G
Sbjct  118  ESPIGVGFSYSSDTSSYETVNDEITARDNVVFLLRWFHKFPQYRKSNLFLTG  169



>ref|XP_012072734.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Jatropha 
curcas]
 ref|XP_012072735.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Jatropha 
curcas]
 gb|KDP37690.1| hypothetical protein JCGZ_06347 [Jatropha curcas]
Length=467

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 107/176 (61%), Gaps = 8/176 (5%)
 Frame = +1

Query  55   IIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            IIK  +   +  L    L +  I    + I  LPGQP +VSF Q++GYI  D++  RALF
Sbjct  7    IIKATICVTVLLLAAQCLSASEI----DEIVKLPGQP-EVSFKQYAGYITIDENHKRALF  61

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            YYF  A+  +  SKPL LWL GG  CS    G F EHGPF+P+ D  L+KN +SWN  +N
Sbjct  62   YYFVEAEI-NSASKPLVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-ILLKNDFSWNKEAN  119

Query  415  MLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            MLY+++P  V +S+S   S Y +  D  TA +NL FL  WF +F EY++ DF+I G
Sbjct  120  MLYLESPAGVGFSYSANDSFYASVNDEITAQDNLAFLEHWFSKFPEYKDRDFFITG  175



>ref|XP_003554111.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=460

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            M+  +  +L  TL  ++     + I +LPGQP  V F Q+SGY   D    RALFYYF  
Sbjct  10   MIATIIIVLAQTLVGVNSLPEADKISNLPGQP-HVKFQQYSGYFSVDNQNQRALFYYFVE  68

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A+ +   SKP+ LWL GG  CS   VG   EHGPF+P  +  LVKN +SWN V+N+LY++
Sbjct  69   AE-KHPTSKPVVLWLNGGPGCSSIGVGALVEHGPFKPDSN-VLVKNHFSWNKVANVLYLE  126

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +P  V +S+S+  S Y    D  TA +NL FL++WF  F EY N DF+I G
Sbjct  127  SPAGVGFSYSSNASFYTLVTDEITARDNLVFLQRWFTEFPEYSNNDFFITG  177



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 110/184 (60%), Gaps = 3/184 (2%)
 Frame = +1

Query  34   AFTFIIDIIKKIMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDK  213
            +F F I     I V L   +  ++L     + + + +  LPGQ  DV+F  +SGY+  ++
Sbjct  10   SFEFSIATTLIIFVNLYLGVFASSLRDPVAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNE  69

Query  214  SRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNP  390
              GRALFY+F  A  ED  SKPL LWL GG  CS    GM  E GPF    DGK L  NP
Sbjct  70   KYGRALFYWFVEA-VEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNP  128

Query  391  YSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDF  567
            YSWN V+N+L++D+P+ V YS+SNT+SD     D +TA ++L FL  WF RF +Y+  DF
Sbjct  129  YSWNQVANILFLDSPVGVGYSYSNTSSDLLNNGDKKTAADSLAFLLNWFERFPQYKGRDF  188

Query  568  YIAG  579
            YI G
Sbjct  189  YITG  192



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 111/180 (62%), Gaps = 11/180 (6%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSIS----IRINGEM----IDSLPGQPSDVSFTQFSGYIVTDKSRGR  225
            M+ L+W  +V  L SIS    +  N +     +  LPGQ  +V+F  +SGY+  ++   R
Sbjct  1    MLNLIWVFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSER  60

Query  226  ALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWN  402
            ALFY+F  A  +D  SKPL LWL GG  CS    G+  E GPF   KDGK L  NPYSWN
Sbjct  61   ALFYWFFEA-VDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWN  119

Query  403  LVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            L +N+L++D+P+ V YS+SNT+SD+    D  TA ++L FL KW  RF EY+  DFYI+G
Sbjct  120  LAANVLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLVFLLKWLERFPEYKGRDFYISG  179



>ref|NP_564298.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 ref|NP_973926.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 sp|Q93Y09.1|SCP45_ARATH RecName: Full=Serine carboxypeptidase-like 45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL24336.1| serine carboxypeptidase II, putative [Arabidopsis thaliana]
 gb|AAP49525.1| At1g28110 [Arabidopsis thaliana]
 gb|AEE30918.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 gb|AEE30919.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
Length=461

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 98/151 (65%), Gaps = 4/151 (3%)
 Frame = +1

Query  130  NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHD  309
            + + +  LPGQP  V F Q+SGY+  D  + RALFYYFA A++    SKPL LWL GG  
Sbjct  28   HSDRVTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPG  85

Query  310  CSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +S Y+   
Sbjct  86   CSSLGVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVN  144

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA +NL FL++WFL+F  Y N   +I G
Sbjct  145  DKITARDNLVFLQRWFLKFPHYLNRSLFITG  175



>ref|XP_007038111.1| Serine carboxypeptidase-like 45 isoform 2 [Theobroma cacao]
 gb|EOY22612.1| Serine carboxypeptidase-like 45 isoform 2 [Theobroma cacao]
Length=379

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I  LPGQP  V F QFSGY+  D+ + + LFYYF  A+  D  SKPL LWL GG  CS
Sbjct  18   DKIVRLPGQPR-VGFQQFSGYVTVDEKKHKVLFYYFVEAEI-DPASKPLVLWLNGGPGCS  75

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP  +  LV+N YSWN  +NMLY++TPI V +S+S  +S Y A  D 
Sbjct  76   SVGVGAFSENGPFRPNGE-VLVRNDYSWNREANMLYLETPIGVGFSYSTNSSSYVAVDDE  134

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NL FL++W+ +F  YR  D +I G
Sbjct  135  TTARDNLVFLQRWYHKFPNYRQRDLFITG  163



>gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [Arabidopsis thaliana]
Length=456

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 98/151 (65%), Gaps = 4/151 (3%)
 Frame = +1

Query  130  NGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHD  309
            + + +  LPGQP  V F Q+SGY+  D  + RALFYYFA A++    SKPL LWL GG  
Sbjct  28   HSDRVTRLPGQPR-VGFQQYSGYVTVDDKKQRALFYYFAEAETNPS-SKPLVLWLNGGPG  85

Query  310  CSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++TP+ V +S+S  +S Y+   
Sbjct  86   CSSLGVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLETPVGVGFSYSTQSSHYEGVN  144

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA +NL FL++WFL+F  Y N   +I G
Sbjct  145  DKITARDNLVFLQRWFLKFPHYLNRSLFITG  175



>ref|XP_010023719.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=477

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 110/185 (59%), Gaps = 16/185 (9%)
 Frame = +1

Query  64   KIMVFLLWFLLVNTLCS---ISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALF  234
            +++ +L    L  TLCS   +      + I SLPGQP  VSF Q++GY+  D+ + RALF
Sbjct  4    QLVPWLAAATLCATLCSSSTLGTTSEADKIASLPGQP-KVSFGQYAGYVTVDEKQQRALF  62

Query  235  YYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSN  414
            +YFA A++ D  SKPL LWL GG  CS   +G F EHGPF+P  D  L+KN YSWN  +N
Sbjct  63   FYFAEAEA-DPASKPLVLWLNGGPGCSSIGLGSFSEHGPFKPRGD-VLLKNDYSWNKEAN  120

Query  415  MLYVDTPI-VAYSFSNTTSDYQAW---------CDFETAYENLKFLRKWFLRFYEYRNLD  564
            MLY+++P  V +S+S  TS Y +          C      +NL FLR WF +F EY+  D
Sbjct  121  MLYLESPAGVGFSYSVHTSYYSSVDDEMTGSFPCKLRYQRDNLAFLRSWFEKFPEYKERD  180

Query  565  FYIAG  579
            F+I G
Sbjct  181  FFITG  185



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA-GAQSEDELSKPLTLWLGGGHDC  312
            + I  LPG+P+DVSF+ FSGYI  ++S GRALFY+      SE+  SKPL LWL GG  C
Sbjct  28   DRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSENPESKPLVLWLNGGPGC  87

Query  313  SIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            S    G   E GPFR   DGK L  NPYSWN ++N+L++++P  V +S+SNTTSD     
Sbjct  88   SSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAG  147

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA +   FL KWF RF +Y++ +FYIAG
Sbjct  148  DQRTAEDAYVFLVKWFERFPQYKHREFYIAG  178



>ref|NP_001150027.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG37565.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=471

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +1

Query  136  EMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDCS  315
            + I +LPGQP  V F Q+SGYI  D +  R+LFYYFA A++ D  +KPL LWL GG  CS
Sbjct  38   DKISALPGQPP-VGFAQYSGYIPVDAAGKRSLFYYFAEAEA-DPAAKPLVLWLNGGPGCS  95

Query  316  IATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWCDF  492
               VG F E+GPFRP+ +  L +N YSWN  +NMLY+++P  V +S+S   + Y+   D 
Sbjct  96   SVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLESPAGVGFSYSTDPAFYEGVGDS  154

Query  493  ETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
             TA +NLKFL+ WF RF +Y+  D YI G
Sbjct  155  MTARDNLKFLQGWFARFPQYKGRDLYITG  183



>gb|KHN31265.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 107/171 (63%), Gaps = 7/171 (4%)
 Frame = +1

Query  70   MVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAG  249
            +VFL     +   C  S   + + I +LPGQP  V F QFSGY+  D  + ++LFYYFA 
Sbjct  5    VVFLHLSFSMEVFCHPS---HADTIAALPGQP-HVGFQQFSGYVTVDDKKQKSLFYYFAE  60

Query  250  AQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  429
            A++ D  SKPL LWL GG  CS   VG F E+GPFRP  +  L+KN YSWN  +NMLY++
Sbjct  61   AET-DPASKPLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LIKNYYSWNKEANMLYLE  118

Query  430  TPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            TP+ V +S++  +S Y    D  TA +NL FL +WF +F +YR+ D ++ G
Sbjct  119  TPVGVGFSYAKGSSSYMTVNDEATARDNLIFLLRWFNKFPQYRSRDLFLTG  169



>gb|AFW73854.1| hypothetical protein ZEAMMB73_784908 [Zea mays]
Length=505

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
            G+ +++LPGQP+ V+F Q+SGY+  D+ RGRALFY+   A  +D  +KPL LWL GG  C
Sbjct  52   GDRVEALPGQPA-VAFAQYSGYVAVDRDRGRALFYWLTEAVGDDAAAKPLVLWLNGGPGC  110

Query  313  SIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            S    G   E GPFR   +G  L  N YSWN  +N+L++++P  V +S++NTTSD +   
Sbjct  111  SSVAYGASEEIGPFRIKPNGTGLFLNKYSWNREANLLFLESPAGVGFSYANTTSDLKTSG  170

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA + L+FL  W  RF +YR+ DFYIAG
Sbjct  171  DERTAQDALQFLVSWMSRFPQYRHRDFYIAG  201



>ref|XP_010682654.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 109/180 (61%), Gaps = 12/180 (7%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYI--------VTDKSRG  222
            + + L+  +++     + +    + I SLPGQPS V+F  +SGY+         T+ +  
Sbjct  11   VKMLLVLHVVIKIGSVMMLEFEADKITSLPGQPS-VNFQHYSGYVYVSFANQTQTNHNNQ  69

Query  223  RALFYYFAGAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWN  402
            +A+FYYF  A++E  +SKPL LWL GG  CS   VG F E+GPFRP  + +L+ N YSWN
Sbjct  70   KAMFYYFVEAETEP-VSKPLVLWLNGGPGCSSLGVGAFSENGPFRPAGN-RLIINHYSWN  127

Query  403  LVSNMLYVDTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
              +NMLY++TP  V +S S   S Y+   D  TA +NLKFL+KWFL+F  Y+N   YI G
Sbjct  128  KEANMLYLETPAGVGFSHSTNISSYETANDHTTARDNLKFLQKWFLKFPHYQNRSLYITG  187



>gb|EMT29573.1| Serine carboxypeptidase-like 45 [Aegilops tauschii]
Length=560

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = +1

Query  91   LLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDEL  270
            LL++  C +S+ +  + I +LPGQP  VSF Q+SGY+  D  R R+LFYYFA A+  D  
Sbjct  17   LLISNGC-LSMAMVEDKITALPGQPP-VSFAQYSGYVEVDAVRKRSLFYYFAEAEL-DPA  73

Query  271  SKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVDTPI-VAY  447
            +KPL LWL GG  CS   VG F E+GPFRP+ +  L+ N YSWN  +NMLY+++P  V +
Sbjct  74   TKPLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LMSNEYSWNKEANMLYLESPAGVGF  132

Query  448  SFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            S+S   S Y    D  TA +NL+FL  WF +F +Y+  + YIAG
Sbjct  133  SYSTDPSFYGGVGDSMTARDNLRFLEGWFAKFPQYKGRNLYIAG  176



>emb|CDY61693.1| BnaC05g51120D [Brassica napus]
Length=456

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 110/172 (64%), Gaps = 7/172 (4%)
 Frame = +1

Query  67   IMVFLLWFLLVNTLCSISIRINGEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFA  246
            +  F + F +V  L   S+  + + I  LPGQP  V F Q+SGY+  D+++ RALFYY A
Sbjct  5    LQCFTISFAIVLFLSFSSVLSHSDRITRLPGQPR-VGFQQYSGYVTVDENKQRALFYYLA  63

Query  247  GAQSEDELSKPLTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYV  426
             A++ D ++KPL LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY+
Sbjct  64   EAET-DPINKPLVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYL  121

Query  427  DTPI-VAYSFSNTTSDYQAWCDFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            +TP+ V +S+S   + Y++  D  TA +NL FL++WFL+F  Y N   +I G
Sbjct  122  ETPVGVGFSYS---TQYESVNDEITARDNLVFLQRWFLKFPHYLNRSLFITG  170



>ref|NP_001150705.1| LOC100284338 precursor [Zea mays]
 gb|ACG40087.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=481

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = +1

Query  133  GEMIDSLPGQPSDVSFTQFSGYIVTDKSRGRALFYYFAGAQSEDELSKPLTLWLGGGHDC  312
            G+ +++LPGQP+ V+F Q+SGY+  D+ RGRALFY+   A  +D  +KPL LWL GG  C
Sbjct  49   GDRVEALPGQPA-VAFAQYSGYVAVDRDRGRALFYWLTEAVGDDAAAKPLVLWLNGGPGC  107

Query  313  SIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVDTPI-VAYSFSNTTSDYQAWC  486
            S    G   E GPFR   +G  L  N YSWN  +N+L++++P  V +S++NTTSD +   
Sbjct  108  SSVAYGASEEIGPFRIKPNGTGLFLNKYSWNREANLLFLESPAGVGFSYANTTSDLKTSG  167

Query  487  DFETAYENLKFLRKWFLRFYEYRNLDFYIAG  579
            D  TA + L+FL  W  RF +YR+ DFYIAG
Sbjct  168  DERTAQDALQFLVSWMSRFPQYRHRDFYIAG  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737809437560