BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1159

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784592.1|  PREDICTED: cytochrome P450 CYP749A22-like        90.5    5e-18   Nicotiana sylvestris
ref|XP_009607163.1|  PREDICTED: cytochrome P450 CYP749A22-like        90.9    3e-17   Nicotiana tomentosiformis
ref|XP_006348652.1|  PREDICTED: cytochrome P450 734A1-like            85.9    1e-15   
ref|XP_010320842.1|  PREDICTED: cytochrome P450 CYP749A22             84.0    6e-15   Solanum lycopersicum
gb|ERN17797.1|  hypothetical protein AMTR_s00047p00158950             76.6    5e-14   Amborella trichopoda
ref|XP_008350887.1|  PREDICTED: cytochrome P450 CYP749A22-like        78.6    3e-13   
ref|XP_011654017.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2  78.2    5e-13   Cucumis sativus [cucumbers]
ref|XP_011070909.1|  PREDICTED: cytochrome P450 CYP749A22-like        78.2    5e-13   Sesamum indicum [beniseed]
ref|XP_008339765.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.8    5e-13   
ref|XP_008352941.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.8    5e-13   
ref|XP_009356448.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.8    6e-13   Pyrus x bretschneideri [bai li]
ref|XP_008390037.1|  PREDICTED: uncharacterized protein LOC103452311  78.6    6e-13   
ref|XP_010091620.1|  Cytochrome P450 734A1                            77.4    8e-13   
ref|XP_006856330.2|  PREDICTED: cytochrome P450 CYP749A22             77.4    9e-13   
ref|XP_007223262.1|  hypothetical protein PRUPE_ppa004463mg           77.0    1e-12   Prunus persica
ref|XP_004297211.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.0    1e-12   Fragaria vesca subsp. vesca
ref|XP_008243803.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.0    1e-12   Prunus mume [ume]
ref|XP_009356543.1|  PREDICTED: uncharacterized protein LOC103947364  77.8    1e-12   
ref|XP_007149355.1|  hypothetical protein PHAVU_005G0634000g          70.5    2e-12   Phaseolus vulgaris [French bean]
ref|XP_007222985.1|  hypothetical protein PRUPE_ppa004328mg           76.3    2e-12   Prunus persica
ref|XP_009356447.1|  PREDICTED: cytochrome P450 CYP749A22-like        76.3    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_008243895.1|  PREDICTED: cytochrome P450 CYP749A22-like        76.6    3e-12   
ref|XP_008389383.1|  PREDICTED: cytochrome P450 CYP749A22-like        71.6    3e-12   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like        75.5    3e-12   Cucumis melo [Oriental melon]
ref|XP_008360080.1|  PREDICTED: cytochrome P450 CYP749A22-like        75.5    3e-12   
ref|XP_008361867.1|  PREDICTED: uncharacterized protein LOC103425555  76.3    3e-12   
gb|AEM42984.1|  cytochrome P450                                       75.5    4e-12   Siraitia grosvenorii [arhat fruit]
ref|XP_008389250.1|  PREDICTED: cytochrome P450 CYP749A22-like        75.5    4e-12   
ref|XP_009356202.1|  PREDICTED: cytochrome P450 CYP749A22-like        75.5    4e-12   Pyrus x bretschneideri [bai li]
ref|XP_011654406.1|  PREDICTED: cytochrome P450 CYP72A219-like        75.1    4e-12   Cucumis sativus [cucumbers]
ref|XP_008243777.1|  PREDICTED: cytochrome P450 CYP749A22-like        75.9    5e-12   
gb|AFK37510.1|  unknown                                               71.6    7e-12   Lotus japonicus
ref|XP_011462984.1|  PREDICTED: cytochrome P450 CYP749A22-like is...  74.3    8e-12   Fragaria vesca subsp. vesca
ref|XP_007221838.1|  hypothetical protein PRUPE_ppa023692mg           74.3    8e-12   
ref|XP_011102241.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    1e-11   Sesamum indicum [beniseed]
ref|XP_004297212.1|  PREDICTED: cytochrome P450 CYP749A22-like is...  74.3    1e-11   Fragaria vesca subsp. vesca
gb|KCW85136.1|  hypothetical protein EUGRSUZ_B019751                  69.7    1e-11   Eucalyptus grandis [rose gum]
ref|XP_008243806.1|  PREDICTED: cytochrome P450 CYP749A22-like        73.6    1e-11   Prunus mume [ume]
ref|XP_004297206.2|  PREDICTED: uncharacterized protein LOC101301286  73.9    2e-11   Fragaria vesca subsp. vesca
ref|XP_007226180.1|  hypothetical protein PRUPE_ppa015588mg           73.2    2e-11   Prunus persica
ref|XP_007224838.1|  hypothetical protein PRUPE_ppa023100mg           73.2    2e-11   
ref|XP_008367092.1|  PREDICTED: cytochrome P450 CYP749A22-like        73.2    2e-11   
ref|XP_011462983.1|  PREDICTED: cytochrome P450 CYP749A22-like        73.2    2e-11   Fragaria vesca subsp. vesca
ref|XP_008243805.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    2e-11   Prunus mume [ume]
gb|KJB80516.1|  hypothetical protein B456_013G101100                  72.8    2e-11   Gossypium raimondii
ref|XP_011009723.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    3e-11   Populus euphratica
ref|XP_004303121.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    3e-11   Fragaria vesca subsp. vesca
ref|XP_002316010.2|  hypothetical protein POPTR_0010s14950g           72.8    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010044379.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    3e-11   Eucalyptus grandis [rose gum]
ref|XP_008243892.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    3e-11   
ref|XP_008389384.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    3e-11   
ref|XP_010044380.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.8    3e-11   Eucalyptus grandis [rose gum]
gb|KCW86467.1|  hypothetical protein EUGRSUZ_B03135                   72.4    3e-11   Eucalyptus grandis [rose gum]
ref|XP_011460709.1|  PREDICTED: cytochrome P450 CYP749A22-like        71.6    3e-11   Fragaria vesca subsp. vesca
gb|KJB10709.1|  hypothetical protein B456_001G217300                  72.4    3e-11   Gossypium raimondii
ref|XP_011102246.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.4    3e-11   Sesamum indicum [beniseed]
ref|XP_007226531.1|  hypothetical protein PRUPE_ppa025196mg           72.4    4e-11   Prunus persica
ref|XP_010040838.1|  PREDICTED: cytochrome P450 CYP749A22-like        72.4    4e-11   Eucalyptus grandis [rose gum]
gb|EYU22575.1|  hypothetical protein MIMGU_mgv1a004725mg              72.4    4e-11   Erythranthe guttata [common monkey flower]
emb|CDP20014.1|  unnamed protein product                              71.6    5e-11   Coffea canephora [robusta coffee]
gb|KDO52095.1|  hypothetical protein CISIN_1g040765mg                 68.2    5e-11   Citrus sinensis [apfelsine]
ref|XP_008784486.1|  PREDICTED: cytochrome P450 CYP72A219-like        72.0    5e-11   
ref|XP_006437869.1|  hypothetical protein CICLE_v10033485mg           71.6    6e-11   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                  71.6    6e-11   Medicago truncatula
emb|CDP12576.1|  unnamed protein product                              71.6    6e-11   Coffea canephora [robusta coffee]
gb|ACV88396.1|  cytochrome p450 monoxygenase                          68.2    6e-11   Cucumis sativus [cucumbers]
ref|XP_008340298.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.0    7e-11   
gb|KCW82725.1|  hypothetical protein EUGRSUZ_C04102                   71.6    7e-11   Eucalyptus grandis [rose gum]
gb|KCW82722.1|  hypothetical protein EUGRSUZ_C04098                   71.6    7e-11   Eucalyptus grandis [rose gum]
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.6    7e-11   Cucumis melo [Oriental melon]
ref|XP_010049898.1|  PREDICTED: cytochrome P450 CYP749A22-like        71.6    7e-11   Eucalyptus grandis [rose gum]
ref|XP_006484251.1|  PREDICTED: cytochrome P450 734A1-like            71.6    7e-11   Citrus sinensis [apfelsine]
ref|XP_008243778.1|  PREDICTED: cytochrome P450 CYP749A22-like        71.6    7e-11   Prunus mume [ume]
ref|XP_004297193.1|  PREDICTED: cytochrome P450 CYP749A22-like        71.6    7e-11   Fragaria vesca subsp. vesca
gb|KDO70287.1|  hypothetical protein CISIN_1g039293mg                 71.2    8e-11   Citrus sinensis [apfelsine]
gb|EYU22576.1|  hypothetical protein MIMGU_mgv1a004757mg              71.2    8e-11   Erythranthe guttata [common monkey flower]
ref|XP_010046246.1|  PREDICTED: cytochrome P450 CYP749A22-like        71.2    8e-11   
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like        71.2    8e-11   Cucumis melo [Oriental melon]
ref|XP_007226762.1|  hypothetical protein PRUPE_ppa018724mg           71.2    9e-11   Prunus persica
ref|XP_007201527.1|  hypothetical protein PRUPE_ppa016887mg           71.2    9e-11   Prunus persica
ref|XP_008243890.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.3    9e-11   Prunus mume [ume]
gb|KHG26580.1|  Cytochrome P450 protein                               71.2    9e-11   Gossypium arboreum [tree cotton]
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like        70.9    1e-10   Cucumis melo [Oriental melon]
ref|XP_011070908.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.9    1e-10   Sesamum indicum [beniseed]
ref|XP_008243893.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  70.5    1e-10   Prunus mume [ume]
ref|XP_011008174.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.9    1e-10   Populus euphratica
ref|XP_006437868.1|  hypothetical protein CICLE_v10033709mg           70.9    1e-10   
ref|XP_009346500.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.9    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase         70.9    1e-10   Glycine max [soybeans]
ref|XP_004297208.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.9    1e-10   Fragaria vesca subsp. vesca
gb|KHN47459.1|  Secologanin synthase                                  70.9    1e-10   Glycine soja [wild soybean]
ref|XP_004295657.2|  PREDICTED: cytochrome P450 CYP749A22-like        70.9    1e-10   Fragaria vesca subsp. vesca
ref|XP_009346501.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.9    1e-10   Pyrus x bretschneideri [bai li]
gb|KDP41351.1|  hypothetical protein JCGZ_15758                       70.5    1e-10   Jatropha curcas
ref|XP_006377686.1|  hypothetical protein POPTR_0011s102201g          69.7    1e-10   
ref|XP_007149356.1|  hypothetical protein PHAVU_005G063500g           70.1    1e-10   Phaseolus vulgaris [French bean]
emb|CDP00469.1|  unnamed protein product                              70.5    1e-10   Coffea canephora [robusta coffee]
ref|XP_012067825.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.5    1e-10   
gb|KHN47458.1|  Secologanin synthase                                  70.5    1e-10   Glycine soja [wild soybean]
ref|XP_010046255.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.1    2e-10   Eucalyptus grandis [rose gum]
ref|XP_002512038.1|  cytochrome P450, putative                        70.5    2e-10   Ricinus communis
gb|KHG20903.1|  Secologanin synthase                                  69.3    2e-10   Gossypium arboreum [tree cotton]
gb|KHG08441.1|  Cytochrome P450 protein                               70.5    2e-10   Gossypium arboreum [tree cotton]
ref|XP_006442303.1|  hypothetical protein CICLE_v10023520mg           69.7    2e-10   
ref|XP_004151308.2|  PREDICTED: cytochrome P450 CYP72A219             70.5    2e-10   Cucumis sativus [cucumbers]
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g           70.5    2e-10   Phaseolus vulgaris [French bean]
gb|KHG26927.1|  Cytochrome P450 protein                               70.1    2e-10   Gossypium arboreum [tree cotton]
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  70.1    2e-10   Citrus sinensis [apfelsine]
gb|KDO36840.1|  hypothetical protein CISIN_1g012962mg                 70.1    2e-10   Citrus sinensis [apfelsine]
sp|H2DH17.1|C7A22_PANGI  RecName: Full=Cytochrome P450 CYP749A22;...  70.1    2e-10   Panax ginseng [Asiatic ginseng]
gb|KJB78243.1|  hypothetical protein B456_012G185300                  70.1    2e-10   Gossypium raimondii
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg           70.1    2e-10   
gb|KDO64199.1|  hypothetical protein CISIN_1g022822mg                 68.9    2e-10   Citrus sinensis [apfelsine]
ref|XP_004298349.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.1    2e-10   Fragaria vesca subsp. vesca
gb|KDP35176.1|  hypothetical protein JCGZ_10710                       70.1    2e-10   Jatropha curcas
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like        70.1    2e-10   Cucumis melo [Oriental melon]
ref|XP_004298351.1|  PREDICTED: cytochrome P450 CYP749A22-like        70.1    2e-10   Fragaria vesca subsp. vesca
ref|XP_007045779.1|  Cytochrome P450, putative                        70.1    2e-10   
ref|XP_004146005.2|  PREDICTED: cytochrome P450 CYP72A219 isoform X1  70.1    2e-10   Cucumis sativus [cucumbers]
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    70.1    2e-10   Citrus sinensis [apfelsine]
ref|XP_007224155.1|  hypothetical protein PRUPE_ppa016800mg           70.1    2e-10   
ref|XP_008367032.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  70.1    2e-10   
ref|XP_011654016.1|  PREDICTED: cytochrome P450 CYP72A219-like        70.1    2e-10   Cucumis sativus [cucumbers]
gb|KCW85140.1|  hypothetical protein EUGRSUZ_B01983                   70.1    2e-10   Eucalyptus grandis [rose gum]
emb|CAA49445.1|  cytochrome P-450                                     64.3    2e-10   Catharanthus roseus [chatas]
ref|XP_007201627.1|  hypothetical protein PRUPE_ppa021443mg           69.7    2e-10   
ref|XP_006437867.1|  hypothetical protein CICLE_v10033321mg           70.1    2e-10   Citrus clementina [clementine]
ref|XP_006484250.1|  PREDICTED: cytochrome P450 734A1-like            70.1    2e-10   Citrus sinensis [apfelsine]
gb|KHG18227.1|  Secologanin synthase                                  69.7    2e-10   Gossypium arboreum [tree cotton]
ref|XP_012075440.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.7    2e-10   
ref|XP_006442300.1|  hypothetical protein CICLE_v100199321mg          68.6    3e-10   
gb|KHG20902.1|  Secologanin synthase                                  69.7    3e-10   Gossypium arboreum [tree cotton]
ref|XP_008446467.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.7    3e-10   Cucumis melo [Oriental melon]
ref|XP_007224911.1|  hypothetical protein PRUPE_ppa021901mg           69.7    3e-10   
ref|XP_009357376.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.7    3e-10   Pyrus x bretschneideri [bai li]
gb|KHN44046.1|  Secologanin synthase                                  69.7    3e-10   Glycine soja [wild soybean]
ref|XP_009356542.1|  PREDICTED: uncharacterized protein LOC103947363  70.1    3e-10   
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    69.7    3e-10   Glycine max [soybeans]
ref|XP_008364583.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.7    3e-10   
ref|XP_008346697.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.7    3e-10   
ref|XP_010098360.1|  Secologanin synthase                             67.8    3e-10   
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    69.3    3e-10   Citrus sinensis [apfelsine]
ref|XP_007222124.1|  hypothetical protein PRUPE_ppa004646mg           69.3    4e-10   
ref|XP_011659939.1|  PREDICTED: cytochrome P450 CYP72A219-like        69.3    4e-10   Cucumis sativus [cucumbers]
gb|KDP41353.1|  hypothetical protein JCGZ_15760                       69.3    4e-10   Jatropha curcas
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like        69.3    4e-10   Nicotiana tomentosiformis
ref|XP_007222983.1|  hypothetical protein PRUPE_ppa004319mg           69.3    4e-10   Prunus persica
ref|XP_006442302.1|  hypothetical protein CICLE_v100197311mg          68.9    4e-10   
gb|KDO55401.1|  hypothetical protein CISIN_1g038623mg                 67.8    4e-10   Citrus sinensis [apfelsine]
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g           69.3    4e-10   Phaseolus vulgaris [French bean]
ref|XP_004135429.2|  PREDICTED: cytochrome P450 CYP749A22-like        69.3    4e-10   Cucumis sativus [cucumbers]
ref|XP_008243804.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.3    4e-10   Prunus mume [ume]
ref|XP_006429655.1|  hypothetical protein CICLE_v10011453mg           69.3    4e-10   Citrus clementina [clementine]
ref|XP_010052417.1|  PREDICTED: cytochrome P450 CYP749A22-like        68.9    5e-10   Eucalyptus grandis [rose gum]
emb|CDP15973.1|  unnamed protein product                              68.9    5e-10   Coffea canephora [robusta coffee]
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  68.9    5e-10   
ref|XP_007223137.1|  hypothetical protein PRUPE_ppa004329mg           68.9    5e-10   Prunus persica
gb|KHG02805.1|  Cytochrome P450 protein                               68.6    5e-10   Gossypium arboreum [tree cotton]
ref|XP_011070904.1|  PREDICTED: cytochrome P450 CYP749A22-like        68.9    5e-10   Sesamum indicum [beniseed]
ref|XP_007224470.1|  hypothetical protein PRUPE_ppa022621mg           68.9    5e-10   
ref|XP_008243779.1|  PREDICTED: cytochrome P450 CYP749A22-like        68.9    5e-10   Prunus mume [ume]
gb|KHG20728.1|  hypothetical protein F383_28301                       69.3    5e-10   Gossypium arboreum [tree cotton]
gb|KHG20729.1|  hypothetical protein F383_28301                       69.3    5e-10   Gossypium arboreum [tree cotton]
gb|KJB12898.1|  hypothetical protein B456_002G043200                  68.9    5e-10   Gossypium raimondii
gb|KDP35171.1|  hypothetical protein JCGZ_10705                       68.9    5e-10   Jatropha curcas
ref|XP_008356573.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  68.9    5e-10   
gb|EYU22578.1|  hypothetical protein MIMGU_mgv1a004881mg              68.9    5e-10   Erythranthe guttata [common monkey flower]
ref|XP_012075437.1|  PREDICTED: cytochrome P450 CYP749A22-like        68.9    6e-10   Jatropha curcas
gb|KHG27367.1|  Cytochrome P450 protein                               68.6    6e-10   Gossypium arboreum [tree cotton]
ref|XP_012067827.1|  PREDICTED: cytochrome P450 CYP749A22-like        68.6    6e-10   Jatropha curcas
ref|XP_008243887.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.9    6e-10   
gb|EMT11454.1|  Secologanin synthase                                  68.6    6e-10   
ref|XP_011470797.1|  PREDICTED: cytochrome P450 CYP749A22-like        66.6    6e-10   Fragaria vesca subsp. vesca
ref|XP_004295655.2|  PREDICTED: cytochrome P450 CYP749A22-like is...  68.6    6e-10   Fragaria vesca subsp. vesca
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.6    6e-10   Solanum lycopersicum
gb|KJB79907.1|  hypothetical protein B456_013G071400                  68.6    6e-10   Gossypium raimondii
gb|KDP41344.1|  hypothetical protein JCGZ_15751                       68.6    7e-10   Jatropha curcas
ref|XP_009596805.1|  PREDICTED: cytochrome P450 72A15-like            68.6    7e-10   Nicotiana tomentosiformis
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    68.6    7e-10   Solanum tuberosum [potatoes]
dbj|BAJ93197.1|  predicted protein                                    68.6    7e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO70290.1|  hypothetical protein CISIN_1g009043mg                 68.6    7e-10   Citrus sinensis [apfelsine]
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like            68.6    7e-10   Eucalyptus grandis [rose gum]
ref|XP_007210003.1|  hypothetical protein PRUPE_ppa016601mg           68.6    7e-10   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.6    7e-10   Cucumis melo [Oriental melon]
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    68.6    8e-10   Solanum tuberosum [potatoes]
gb|KHG14489.1|  Secologanin synthase                                  68.6    8e-10   Gossypium arboreum [tree cotton]
gb|ERN17807.1|  hypothetical protein AMTR_s00047p00169120             64.7    8e-10   Amborella trichopoda
emb|CDY51036.1|  BnaA06g02990D                                        68.2    9e-10   Brassica napus [oilseed rape]
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like        68.2    9e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006493472.1|  PREDICTED: cytochrome P450 734A1-like            68.2    9e-10   
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like            68.2    9e-10   
ref|XP_012068355.1|  PREDICTED: cytochrome P450 CYP749A22-like        68.2    9e-10   Jatropha curcas
emb|CDP00470.1|  unnamed protein product                              68.2    9e-10   Coffea canephora [robusta coffee]
ref|XP_004298348.1|  PREDICTED: cytochrome P450 CYP749A22-like        68.2    9e-10   Fragaria vesca subsp. vesca
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein        68.2    1e-09   Vinca minor [common periwinkle]
gb|KHG13385.1|  Cytochrome P450 protein                               67.0    1e-09   Gossypium arboreum [tree cotton]
ref|XP_006348799.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    67.8    1e-09   
gb|KJB12897.1|  hypothetical protein B456_002G043200                  68.2    1e-09   Gossypium raimondii
ref|XP_006437870.1|  hypothetical protein CICLE_v10031156mg           68.2    1e-09   Citrus clementina [clementine]
gb|KDO70289.1|  hypothetical protein CISIN_1g009043mg                 68.2    1e-09   Citrus sinensis [apfelsine]
ref|XP_006484252.1|  PREDICTED: cytochrome P450 734A1-like            68.2    1e-09   Citrus sinensis [apfelsine]
ref|XP_006437871.1|  hypothetical protein CICLE_v10031156mg           68.2    1e-09   Citrus clementina [clementine]
ref|XP_008243891.1|  PREDICTED: cytochrome P450 CYP749A22-like        67.8    1e-09   
gb|AJD25167.1|  cytochrome P450 CYP72A326                             68.2    1e-09   Salvia miltiorrhiza [Chinese salvia]
gb|KDO70288.1|  hypothetical protein CISIN_1g009043mg                 67.8    1e-09   Citrus sinensis [apfelsine]
ref|XP_004146006.2|  PREDICTED: cytochrome P450 CYP72A219-like        67.8    1e-09   Cucumis sativus [cucumbers]
ref|XP_006427678.1|  hypothetical protein CICLE_v10027532mg           67.8    1e-09   Citrus clementina [clementine]
gb|EMS52653.1|  Secologanin synthase                                  67.8    1e-09   Triticum urartu
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...  67.8    1e-09   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like            67.8    1e-09   Eucalyptus grandis [rose gum]
ref|XP_010064521.1|  PREDICTED: cytochrome P450 72A14-like            67.8    1e-09   
gb|KHN44049.1|  Secologanin synthase                                  65.9    1e-09   Glycine soja [wild soybean]
ref|XP_002325505.1|  hypothetical protein POPTR_0019s09980g           67.8    1e-09   
dbj|BAB02395.1|  cytochrome P450-like protein                         67.8    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356544.1|  PREDICTED: uncharacterized protein LOC103947365  67.8    1e-09   
ref|XP_002316008.1|  hypothetical protein POPTR_0010s14920g           67.4    1e-09   Populus trichocarpa [western balsam poplar]
gb|KCW86459.1|  hypothetical protein EUGRSUZ_B03127                   67.4    1e-09   Eucalyptus grandis [rose gum]
gb|KJB12904.1|  hypothetical protein B456_002G043600                  67.4    2e-09   Gossypium raimondii
ref|XP_007212388.1|  hypothetical protein PRUPE_ppa016261mg           67.4    2e-09   
emb|CAN71061.1|  hypothetical protein VITISV_032613                   66.2    2e-09   Vitis vinifera
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...  67.4    2e-09   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219             67.4    2e-09   Solanum lycopersicum
gb|ABR25638.1|  cytochrome p450 72a1                                  63.9    2e-09   Oryza sativa Indica Group [Indian rice]
emb|CDY28093.1|  BnaC06g02740D                                        67.4    2e-09   Brassica napus [oilseed rape]
ref|NP_001175164.1|  Os07g0419000                                     64.3    2e-09   
ref|XP_009358604.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.5    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_010041049.1|  PREDICTED: cytochrome P450 734A1-like            67.4    2e-09   
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...  67.4    2e-09   
gb|KHG14401.1|  Cytochrome P450 protein                               67.4    2e-09   Gossypium arboreum [tree cotton]
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg              67.0    2e-09   Erythranthe guttata [common monkey flower]
gb|AFO67239.1|  putative cytochrome P450 monooxygenase                62.4    2e-09   Aralia elata
ref|XP_007226407.1|  hypothetical protein PRUPE_ppa022752mg           67.0    2e-09   
ref|XP_007225594.1|  hypothetical protein PRUPE_ppa026874mg           66.6    2e-09   
gb|KJB54457.1|  hypothetical protein B456_009G035000                  67.0    2e-09   Gossypium raimondii
ref|XP_002988180.1|  hypothetical protein SELMODRAFT_127819           67.0    2e-09   
gb|EYU22577.1|  hypothetical protein MIMGU_mgv1a004830mg              67.0    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_010054391.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.9    2e-09   
ref|XP_011457333.1|  PREDICTED: cytochrome P450 CYP749A22-like        67.0    2e-09   Fragaria vesca subsp. vesca
ref|XP_002963468.1|  hypothetical protein SELMODRAFT_80290            67.0    2e-09   
emb|CDX97593.1|  BnaA05g24860D                                        67.0    2e-09   
ref|XP_008219236.1|  PREDICTED: cytochrome P450 CYP749A22-like        67.0    2e-09   Prunus mume [ume]
ref|XP_010046611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.4    2e-09   
gb|AJD25168.1|  cytochrome P450 CYP72A327                             67.0    2e-09   Salvia miltiorrhiza [Chinese salvia]
gb|AJD25259.1|  cytochrome P450 CYP749A37                             67.0    2e-09   Salvia miltiorrhiza [Chinese salvia]
gb|EYU38223.1|  hypothetical protein MIMGU_mgv1a005129mg              67.0    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_011015642.1|  PREDICTED: cytochrome P450 CYP749A22-like        66.6    2e-09   Populus euphratica
ref|XP_011070335.1|  PREDICTED: cytochrome P450 CYP72A219-like        66.6    3e-09   Sesamum indicum [beniseed]
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like            66.6    3e-09   Brassica rapa
ref|XP_008446465.1|  PREDICTED: cytochrome P450 CYP749A22-like        66.6    3e-09   
emb|CBI39918.3|  unnamed protein product                              63.9    3e-09   Vitis vinifera
gb|KCW86463.1|  hypothetical protein EUGRSUZ_B03131                   66.6    3e-09   Eucalyptus grandis [rose gum]
gb|EYU22581.1|  hypothetical protein MIMGU_mgv1a004745mg              66.6    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_010044378.1|  PREDICTED: cytochrome P450 CYP749A22-like is...  66.6    3e-09   Eucalyptus grandis [rose gum]
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase           66.6    3e-09   Catharanthus roseus [chatas]
ref|XP_008351041.1|  PREDICTED: cytochrome P450 CYP749A22-like        67.0    3e-09   
gb|ERN17815.1|  hypothetical protein AMTR_s00047p00172840             66.2    3e-09   Amborella trichopoda
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...  66.6    3e-09   
gb|KHN47456.1|  Secologanin synthase                                  66.6    3e-09   Glycine soja [wild soybean]
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    66.6    3e-09   Glycine max [soybeans]
gb|EYU25272.1|  hypothetical protein MIMGU_mgv1a019375mg              63.2    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_002316006.2|  hypothetical protein POPTR_0010s14900g           66.6    3e-09   
gb|KJB26994.1|  hypothetical protein B456_004G270700                  66.6    3e-09   Gossypium raimondii
ref|XP_010044377.1|  PREDICTED: cytochrome P450 CYP749A22-like is...  66.6    3e-09   Eucalyptus grandis [rose gum]
ref|XP_011015632.1|  PREDICTED: cytochrome P450 CYP749A22-like        66.6    3e-09   Populus euphratica
ref|XP_010091621.1|  Cytochrome P450 734A1                            66.6    3e-09   Morus notabilis
dbj|BAL45201.1|  cytochrome P450 monooxygenase                        66.2    3e-09   Medicago truncatula
ref|XP_009800506.1|  PREDICTED: cytochrome P450 72A15-like            66.2    3e-09   Nicotiana sylvestris
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like        66.2    3e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW44686.1|  hypothetical protein EUGRSUZ_L01780                   66.2    4e-09   Eucalyptus grandis [rose gum]
gb|EEE67041.1|  hypothetical protein OsJ_23983                        65.1    4e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ERM97995.1|  hypothetical protein AMTR_s00117p00135700             66.2    4e-09   Amborella trichopoda
ref|XP_006830579.2|  PREDICTED: cytochrome P450 CYP72A219             66.2    4e-09   Amborella trichopoda
ref|XP_006856340.2|  PREDICTED: cytochrome P450 CYP749A22             64.3    4e-09   Amborella trichopoda
ref|XP_004239025.1|  PREDICTED: cytochrome P450 CYP749A22-like        66.2    4e-09   Solanum lycopersicum
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg           66.2    4e-09   
ref|XP_011091093.1|  PREDICTED: secologanin synthase-like             66.2    4e-09   Sesamum indicum [beniseed]
gb|KHG03731.1|  Secologanin synthase                                  66.2    4e-09   Gossypium arboreum [tree cotton]
emb|CBI39929.3|  unnamed protein product                              66.2    4e-09   Vitis vinifera
gb|KHG08051.1|  Cytochrome P450 protein                               66.2    4e-09   Gossypium arboreum [tree cotton]
gb|KHG14937.1|  Cytochrome P450 protein                               66.2    4e-09   
emb|CBI39917.3|  unnamed protein product                              66.2    4e-09   
gb|KCW76384.1|  hypothetical protein EUGRSUZ_D00766                   66.2    4e-09   
ref|XP_003628067.1|  Cytochrome P450 monooxygenase CYP72A65           66.2    4e-09   
ref|XP_010645072.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.9    5e-09   
ref|XP_006598146.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    65.9    5e-09   
ref|XP_008367031.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.9    5e-09   
gb|ABK25130.1|  unknown                                               65.9    5e-09   
gb|EPS61578.1|  hypothetical protein M569_13218                       65.9    5e-09   
gb|KDO52110.1|  hypothetical protein CISIN_1g042061mg                 62.8    5e-09   
ref|XP_003628068.1|  Cytochrome P450 monooxygenase CYP72A65           65.9    5e-09   
gb|ERM97993.1|  hypothetical protein AMTR_s00117p00134960             65.9    5e-09   
ref|XP_011085689.1|  PREDICTED: cytochrome P450 714C2-like            65.9    5e-09   
ref|XP_010046258.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.5    5e-09   
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                 65.9    5e-09   
gb|ERN17795.1|  hypothetical protein AMTR_s00047p00155480             64.3    5e-09   
ref|XP_004298350.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.9    5e-09   
ref|XP_011620352.1|  PREDICTED: cytochrome P450 CYP72A219             65.9    5e-09   
gb|KCW73210.1|  hypothetical protein EUGRSUZ_E016721                  61.2    6e-09   
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like        65.9    6e-09   
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein        65.9    6e-09   
ref|XP_002515361.1|  cytochrome P450, putative                        65.9    6e-09   
gb|KHG20842.1|  Secologanin synthase                                  65.9    6e-09   
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like        65.9    6e-09   
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein        65.9    6e-09   
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like            65.9    6e-09   
ref|XP_006388779.1|  hypothetical protein POPTR_0102s00240g           65.9    6e-09   
gb|KDP41343.1|  hypothetical protein JCGZ_15750                       65.5    6e-09   
gb|ERN17810.1|  hypothetical protein AMTR_s00047p00170590             62.4    6e-09   
ref|XP_007223241.1|  hypothetical protein PRUPE_ppa004414mg           65.9    6e-09   
ref|XP_002512040.1|  cytochrome P450, putative                        65.9    6e-09   
gb|ADO16189.1|  cytochrome P450 mono-oxygenase                        60.8    6e-09   
ref|XP_010046249.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.5    6e-09   
gb|KHG09430.1|  Secologanin synthase                                  65.5    6e-09   
ref|XP_006342362.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    65.5    6e-09   
gb|KJB50134.1|  hypothetical protein B456_008G154900                  65.5    6e-09   
emb|CDX98486.1|  BnaC05g38890D                                        65.5    6e-09   
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    65.5    7e-09   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like            65.5    7e-09   
emb|CAN66491.1|  hypothetical protein VITISV_029789                   63.2    7e-09   
ref|XP_006397887.1|  hypothetical protein EUTSA_v10001401mg           65.5    7e-09   
ref|XP_007226460.1|  hypothetical protein PRUPE_ppa024660mg           65.5    7e-09   
ref|XP_006856348.2|  PREDICTED: cytochrome P450 734A1                 65.5    7e-09   
gb|KCW86460.1|  hypothetical protein EUGRSUZ_B03128                   65.5    7e-09   
ref|XP_002992582.1|  hypothetical protein SELMODRAFT_186869           65.5    7e-09   
emb|CAN67452.1|  hypothetical protein VITISV_034123                   62.8    7e-09   
ref|XP_002972525.1|  hypothetical protein SELMODRAFT_97810            65.5    8e-09   
ref|XP_009607162.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.5    8e-09   
ref|XP_006377673.1|  hypothetical protein POPTR_0011s101201g          61.2    8e-09   
ref|XP_010248211.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.1    8e-09   
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like            65.5    8e-09   
ref|NP_001060384.2|  Os07g0635200                                     65.1    8e-09   
emb|CDP15974.1|  unnamed protein product                              65.1    8e-09   
gb|KCW85143.1|  hypothetical protein EUGRSUZ_B01987                   65.1    9e-09   
gb|KJB50133.1|  hypothetical protein B456_008G154900                  65.1    9e-09   
ref|XP_010044348.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.1    9e-09   
emb|CDP00472.1|  unnamed protein product                              65.5    9e-09   
gb|AJD25262.1|  cytochrome P450 CYP749A40                             65.1    1e-08   
emb|CDY32348.1|  BnaC01g36670D                                        65.1    1e-08   
ref|XP_004144024.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.1    1e-08   
dbj|BAC07127.1|  putative cytochrome P450                             65.1    1e-08   
gb|EEC82513.1|  hypothetical protein OsI_27006                        65.1    1e-08   
ref|XP_008450912.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  65.1    1e-08   
ref|XP_012068356.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.1    1e-08   
ref|XP_008450911.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  65.1    1e-08   
gb|KDP41345.1|  hypothetical protein JCGZ_15752                       64.7    1e-08   
ref|NP_001140247.1|  putative cytochrome P450 superfamily protein     64.7    1e-08   
ref|XP_010552157.1|  PREDICTED: cytochrome P450 72A14-like            62.8    1e-08   
ref|XP_009762791.1|  PREDICTED: cytochrome P450 CYP749A22-like        64.7    1e-08   
ref|XP_011101779.1|  PREDICTED: cytochrome P450 CYP749A22-like        64.7    1e-08   
ref|XP_009362696.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.7    1e-08   
gb|EAZ40790.1|  hypothetical protein OsJ_25269                        64.7    1e-08   
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  64.7    1e-08   
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  64.7    1e-08   
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.7    1e-08   
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.7    1e-08   
ref|XP_011102247.1|  PREDICTED: cytochrome P450 CYP749A22-like        64.7    1e-08   
emb|CDY51038.1|  BnaA06g03010D                                        64.7    1e-08   
gb|KHG30791.1|  Cytochrome P450 protein                               64.7    1e-08   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like             64.7    1e-08   
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...  64.7    1e-08   
ref|XP_002325324.2|  hypothetical protein POPTR_0019s03160g           64.7    1e-08   
gb|EEC82514.1|  hypothetical protein OsI_27007                        64.7    1e-08   
ref|XP_006657629.1|  PREDICTED: cytochrome P450 734A6-like            64.7    1e-08   
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like             64.7    1e-08   
ref|XP_011009686.1|  PREDICTED: cytochrome P450 CYP749A22-like        64.7    1e-08   
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.7    1e-08   
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.7    1e-08   
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                  64.7    1e-08   
gb|KHG29404.1|  Cytochrome P450 protein                               64.3    1e-08   
gb|KJB28185.1|  hypothetical protein B456_005G032800                  64.3    1e-08   
ref|XP_002316007.2|  hypothetical protein POPTR_0010s14910g           64.3    1e-08   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like            64.3    2e-08   
gb|EAZ04830.1|  hypothetical protein OsI_27008                        64.3    2e-08   
ref|XP_003628063.1|  Cytochrome P450 monooxygenase CYP72A65           64.3    2e-08   
gb|EYU44092.1|  hypothetical protein MIMGU_mgv1a0044501mg             64.3    2e-08   
gb|EEC77611.1|  hypothetical protein OsI_16590                        63.9    2e-08   
gb|ADO16195.1|  cytochrome P450 mono-oxygenase                        59.7    2e-08   
emb|CBI16700.3|  unnamed protein product                              64.3    2e-08   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    2e-08   
ref|XP_006407057.1|  hypothetical protein EUTSA_v10020855mg           64.3    2e-08   
gb|KJB79277.1|  hypothetical protein B456_013G041300                  64.3    2e-08   
ref|XP_004243719.1|  PREDICTED: cytochrome P450 72A15-like            64.3    2e-08   
ref|XP_007034362.1|  Cytochrome P450                                  64.3    2e-08   
ref|XP_012076364.1|  PREDICTED: cytochrome P450 714A1-like            64.3    2e-08   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    2e-08   
ref|XP_002512037.1|  cytochrome P450, putative                        64.3    2e-08   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    2e-08   
emb|CAN68126.1|  hypothetical protein VITISV_002909                   61.6    2e-08   
ref|XP_002269307.2|  PREDICTED: cytochrome P450 714C2                 64.3    2e-08   
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    64.3    2e-08   
ref|XP_002266550.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.9    2e-08   
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg           64.3    2e-08   
emb|CDX97590.1|  BnaA05g24890D                                        64.3    2e-08   
ref|XP_012077201.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    2e-08   
ref|XP_002512039.1|  cytochrome P450, putative                        63.9    2e-08   
emb|CDP15976.1|  unnamed protein product                              64.3    2e-08   
ref|XP_006856328.2|  PREDICTED: cytochrome P450 CYP749A22             64.3    2e-08   
emb|CDY20078.1|  BnaA01g29240D                                        63.9    2e-08   
ref|XP_007045774.1|  Cytochrome P450                                  64.3    2e-08   
ref|XP_002992581.1|  hypothetical protein SELMODRAFT_135524           59.7    2e-08   
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...  63.9    2e-08   
ref|XP_006646126.1|  PREDICTED: secologanin synthase-like             63.9    2e-08   
ref|XP_008393592.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.9    2e-08   
ref|XP_007034363.1|  Cytochrome P450                                  63.9    2e-08   
ref|XP_006646124.1|  PREDICTED: secologanin synthase-like             63.9    2e-08   
ref|XP_006655309.1|  PREDICTED: cytochrome P450 734A1-like            63.9    2e-08   
gb|KJB28173.1|  hypothetical protein B456_005G0331001                 63.9    2e-08   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                   63.9    2e-08   
ref|XP_002516130.1|  cytochrome P450, putative                        63.9    2e-08   
gb|KHN12943.1|  Secologanin synthase                                  63.5    2e-08   
gb|EMT24740.1|  Secologanin synthase                                  63.9    2e-08   
gb|ERN01818.1|  hypothetical protein AMTR_s00089p00051730             63.9    2e-08   
gb|ABF96179.1|  Cytochrome P450 family protein, expressed             62.8    2e-08   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like            63.9    2e-08   
gb|KJB28191.1|  hypothetical protein B456_005G033500                  63.9    2e-08   
ref|NP_001059471.1|  Os07g0418500                                     63.9    2e-08   
emb|CAN78942.1|  hypothetical protein VITISV_002447                   63.9    2e-08   
ref|XP_002882888.1|  CYP72A15                                         63.9    2e-08   
sp|H1A981.1|C7263_MEDTR  RecName: Full=11-oxo-beta-amyrin 30-oxid...  63.9    2e-08   
gb|KCW67647.1|  hypothetical protein EUGRSUZ_F01394                   63.5    3e-08   
gb|EEC82045.1|  hypothetical protein OsI_26022                        63.5    3e-08   
ref|XP_004305066.1|  PREDICTED: cytochrome P450 714A1-like isofor...  63.9    3e-08   
ref|XP_011466388.1|  PREDICTED: cytochrome P450 714A1-like isofor...  63.9    3e-08   
ref|XP_006388777.1|  hypothetical protein POPTR_0102s00210g           63.9    3e-08   
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.9    3e-08   
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    63.9    3e-08   
gb|EMT17847.1|  Secologanin synthase                                  63.9    3e-08   
gb|KJB28186.1|  hypothetical protein B456_005G032900                  63.9    3e-08   
gb|EEE67659.1|  hypothetical protein OsJ_25270                        63.5    3e-08   
ref|NP_001060385.2|  Os07g0635300                                     63.5    3e-08   
gb|ABC68405.1|  cytochrome P450 monooxygenase CYP72A68                63.5    3e-08   
gb|KHN44060.1|  Secologanin synthase                                  63.5    3e-08   
dbj|BAC07129.1|  putative cytochrome P450                             63.5    3e-08   
gb|EEE67038.1|  hypothetical protein OsJ_23978                        63.5    3e-08   
ref|XP_011627833.1|  PREDICTED: cytochrome P450 CYP749A22             62.4    3e-08   
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like             63.5    3e-08   
gb|KHG14554.1|  Cytochrome P450 protein                               63.5    3e-08   
ref|XP_010273926.1|  PREDICTED: cytochrome P450 72A15-like            63.5    3e-08   
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219             63.5    3e-08   
emb|CDX82469.1|  BnaA03g33520D                                        61.6    3e-08   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...  63.5    3e-08   
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    3e-08   
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                 63.5    3e-08   
ref|XP_006658008.1|  PREDICTED: cytochrome P450 734A6-like            63.5    3e-08   
gb|ERN17804.1|  hypothetical protein AMTR_s00047p00167300             60.5    3e-08   
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg           63.5    3e-08   
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...  63.5    3e-08   
gb|KCW47557.1|  hypothetical protein EUGRSUZ_K01306                   62.4    3e-08   
ref|XP_006840143.2|  PREDICTED: cytochrome P450 CYP72A219             63.5    3e-08   
emb|CDP15981.1|  unnamed protein product                              63.5    3e-08   
gb|KHG30566.1|  Cytochrome P450 protein                               62.8    3e-08   
gb|AET02541.2|  cytochrome P450 family 72 protein                     63.5    3e-08   
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg           63.5    3e-08   
ref|XP_003562608.1|  PREDICTED: cytochrome P450 734A6-like            63.5    3e-08   
emb|CDX98485.1|  BnaC05g38900D                                        63.5    3e-08   
ref|NP_001050202.1|  Os03g0371000                                     62.8    3e-08   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    3e-08   
ref|XP_004511114.1|  PREDICTED: secologanin synthase-like             63.5    3e-08   
ref|XP_006377692.1|  hypothetical protein POPTR_0011s10280g           58.9    4e-08   
gb|KCW67651.1|  hypothetical protein EUGRSUZ_F01398                   63.2    4e-08   
gb|EEE59120.1|  hypothetical protein OsJ_11004                        63.2    4e-08   
ref|XP_003628061.1|  Cytochrome P450 monooxygenase CYP72A65           63.2    4e-08   
gb|KHG07569.1|  Cytochrome P450 protein                               63.2    4e-08   
gb|KJB28195.1|  hypothetical protein B456_005G033700                  63.2    4e-08   
ref|XP_003628065.1|  Cytochrome P450 monooxygenase CYP72A65           63.2    4e-08   
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.2    4e-08   
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.2    4e-08   
ref|XP_009790069.1|  PREDICTED: cytochrome P450 734A1                 63.2    4e-08   
gb|AFK40287.1|  unknown                                               61.6    4e-08   
gb|KCW44812.1|  hypothetical protein EUGRSUZ_L01624                   63.2    4e-08   
ref|XP_004502797.1|  PREDICTED: cytokinin hydroxylase-like            63.2    4e-08   
dbj|BAL45205.1|  cytochrome P450 monooxygenase                        63.2    4e-08   
gb|ABF96180.1|  Cytochrome P450 family protein, expressed             63.2    4e-08   
ref|XP_007204041.1|  hypothetical protein PRUPE_ppa021108mg           63.2    4e-08   
emb|CAN67740.1|  hypothetical protein VITISV_015554                   63.2    4e-08   
ref|XP_008345110.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    4e-08   
ref|NP_001060386.1|  Os07g0635500                                     63.2    4e-08   
gb|EMS66485.1|  Secologanin synthase                                  63.5    4e-08   
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219             63.2    4e-08   
gb|ABC69393.1|  CYP72A55v2                                            63.2    4e-08   
dbj|BAF98466.1|  cytochrome P450                                      63.2    4e-08   
gb|KHG11625.1|  Cytochrome P450 protein                               63.2    4e-08   
ref|XP_010092742.1|  Secologanin synthase                             63.2    4e-08   
ref|XP_002455989.1|  hypothetical protein SORBIDRAFT_03g028560        63.2    4e-08   
gb|KJB79281.1|  hypothetical protein B456_013G041900                  63.2    4e-08   
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  63.2    4e-08   
ref|XP_008374265.1|  PREDICTED: cytochrome P450 CYP749A22-like        63.2    4e-08   
gb|ABC69392.1|  CYP72A55v1                                            63.2    4e-08   
ref|XP_007133221.1|  hypothetical protein PHAVU_011G161600g           60.8    4e-08   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...  63.2    4e-08   
gb|KHG27490.1|  Cytochrome P450 protein                               63.2    4e-08   
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  63.2    4e-08   
ref|XP_010692015.1|  PREDICTED: cytochrome P450 714C2-like            63.2    5e-08   
gb|KEH38477.1|  cytochrome P450 family 72 protein                     62.8    5e-08   
emb|CBI22131.3|  unnamed protein product                              63.2    5e-08   
ref|XP_008782717.1|  PREDICTED: cytochrome P450 714B3-like            63.2    5e-08   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...  63.2    5e-08   
gb|KHN02133.1|  Cytochrome P450 734A1                                 63.2    5e-08   
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.2    5e-08   
gb|KEH38476.1|  cytochrome P450 family 72 protein                     63.2    5e-08   



>ref|XP_009784592.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Nicotiana 
sylvestris]
Length=266

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIK-------------------------------  658
            DG++RLKI++ I+E+  R YP +PFIK K                               
Sbjct  117  DGLSRLKIMNMIIEESLRLYPPVPFIKRKVNKKVQLGKLTLPPQMQLYISPLAVQHDPKI  176

Query  657  ---------------GIVEEESK---AFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFA  532
                           G+V+  +    AF    Y   T LGLNFA IE+KV LS+IL+R+ 
Sbjct  177  WGEDVHIFKPERFAEGVVKATNNNPVAFLPFGYGPRTCLGLNFAMIESKVTLSMILQRYM  236

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FT+SP+Y+HSPV  F + P+HG+++ILHK+
Sbjct  237  FTVSPSYVHSPVQLFMLRPQHGVKIILHKI  266



>ref|XP_009607163.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana tomentosiformis]
Length=507

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 76/150 (51%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIK-------------------------------  658
            DG++RLKI++ IVE+  R YP +PF K K                               
Sbjct  358  DGLSRLKIMNMIVEESLRLYPPVPFTKRKVNKKVQLGKLTLPPQMQLYISPLAVQHDPKI  417

Query  657  ---------------GIVEEESK---AFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFA  532
                           G+V+  +    AF    Y   T LGLNFA IEAKV LS+IL+R+ 
Sbjct  418  WGEDVHIFKPERFAEGVVKATNNNPVAFLPFGYGPRTCLGLNFAMIEAKVTLSMILQRYM  477

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FT+SP+Y+HSPV  F + P+HG++VILHK+
Sbjct  478  FTVSPSYVHSPVQLFMLRPEHGVKVILHKI  507



>ref|XP_006348652.1| PREDICTED: cytochrome P450 734A1-like [Solanum tuberosum]
Length=505

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIK-----------------------------GI  652
            DG++RLKI++ I+++  R YP +PFIK K                              I
Sbjct  356  DGLSRLKIMNMILDESLRLYPPVPFIKRKVDKKVELGKLTLPPEMHFYISALAVQHDCKI  415

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              E+   FK   +  G                    T LGLNFA  EAK+ LS+IL+R+ 
Sbjct  416  WGEDVHVFKPDRFAEGVVKASNNNPVAYLPFGYGPRTCLGLNFAMTEAKITLSMILQRYM  475

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FT+SPTY+HSP   F + P+HG++VILHK+
Sbjct  476  FTISPTYVHSPADLFMLRPQHGVKVILHKI  505



>ref|XP_010320842.1| PREDICTED: cytochrome P450 CYP749A22 [Solanum lycopersicum]
Length=501

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 73/150 (49%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIK-------------------------------  658
            DG++RLK ++ I+++  R YP +PFIK K                               
Sbjct  352  DGLSRLKTMNMILDESLRLYPPVPFIKRKVDNKVELGKLTLPGEMHFYISPLALHHDRKI  411

Query  657  ---------------GIVEEESK---AFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFA  532
                           G+V+  +    A+    Y   T LGLNFA  EAK+ LS+IL+R+ 
Sbjct  412  WGEDVHVFRPDRFAEGVVKATNNNPVAYLPFGYGPRTCLGLNFAMTEAKIALSMILQRYM  471

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FT+SPTY+HSP   F + P+HG+ VILHK+
Sbjct  472  FTMSPTYVHSPAQLFMLRPQHGVEVILHKI  501



>gb|ERN17797.1| hypothetical protein AMTR_s00047p00158950 [Amborella trichopoda]
Length=141

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = -1

Query  660  KGIVEEESKAFKSSCYDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGF  487
            +G++   S       +  G R+  GLNFA +EAKV LS+ILRR+ FTLSP+Y H+P+H  
Sbjct  67   QGVMNAASTQVSFIPFGHGPRICVGLNFATLEAKVALSMILRRYTFTLSPSYQHAPIHRI  126

Query  486  TVTPKHGIRVILHKL  442
            T+ P+HG ++I+H L
Sbjct  127  TMVPQHGAQIIIHSL  141



>ref|XP_008350887.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=518

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  EAK+ LS+IL+RF+FTLSP YIHSP+H  T  P+HG++V+LH L
Sbjct  465  TCVGLNFATTEAKIALSMILQRFSFTLSPGYIHSPLHYLTCRPQHGVQVMLHSL  518



>ref|XP_011654017.1| PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Cucumis sativus]
Length=526

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 70/149 (47%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPL--------------------------LPFIKIKGIVE-  646
            DG++RLK+V  I+ +  R YP                           LP + ++   E 
Sbjct  378  DGLSRLKVVTMILNEVLRLYPPVSMFGRLVKKETKLGKLTLPAGVMLGLPVVLMQCDPEL  437

Query  645  --EESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++  FK   +  G                     +GLNFA IEAK+ LS+IL+RF+F
Sbjct  438  WGEDAHEFKPERFSEGVSKAAKNPGAFVPFGWGPRICIGLNFAMIEAKMALSMILQRFSF  497

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP+Y H+P+ G T  P+HG  +ILHKL
Sbjct  498  QLSPSYTHTPIAGLTTQPQHGAHIILHKL  526



>ref|XP_011070909.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=510

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 70/150 (47%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIK-----------------------------GI  652
            DGIARLKI+  I+E+  R Y  +P IK K                              I
Sbjct  361  DGIARLKILTMIIEESLRLYCPVPAIKRKVEKEVKLGKLTLPPQTELYISQLALHHDPNI  420

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              E+   F+   ++ G                    T +GLNFA  EAK+ LS+IL+R+ 
Sbjct  421  WGEDVHLFRPERFEQGIVKATNNNPVAFLPFGFGPRTCVGLNFAMTEAKIALSMILQRYR  480

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
              LSPTYIHSPV  F V P+HG++VIL K+
Sbjct  481  LILSPTYIHSPVQVFMVRPQHGVQVILQKI  510



>ref|XP_008339765.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA IEAK+ LS+IL+R++F LSP Y+HSP++G  V+P+HG++VILH L
Sbjct  463  TCVGMNFAIIEAKIALSMILQRYSFXLSPXYMHSPINGLAVSPQHGVQVILHSL  516



>ref|XP_008352941.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA IEAK+ LS+IL+R++F LSP Y+HSP++G  V+P+HG++VILH L
Sbjct  463  TCVGMNFAIIEAKIALSMILQRYSFXLSPXYMHSPINGLAVSPQHGVQVILHSL  516



>ref|XP_009356448.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+NF  IEAK+ LS+ILRR++FTLSP Y+H P H  TV PKHGI+V+LH L
Sbjct  465  VGMNFTNIEAKIALSMILRRYSFTLSPGYVHLPFHYLTVRPKHGIQVMLHSL  516



>ref|XP_008390037.1| PREDICTED: uncharacterized protein LOC103452311 [Malus domestica]
Length=1032

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603   TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             T +GLNFA  EAK+ LS+IL+RF+FTLSP YIHSP+H  T  P+HG++V+LH L
Sbjct  979   TCVGLNFATTEAKIALSMILQRFSFTLSPGYIHSPLHYLTCRPQHGVQVMLHSL  1032


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIR  460
            T +GLNF+  EAK+ LS+IL+R++FTLSP+Y+H P+H  TV P HG++
Sbjct  463  TCVGLNFSTTEAKIALSMILQRYSFTLSPSYVHLPLHYVTVRPYHGVQ  510



>ref|XP_010091620.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44886.1| Cytochrome P450 734A1 [Morus notabilis]
Length=475

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 68/152 (45%), Gaps = 49/152 (32%)
 Frame = -1

Query  750  IQDGIARLKIVDEIVEDCQRQYP-----------------------------LLPFIKIK  658
            I DGIARLK++ +I+ +  R YP                              LP     
Sbjct  324  IADGIARLKVISQIINESTRLYPPVVAFSRHAAKEVRLGNLNLPAKMELVISNLPLHLDP  383

Query  657  GIVEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRR  538
             I  E+   FK   +  G                    T +G+NFA  EAK+ LS+ILRR
Sbjct  384  QIWGEDVYEFKPERFSEGVVKATNNNSAAYFPFGMGPRTCVGMNFALTEAKIALSMILRR  443

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            ++FTLSP Y+HSP    T+ P+HGI+V+L  L
Sbjct  444  YSFTLSPAYVHSPYAFITLQPQHGIQVVLQPL  475



>ref|XP_006856330.2| PREDICTED: cytochrome P450 CYP749A22 [Amborella trichopoda]
Length=573

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI------  661
            DG+A+LKI++ I+ +  R YP                          ++P + +      
Sbjct  425  DGLAQLKIMNMIINESLRLYPPIQHQNKVSTKKARVGKYTIPSGMELVVPILTVHHDPSQ  484

Query  660  --------------KGIVEEESKAFKSSCYDAGTRL--GLNFAKIEAKVVLSIILRRFAF  529
                          +G++   S       +  G R+  GLNFA +EAKV LS+ILRR+ F
Sbjct  485  WGEDVNLFNPDRFAQGVMNAASTQVSFIPFGHGPRICVGLNFATLEAKVALSMILRRYTF  544

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            TLSP+Y H+P+H  T+ P+HG ++I+H L
Sbjct  545  TLSPSYQHAPIHRITMVPQHGAQIIIHSL  573



>ref|XP_007223262.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
 gb|EMJ24461.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
Length=508

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G NFA IEAK+ LS+IL+R+ FTLSP Y+HSPV   T+ P+HG++V+LHKL
Sbjct  455  TCVGFNFATIEAKIALSMILQRYQFTLSPGYVHSPVDYLTIRPQHGVQVMLHKL  508



>ref|XP_004297211.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=520

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 70/152 (46%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEES------------------------  637
            DG+A+LK +  I+ +  R YP  P I +   V++E                         
Sbjct  371  DGLAKLKTMSMIINESLRLYP--PVITLARNVDKEVRLGNLTIPPNVEFLVPNLALHHEP  428

Query  636  -------KAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRR  538
                   K FK   +  G                    T +GLNFA IEAK+ L++IL+R
Sbjct  429  QFWGQDVKVFKPERFSEGVASATNNNMAAFLPFGMGPRTCVGLNFATIEAKIALAMILQR  488

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            ++FTLSP Y+HSP    TV P+HG++VILH L
Sbjct  489  YSFTLSPAYVHSPFQFLTVRPQHGLQVILHSL  520



>ref|XP_008243803.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=508

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G NFA IEAK+ LS+IL+R+ FTLSP Y+HSPV   T+ P+HG++V+LHKL
Sbjct  455  TCVGFNFAAIEAKIALSMILQRYQFTLSPGYVHSPVDYLTIRPQHGVQVMLHKL  508



>ref|XP_009356543.1| PREDICTED: uncharacterized protein LOC103947364 [Pyrus x bretschneideri]
Length=1045

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  EAK+ LS+IL+R++FTLSP YIHSP+H  T  P+HG++V+LH L
Sbjct  475  TCVGLNFATTEAKIALSMILQRYSFTLSPGYIHSPLHYLTCRPQHGVQVMLHSL  528


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603   TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             T  G+NF   EAKV LS+IL+R++F+LSP YIHSP    T+ P+HG++VILH L
Sbjct  988   TCAGINFVANEAKVALSMILQRYSFSLSPAYIHSPFQLLTLRPRHGVQVILHPL  1041



>ref|XP_007149355.1| hypothetical protein PHAVU_005G0634000g, partial [Phaseolus vulgaris]
 gb|ESW21349.1| hypothetical protein PHAVU_005G0634000g, partial [Phaseolus vulgaris]
Length=54

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+VLS++L+RF+F +SP Y H+PV  FT+ PKHG  +IL KL
Sbjct  3    IGQNFALLEAKLVLSLLLQRFSFQISPAYAHAPVTVFTLHPKHGAHIILQKL  54



>ref|XP_007222985.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
 gb|EMJ24184.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
Length=516

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  EAK+ LS+IL+R+AFTLSP Y+H P+H  TV P+HG++V+LH L
Sbjct  463  TCVGLNFAITEAKIALSMILQRYAFTLSPGYVHLPLHYLTVRPQHGVQVMLHSL  516



>ref|XP_009356447.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  GTR  +GLNF+  EAK+ LS+IL+R++FTLSP+Y+H P+H  TV P HG++VILH L
Sbjct  457  FGLGTRTCVGLNFSTTEAKIALSMILQRYSFTLSPSYVHLPLHYVTVRPYHGVQVILHSL  516



>ref|XP_008243895.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1009

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603   TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             T +GLNFA  EAK+ LS+IL+R+AFTLSP Y+H P+H  TV P+HG++V+LH L
Sbjct  956   TCVGLNFAITEAKIALSMILQRYAFTLSPGYVHLPLHYLTVRPQHGVQVMLHSL  1009


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            +GLNFA IEAK+ LS++L+R+ FTLSP Y+H P    T  P  G++V+
Sbjct  468  VGLNFATIEAKIALSMVLQRYFFTLSPGYVHLPFQLVTNRPLRGVQVM  515



>ref|XP_008389383.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=142

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+NF  IEAK+ LS+IL+R++FTLSP Y+H P H  TV PK GI+V+LH L
Sbjct  91   VGMNFTNIEAKIALSMILQRYSFTLSPGYVHLPFHYLTVRPKRGIQVMLHSL  142



>ref|XP_008452437.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=522

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 67/149 (45%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIK-----  658
            DG++RLK+V  I  +  R YP                           LP I I+     
Sbjct  374  DGLSRLKVVTMIFNEVLRLYPPVSMYARTVNKETKLGKLTLPAGVMLSLPIILIQTDPEL  433

Query  657  ---------------GIVEEESKAFKSSCYDAGTRL--GLNFAKIEAKVVLSIILRRFAF  529
                           G+ +     F    +  G R+  GLNFA IEAK+ LS+IL+RF+F
Sbjct  434  WGQDAYEFNPDRFSEGVSKATKNPFAFVPFGWGPRICIGLNFAMIEAKMALSMILQRFSF  493

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP+Y H+P  G T  P+HG  +ILHKL
Sbjct  494  ELSPSYTHTPHTGLTTQPQHGAHIILHKL  522



>ref|XP_008360080.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=520

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            T +G+NFA IEAK+ LS+IL+R++FTLSP Y+HSP+   TV P+HG++VILH
Sbjct  467  TCVGMNFAIIEAKIALSMILQRYSFTLSPGYVHSPIQFLTVRPQHGVQVILH  518



>ref|XP_008361867.1| PREDICTED: uncharacterized protein LOC103425555 [Malus domestica]
Length=1316

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  603   TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
             T +G+NFA IEAK+ LS+IL+R++FTLSP Y+HSP+   TV P+HG++VILH
Sbjct  1263  TCVGMNFAIIEAKIALSMILQRYSFTLSPGYVHSPIQFLTVRPQHGVQVILH  1314



>gb|AEM42984.1| cytochrome P450 [Siraitia grosvenorii]
Length=519

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 70/155 (45%), Gaps = 53/155 (34%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVE---------------------------  646
            +G+A+LK +  I+ +C R YP  P + +   VE                           
Sbjct  365  EGLAKLKTMTMIINECLRLYP--PAMTVSRTVEKEVRLGRLVLPKTITVAVPTIAVHQDT  422

Query  645  ----EESKAFKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRR  538
                E++  FK   +  G                      +G+NFA  EAK+V+S+ILRR
Sbjct  423  EYWGEDAHVFKPERFSEGIAKVIESNSAGYLPFGLGPRICVGMNFALNEAKIVISMILRR  482

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEE  433
            ++FTLSP Y HSP+   TV P+HG++VILH L   
Sbjct  483  YSFTLSPAYSHSPIQLVTVCPQHGLQVILHPLSHH  517



>ref|XP_008389250.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IE K+VLS+IL+RF+FTLSP YIHSP    TV P+HG++V+LH L
Sbjct  464  VGSNFAAIETKIVLSMILQRFSFTLSPAYIHSPYRLLTVRPQHGVQVMLHSL  515



>ref|XP_009356202.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IE K+VLS+IL+RF+FTLSP YIHSP    TV P+HG++V+LH L
Sbjct  464  VGSNFAAIETKIVLSMILQRFSFTLSPAYIHSPYRLLTVRPQHGVQVMLHSL  515



>ref|XP_011654406.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]
Length=474

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 6/72 (8%)
 Frame = -1

Query  639  SKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA K+ C    +  G R+  GLNF  IEAK+ LS+IL+RF+F LSP+Y HSP    T  
Sbjct  403  SKATKNPCAFIPFGWGPRICIGLNFTMIEAKMTLSMILQRFSFELSPSYTHSPSASLTTQ  462

Query  477  PKHGIRVILHKL  442
            P+HG  +ILHKL
Sbjct  463  PQHGAHIILHKL  474



>ref|XP_008243777.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1030

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603   TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             T +GLNFA  EAK+ LS+IL+++AFTLSP Y+H P+H  TV P+HG++V+LH L
Sbjct  977   TCVGLNFATTEAKIALSMILQQYAFTLSPVYVHLPLHYLTVRPQHGVQVMLHSL  1030


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            T +GLNFA  EAK+ LS+IL+R+AFTLSP Y+HSP H  TV P+HG++V+
Sbjct  463  TCVGLNFATTEAKIALSMILQRYAFTLSPGYVHSPFHHLTVRPQHGVQVL  512



>gb|AFK37510.1| unknown [Lotus japonicus]
Length=206

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 70/150 (47%), Gaps = 48/150 (32%)
 Frame = -1

Query  747  QDGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KG  655
             +G++RLKIV  ++ +  R YP                           LP + I   + 
Sbjct  57   NEGLSRLKIVTMVLYEVLRLYPPVIYFNRVARKDVKLGNFTIPAGVNVSLPILLIHHDRN  116

Query  654  IVEEESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFA  532
            I  +++  FK   +  G                     +G NFA +EAK+V+S+IL+RF+
Sbjct  117  IWGDDATEFKPERFSEGLAKATKGQVSFFPFGWGPRVCIGQNFALLEAKIVISLILQRFS  176

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            F LSPTY H+P   F++ PKHG  +ILHKL
Sbjct  177  FELSPTYAHAPRTTFSLNPKHGAHIILHKL  206



>ref|XP_011462984.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=430

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G+R+  GLNFA +EAK+ LS+IL+R++FTLSP Y+HSP    T+ P+HG++V+L+ L
Sbjct  367  FGMGSRVCVGLNFATMEAKIALSMILQRYSFTLSPAYVHSPFRSMTLRPQHGVQVMLYSL  426

Query  441  GEE  433
              E
Sbjct  427  NCE  429



>ref|XP_007221838.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
 gb|EMJ23037.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
Length=516

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 68/152 (45%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESKA----------------------  631
            DGIARLK +  I+ +  R YP  P + I   VE E +                       
Sbjct  367  DGIARLKTMSMIINESLRLYP--PIVSIARKVEREVRLGKLIVPANVEIFIPSLAIHHEP  424

Query  630  ---------FKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRR  538
                     FK   +  G                      +GL++A  EAK+VLS+IL+R
Sbjct  425  QLWGEDVHLFKPERFSEGIAKATEKRIAAFLPFGMGPRNCVGLDYATTEAKIVLSMILQR  484

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            ++FTLSP Y+HSP+   TV P+HG +VILH L
Sbjct  485  YSFTLSPAYVHSPLQYITVRPQHGAQVILHSL  516



>ref|XP_011102241.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Sesamum indicum]
Length=288

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  633  AFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            AF    Y   T +GLNFA  E K+ LS+IL+R+ FTLSP+YIHSP+   T+ P+HG++++
Sbjct  225  AFLPFGYGPRTCVGLNFANNEVKIALSMILQRYKFTLSPSYIHSPLSLVTIRPQHGVQIM  284

Query  453  LHKL  442
            L KL
Sbjct  285  LQKL  288



>ref|XP_004297212.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=516

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G+R+  GLNFA +EAK+ LS+IL+R++FTLSP Y+HSP    T+ P+HG++V+L+ L
Sbjct  453  FGMGSRVCVGLNFATMEAKIALSMILQRYSFTLSPAYVHSPFRSMTLRPQHGVQVMLYSL  512

Query  441  GEE  433
              E
Sbjct  513  NCE  515



>gb|KCW85136.1| hypothetical protein EUGRSUZ_B019751, partial [Eucalyptus grandis]
Length=127

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEE  433
            T +G+NFA  EAK+ +++IL+R++FTLSP YIH P H  T+ P+HG++VILH L  E
Sbjct  64   TCVGINFATNEAKIAIAMILQRYSFTLSPGYIHLPAHILTIHPQHGVKVILHPLQCE  120



>ref|XP_008243806.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 66/150 (44%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP-----------------------------LLPFIKIKGI  652
            DGIARLK +  I+ +  R YP                              L F    G+
Sbjct  367  DGIARLKTMTMIINETLRLYPPIVVLEREAEREVRLGNLIIPAAVELVIPCLAFHHEPGL  426

Query  651  VEEESKAFKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRRFA  532
              ++   FK   +  G                      +GLNFA  E K+VLS+IL+R++
Sbjct  427  WGQDVHLFKPERFSEGVAKATKNNIATFLPFGMGPRNCVGLNFATNEVKIVLSMILQRYS  486

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSP Y+HSP    TV P+HG++V+LH L
Sbjct  487  FTLSPAYVHSPFRLLTVRPQHGLQVMLHSL  516



>ref|XP_004297206.2| PREDICTED: uncharacterized protein LOC101301286 [Fragaria vesca 
subsp. vesca]
Length=1032

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -1

Query  615   YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             +  G R+  G +FA  EAKVVLS+IL+R++FTLSPTY+HSP    T+ P+HG++V+LH L
Sbjct  973   FGTGRRMCVGSDFAVTEAKVVLSMILQRYSFTLSPTYVHSPYEALTLCPQHGVQVMLHSL  1032


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            T +G NFA IE K+ LS+IL+R++FTLSP Y+HSP H  T+ P+HG++V+
Sbjct  458  TCVGFNFATIEVKIALSMILQRYSFTLSPGYVHSPFHFLTLRPQHGVQVL  507



>ref|XP_007226180.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
 gb|EMJ27379.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
Length=516

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G R+  GLNFA  EAK+ LS+IL+R+AFTLSP Y+HSP H  TV P+HG++V L  L
Sbjct  457  FSMGPRICVGLNFATTEAKIALSMILQRYAFTLSPGYVHSPFHHLTVRPQHGVQVRLQPL  516



>ref|XP_007224838.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
 gb|EMJ26037.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
Length=501

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA +E+K+ L++IL+R++FTLSP Y+HSP+   TV P+HGI VILH L
Sbjct  448  TCVGMNFAIVESKIALAMILQRYSFTLSPGYVHSPIQFMTVRPQHGIPVILHSL  501



>ref|XP_008367092.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=543

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+NF  IEAK+ LS+IL+R++FTLSP Y+H P H  TV PK GI+V+LH L
Sbjct  492  VGMNFTNIEAKIALSMILQRYSFTLSPGYVHLPFHYLTVRPKRGIQVMLHSL  543



>ref|XP_011462983.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -1

Query  621  SCYDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            S +  G R+  G+NFA  EAK+ LS+IL+ ++FTLSP Y+HSP    TV P+HG++VILH
Sbjct  454  SPFGMGPRMCAGINFASNEAKIALSMILQHYSFTLSPAYVHSPFQFLTVRPQHGVQVILH  513

Query  447  KL  442
             L
Sbjct  514  SL  515



>ref|XP_008243805.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA +E+K+ L++IL+R++FTLSP Y+HSP+   TV P+HGI VILH L
Sbjct  463  TCVGMNFAIVESKIALAMILQRYSFTLSPGYVHSPIQFMTVRPQHGIPVILHSL  516



>gb|KJB80516.1| hypothetical protein B456_013G101100 [Gossypium raimondii]
Length=519

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL-GEEG  430
            T +G NFA + AK+VL +IL+R+ FTLSP Y+HSPV  F + P+HGI+VILH L  EEG
Sbjct  459  TCVGFNFATMGAKIVLMMILQRYRFTLSPAYVHSPVVHFVLYPQHGIQVILHSLKSEEG  517



>ref|XP_011009723.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=515

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 68/152 (45%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVE---------------------------  646
            DGIA+LKI+  I+ +  R YP  P + +   VE                           
Sbjct  366  DGIAKLKILTMIINETLRLYP--PVLGLMRKVEREVQIGQLTLPANMNLYIANAALHHDP  423

Query  645  ----EESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRR  538
                E+   FK   +  G                    T +GLNFA  EAK+ LS+IL++
Sbjct  424  EIWGEDVHLFKPERFSGGVAKATNNIPAAFFPFGLGPRTCVGLNFATTEAKITLSMILQK  483

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + FTLSPTY HSP    T+ P++G++VILH L
Sbjct  484  YLFTLSPTYTHSPYEAVTLCPRNGVQVILHSL  515



>ref|XP_004303121.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA IEAK+ LS+IL+R++FTLSP YIHSP H  T+ P++G++V+L  L
Sbjct  460  TCVGMNFATIEAKIALSMILQRYSFTLSPAYIHSPTHKITLRPQYGLQVLLQPL  513



>ref|XP_002316010.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
 gb|EEF02181.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
Length=515

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 68/152 (45%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVE---------------------------  646
            DGIA+LKI+  I+ +  R YP  P + +   VE                           
Sbjct  366  DGIAKLKILTMIINETLRLYP--PVLGLMRKVEREVQIGQLTLPANMNLYIANAALHHDP  423

Query  645  ----EESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRR  538
                E+   FK   +  G                    T +GLNFA  EAK+ LS+IL++
Sbjct  424  EIWGEDVHLFKPERFSGGVAKATNNIPAAFFPFGLGPRTCVGLNFATTEAKITLSMILQK  483

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + FTLSPTY HSP    T+ P++G++VILH L
Sbjct  484  YLFTLSPTYTHSPYEAVTLCPRNGVQVILHSL  515



>ref|XP_010044379.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86464.1| hypothetical protein EUGRSUZ_B03132 [Eucalyptus grandis]
Length=515

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+NFA  EAK+VLS+IL+R+ F LSP YIHSPV   T+ P+HG++VILH L
Sbjct  464  VGMNFAMNEAKIVLSMILQRYTFILSPGYIHSPVQILTIRPQHGLQVILHPL  515



>ref|XP_008243892.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=557

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            T +G NFA  E K+ LS+IL+ ++FTLSP Y+HSP H  TV P+HG+RV LH
Sbjct  504  TCVGFNFATTEVKIALSMILQHYSFTLSPAYVHSPFHFLTVRPQHGVRVTLH  555



>ref|XP_008389384.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+NF  IEAK+ LS+IL+R++FTLSP Y+H P H  TV PK GI+V+LH L
Sbjct  465  VGMNFTNIEAKIALSMILQRYSFTLSPGYVHLPFHYLTVRPKRGIQVMLHSL  516



>ref|XP_010044380.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=545

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+NFA  EAK+VLS+IL+R+ F LSP YIHSPV   T+ P+HG++VILH L
Sbjct  494  VGMNFAMNEAKIVLSMILQRYTFILSPGYIHSPVQILTIRPQHGLQVILHPL  545



>gb|KCW86467.1| hypothetical protein EUGRSUZ_B03135 [Eucalyptus grandis]
Length=515

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+NFA  EAK+VLS+IL+R+ F LSP YIHSPV   T+ P+HG++VILH L
Sbjct  464  VGMNFAMNEAKIVLSMILQRYTFILSPGYIHSPVQILTIRPQHGLQVILHPL  515



>ref|XP_011460709.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=336

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  594  GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            G NFA  E K+ LS+ILRR+ FTLSP Y+HSP+H  T+ P++G++VILH L
Sbjct  286  GFNFATTEIKIALSMILRRYTFTLSPGYVHSPLHFLTLRPQNGLQVILHPL  336



>gb|KJB10709.1| hypothetical protein B456_001G217300 [Gossypium raimondii]
Length=519

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL-GEEG  430
            T +G NFA + AK+VL +IL+R+ FT SPTY+HSPV  F + P+HGI+VILH L  +EG
Sbjct  459  TCVGFNFATLGAKIVLIMILQRYRFTFSPTYVHSPVINFLLVPQHGIQVILHSLQSDEG  517



>ref|XP_011102246.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=506

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  633  AFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            AF    Y   T +GLNFA  E K+ LS+IL+R+ FTLSP+YIHSP+   T+ P+HG++++
Sbjct  443  AFLPFGYGPRTCVGLNFANNEVKIALSMILQRYKFTLSPSYIHSPLSLVTIRPQHGVQIM  502

Query  453  LHKL  442
            L KL
Sbjct  503  LQKL  506



>ref|XP_007226531.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
 gb|EMJ27730.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
Length=516

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 65/150 (43%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP-----------------------------LLPFIKIKGI  652
            DGIARLK +  I+ +  R YP                              L F    G 
Sbjct  367  DGIARLKTMTMIINETLRLYPPIVVLEREAEREVRLGNLIIPATVELVIPCLAFHHEPGF  426

Query  651  VEEESKAFKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRRFA  532
              ++   FK   +  G                      +GLNFA  E K+VLS+IL+R++
Sbjct  427  WGQDVHLFKPERFSEGVAKATKNNIATFLPFGMGPRNCVGLNFATNEVKIVLSMILQRYS  486

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSP Y+HSP    TV P+HG++++LH L
Sbjct  487  FTLSPAYVHSPFRLLTVRPQHGLQIMLHSL  516



>ref|XP_010040838.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=584

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 63/111 (57%), Gaps = 13/111 (12%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEGSQ  424
            T +G+NFA  EAK+ +++IL+R++FTLSP YIH P H  T+ P+HG++VILH L  E   
Sbjct  463  TCVGINFATNEAKIAIAMILQRYSFTLSPGYIHLPAHILTIHPQHGVKVILHPLQCE-HV  521

Query  423  ITRIVKTVGVIAAMGVAAWGAYKVVGSFGV-------GEEPDQRKKKMMKN  292
            ++ I+  V ++        G     G  GV       G+EP     ++ +N
Sbjct  522  VSSIITPVALLLTCPTNELG-----GDCGVVFHLEHLGDEPRAHAMELAEN  567



>gb|EYU22575.1| hypothetical protein MIMGU_mgv1a004725mg [Erythranthe guttata]
Length=513

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 69/150 (46%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIK-----------------------------GI  652
            D I+RLKI++ I+E+  R YP +P IK K                              I
Sbjct  364  DNISRLKIMNMIIEESLRLYPPVPAIKRKVDKKVTLGKITLPPQMELYISPLALQHDPNI  423

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              E+   F+   +  G                    T +GL+FA  EAK+ LS+ILRR+ 
Sbjct  424  WGEDVHFFRPERFGQGIAKASNDNTVAFLPFGFGPRTCVGLSFAITEAKIALSMILRRYR  483

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
              +SP YIHSPV  F + P+HGI+VIL K+
Sbjct  484  LIVSPGYIHSPVQVFMIRPQHGIQVILEKI  513



>emb|CDP20014.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (58%), Gaps = 8/107 (7%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESKAFKSSC----YDAGTRL--GLNF  583
            DG+  LK+V  I+ +  R YP  P  K +   +  S A         +  G R+  G NF
Sbjct  260  DGLNHLKLVTMILHEVLRLYP--PEFKPERFADGVSNATNGKVVFFPFGWGPRICIGQNF  317

Query  582  AKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            A +EAKV L++IL+RF+F LSP+Y H+P    T+ P++G  +ILHKL
Sbjct  318  AMLEAKVALAMILQRFSFELSPSYTHAPRVVLTLQPQYGAHLILHKL  364



>gb|KDO52095.1| hypothetical protein CISIN_1g040765mg, partial [Citrus sinensis]
Length=141

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +E+K+ L++IL++F F LSPTYIH+P  G TV P+HG  +ILHK+
Sbjct  90   IGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI  141



>ref|XP_008784486.1| PREDICTED: cytochrome P450 CYP72A219-like [Phoenix dactylifera]
Length=512

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LS+IL+ F+F LSPTYIHSP +  TV P+HG ++ILHK+
Sbjct  461  VGQNFALIEAKLALSMILQHFSFELSPTYIHSPYYLLTVQPQHGAQIILHKV  512



>ref|XP_006437869.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
 gb|ESR51109.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
Length=421

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G NF  IEAK+ LS+ILRR+ FTLSP Y+HSPV   T+ P+HGI+V+L  L
Sbjct  368  TCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVPRITLCPQHGIQVMLRAL  421



>gb|KEH38471.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=523

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 67/149 (45%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KGI  652
            DGI+RLKIV  I+ +  R YP                           LP + I   + I
Sbjct  375  DGISRLKIVTMILYEVLRLYPPVIYFNRVARKDVKVGSLFLPAGVHVSLPILLIHHNRDI  434

Query  651  VEEESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              +++  F    +  G                     +G NFA +EAK+VLS +L+RF+F
Sbjct  435  WGDDATEFNPERFSEGIAKATKGQVCFFPFGYGPRVCMGQNFALLEAKMVLSQLLQRFSF  494

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP Y+H+P   FT+ PKHG  +I HKL
Sbjct  495  ELSPNYVHAPTTVFTLNPKHGAHIIFHKL  523



>emb|CDP12576.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G NFA  E K+ LS+IL+R+AFTLSP+Y+H+PV  F + P+HG++V+LH L
Sbjct  472  TCVGSNFAITEVKIALSMILQRYAFTLSPSYVHAPVQMFALMPQHGVQVVLHVL  525



>gb|ACV88396.1| cytochrome p450 monoxygenase [Cucumis sativus]
Length=156

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LSIIL+ F+F LSP+Y H+P+   T  P+HG  +ILHKL
Sbjct  105  IGQNFAMIEAKIALSIILQHFSFELSPSYTHAPISILTTQPQHGAHIILHKL  156



>ref|XP_008340298.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103403255 
[Malus domestica]
Length=1026

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            +GLNFA IEAK+ LS+IL+R++FTLSP YIH PVH  T+ P+HGI+V+
Sbjct  475  VGLNFATIEAKIALSMILQRYSFTLSPGYIHLPVHYLTMRPQHGIQVM  522


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  603   TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL-GEEGS  427
             T +GLNFA  EAK+ LS+IL+R++FTLSP Y+H P+H   V P HG++VIL  L GE+ S
Sbjct  965   TXVGLNFATTEAKIALSMILQRYSFTLSPGYVHXPLHYIXVRPHHGVQVILLALNGEDQS  1024



>gb|KCW82725.1| hypothetical protein EUGRSUZ_C04102 [Eucalyptus grandis]
Length=508

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIKG---I  652
            DGIA+LK +  I+ +  R YP                           +P +K+     I
Sbjct  359  DGIAKLKTMGMIINESLRLYPPVVGLIRKVATKTRLGKLVLPANMGLYIPNLKLHHNPQI  418

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              ++++ FK   +  G                    T +G NFA  EAK+ LS+IL+R+ 
Sbjct  419  WGDDAQLFKPERFSEGVAKATNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYT  478

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            F+LSP Y+HSP    T +P+HG++VI H L
Sbjct  479  FSLSPAYVHSPTQLLTTSPQHGLQVIFHAL  508



>gb|KCW82722.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=491

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIKG---I  652
            DGIA+LK +  I+ +  R YP                           +P +K+     I
Sbjct  342  DGIAKLKTMGMIINESLRLYPPVVGLIRKIATKTRLGKLVLPANMGLYIPNLKLHHNPQI  401

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              ++++ FK   +  G                    T +G NFA  EAK+ LS+IL+R+ 
Sbjct  402  WGDDAQLFKPERFSEGVAKASNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYT  461

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            F+LSP Y+HSP    T +P+HG++VI H L
Sbjct  462  FSLSPAYVHSPTQLLTTSPQHGLQVIFHAL  491



>ref|XP_008443404.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=520

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = -1

Query  639  SKAFKSS-CY---DAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA K+  CY     G R+  G NFA IEAK+ LS+IL++F+FTLSPTY H+P+   T+ 
Sbjct  449  SKATKNQVCYIPFGWGPRICIGQNFAMIEAKIALSMILQQFSFTLSPTYTHAPITNITIQ  508

Query  477  PKHGIRVILHKL  442
            P+HG  +IL KL
Sbjct  509  PQHGAHLILRKL  520



>ref|XP_010049898.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82721.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=508

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 68/150 (45%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIKG---I  652
            DGIA+LK +  I+ +  R YP                           +P +K+     I
Sbjct  359  DGIAKLKTMGMIINESLRLYPPVVGLIRKIATKTRLGKLVLPANMGLYIPNLKLHHNPQI  418

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              ++++ FK   +  G                    T +G NFA  EAK+ LS+IL+R+ 
Sbjct  419  WGDDAQLFKPERFSEGVAKASNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYT  478

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            F+LSP Y+HSP    T +P+HG++VI H L
Sbjct  479  FSLSPAYVHSPTQLLTTSPQHGLQVIFHAL  508



>ref|XP_006484251.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=512

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G NF  IEAK+ LS+ILRR+ FTLSP Y+HSPV   T+ P+HGI+V+L  L
Sbjct  459  TCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVPRITLCPQHGIQVMLRAL  512



>ref|XP_008243778.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G R+  GLNFA  E K+ LS+IL+R+AFTLSP Y+HSP+H  TV P+HG++V L  L
Sbjct  457  FSMGPRICVGLNFATTEVKIALSMILQRYAFTLSPGYVHSPLHLLTVRPQHGVQVRLQPL  516



>ref|XP_004297193.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=519

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA  EAK+ LS+IL+R++FTLSP Y+HSP    TV P+HG++V+LH L
Sbjct  468  IGFNFATTEAKIALSMILQRYSFTLSPGYVHSPFRYITVRPQHGVQVMLHPL  519



>gb|KDO70287.1| hypothetical protein CISIN_1g039293mg [Citrus sinensis]
Length=512

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G NF  IEAK+ LS+ILRR+ FTLSP Y+HSPV   T+ P+HGI+V+L  L
Sbjct  459  TCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVPRITLCPQHGIQVMLRAL  512



>gb|EYU22576.1| hypothetical protein MIMGU_mgv1a004757mg [Erythranthe guttata]
Length=511

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (45%), Gaps = 53/150 (35%)
 Frame = -1

Query  747  QDGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESK----------------------  634
             DGIARLKI++ I+ +C R YP  P + +   V +E+K                      
Sbjct  361  SDGIARLKIMNMIINECMRLYP--PVLTVTRKVAKEAKIGELIIPPNINIFVSILALHHN  418

Query  633  ---------AFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILR  541
                      F+   +  G                    T +GLNF   EAK+ L++IL+
Sbjct  419  PKIWGKDVHLFRPERFSEGVAKATNNNGAAFLPFGLGPRTCVGLNFTTNEAKIALTMILQ  478

Query  540  RFAFTLSPTYIHSPVHGFTVTPKHGIRVIL  451
            ++ F LSP Y+H P   F +TPK+G++VIL
Sbjct  479  KYEFVLSPNYVHHPTDAFILTPKNGVQVIL  508



>ref|XP_010046246.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=462

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA  EAK+ +++IL+R++FTLSP YIH P H  T+ P+HG++VILH L
Sbjct  399  TCVGINFATNEAKIAIAMILQRYSFTLSPGYIHLPAHILTIHPQHGVKVILHPL  452



>ref|XP_008443405.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=525

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LS+IL++F+FTLSPTY H+P+   T+ P+HG  +IL KL
Sbjct  474  IGQNFAMIEAKIALSMILQQFSFTLSPTYTHAPITNITIQPQHGAHLILRKL  525



>ref|XP_007226762.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
 gb|EMJ27961.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
Length=516

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G R+  GLNFA  E K+ LS+IL+R+AFTLSP Y+HSP+H  TV P+HG++V L  L
Sbjct  457  FSMGPRICVGLNFATTEVKIALSMILQRYAFTLSPGYVHSPLHLITVRPQHGVQVRLQPL  516



>ref|XP_007201527.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
 gb|EMJ02726.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
Length=516

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNF   EAK+ LS+IL+R++FTLSP Y+H P+H  TV P+ G++VILH L
Sbjct  463  TCVGLNFGSTEAKIALSMILQRYSFTLSPGYVHFPLHYLTVRPQLGVQVILHSL  516



>ref|XP_008243890.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=258

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA +E+K+ L++IL+R++FTLSP Y+HSP+   TV P+ G+ VILH L
Sbjct  205  TCVGMNFAIVESKIALAMILQRYSFTLSPGYVHSPIQFMTVRPQRGVPVILHSL  258



>gb|KHG26580.1| Cytochrome P450 protein [Gossypium arboreum]
Length=497

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+ FA  E K+ LS+IL+R++FTLSP Y+HSPVH  T+ P+HGI+VIL  L
Sbjct  442  VGMTFATTETKIALSMILQRYSFTLSPAYVHSPVHIITLQPEHGIQVILESL  493



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LSIIL+RF+F LSP+Y H+P+   T  P+HG  +ILHKL
Sbjct  470  IGQNFAMIEAKMALSIILQRFSFELSPSYTHAPIAVLTTQPQHGAHIILHKL  521



>ref|XP_011070908.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=514

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 67/152 (44%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESK-----------------------  634
            DGIARLKI++ ++ +C R YP  P + +   V +E+K                       
Sbjct  365  DGIARLKIINMVINECLRLYP--PVLTVTRKVAKEAKIGELRIPPKINIYISILALHHNP  422

Query  633  --------AFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRR  538
                     F+   +  G                    T +GLNF   EAKV LS+IL++
Sbjct  423  EIWGKDVHLFRPERFAEGVAKATNNNTAAFLPFGLGPRTCVGLNFTTNEAKVALSMILQK  482

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + F LSP Y H P   F +TPKHG++VIL  +
Sbjct  483  YKFVLSPNYAHHPADVFILTPKHGVQVILETI  514



>ref|XP_008243893.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Prunus mume]
Length=388

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  606  GTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            G R  + F   EAK+VLS+IL+R++FTLSP Y+HSP+   TV P+HG++VILH L
Sbjct  334  GPRNCVGFNXTEAKIVLSMILQRYSFTLSPAYVHSPLQYITVRPQHGVQVILHSL  388



>ref|XP_011008174.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=512

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T LG N+A IE K+ LS+IL+ + FTLSPTY+H PVH  TV PK GI+VIL  L
Sbjct  459  TCLGFNYAIIEGKIALSMILQSYRFTLSPTYVHHPVHLLTVCPKRGIQVILQPL  512



>ref|XP_006437868.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
 gb|ESR51108.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
Length=477

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLN+A  EAK+ LS+IL+R+ FT SPTY+HSPV   T+ P+HG++V++H+L
Sbjct  424  TCVGLNYAITEAKIALSMILQRYKFTPSPTYVHSPVAIITINPQHGLQVLVHRL  477



>ref|XP_009346500.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA  EAK+ +S+IL+R++FTLSP Y+HSP+   TV P+HG++V+LH L
Sbjct  465  VGLNFAINEAKIAVSMILQRYSFTLSPGYVHSPIQYVTVRPQHGVQVMLHPL  516



>ref|XP_003543170.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase [Glycine max]
Length=524

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +EAK+VLS++L+RF+F LSPTY H+PV   T+ PK G  +ILHKL
Sbjct  473  LGQNFALLEAKLVLSLLLQRFSFELSPTYAHAPVTVLTLNPKFGAHIILHKL  524



>ref|XP_004297208.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA  E K+ LS+IL+R+ FTLSP Y+HSP+   TV P+HG++V+LH L
Sbjct  461  VGFNFATTETKIALSMILQRYTFTLSPGYVHSPLQFLTVRPQHGVQVMLHSL  512



>gb|KHN47459.1| Secologanin synthase [Glycine soja]
Length=524

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +EAK+VLS++L+RF+F LSPTY H+PV   T+ PK G  +ILHKL
Sbjct  473  LGQNFALLEAKLVLSLLLQRFSFELSPTYAHAPVTVLTLNPKFGAHIILHKL  524



>ref|XP_004295657.2| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=521

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 70/150 (47%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KGI  652
            DGI+RLK ++ I+ +  R YP                          ++P + +     I
Sbjct  372  DGISRLKTMNMIINESLRLYPPVIELVKKAEREVRLGKLIVPANIDLVIPIVALYHDTQI  431

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              +++  FK   +  G                    T +GLNFA  E K+ LS+IL+R+A
Sbjct  432  WGQDAGLFKPDRFSEGVAKATKDNMAAFIPFGMGPRTCVGLNFATTETKIALSMILQRYA  491

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSP Y+H P+H  T+ P++G++V LH L
Sbjct  492  FTLSPGYVHLPLHFITLRPQNGVQVTLHSL  521



>ref|XP_009346501.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=517

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA  EAK+ +S+IL+R++FTLSP Y+HSP+   TV P+HG++V+LH L
Sbjct  466  VGLNFAINEAKIAVSMILQRYSFTLSPGYVHSPIQYVTVRPQHGVQVMLHPL  517



>gb|KDP41351.1| hypothetical protein JCGZ_15758 [Jatropha curcas]
Length=477

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  E K+ LS+IL+R+ FTLSP+Y+HSPV   T+ P+HG++VIL  L
Sbjct  424  TCVGLNFAITEKKIALSMILQRYKFTLSPSYVHSPVQILTMCPQHGVQVILEAL  477



>ref|XP_006377686.1| hypothetical protein POPTR_0011s102201g, partial [Populus trichocarpa]
 gb|ERP55483.1| hypothetical protein POPTR_0011s102201g, partial [Populus trichocarpa]
Length=296

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 19/118 (16%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESK-----------------AFKSSC  616
            DG+  LK+V  I+ +  R YP  P I +   V EE K                 +F    
Sbjct  181  DGLNHLKVVTMILYEVLRLYP--PVITLNRDVHEEIKLGNLLLPAGVQTRESQVSFLPFG  238

Query  615  YDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +     +G NFA IEAK+ L+++L+R++F LSP+YIH+P    T+ P+HG  +IL KL
Sbjct  239  WGPRICVGQNFALIEAKMALAMVLQRYSFELSPSYIHAPRTVITLQPQHGAPMILRKL  296



>ref|XP_007149356.1| hypothetical protein PHAVU_005G063500g [Phaseolus vulgaris]
 gb|ESW21350.1| hypothetical protein PHAVU_005G063500g [Phaseolus vulgaris]
Length=367

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +EAK+VLS++L+RF+F +SP Y H+PV  FT+ PKHG  +IL KL
Sbjct  316  LGQNFALLEAKLVLSLLLQRFSFQISPAYAHAPVTVFTLHPKHGAHIILQKL  367



>emb|CDP00469.1| unnamed protein product [Coffea canephora]
Length=442

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 69/150 (46%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFI------KIK-----------------------GI  652
            D I RLK ++ I+E+C R YP +P +      K+K                        I
Sbjct  293  DAIPRLKTMNMILEECLRLYPPVPALMRKVHKKVKLGRLTLPAHTELLISPLALHHDPKI  352

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              E+   FK   +  G                    T +GLNFA +EAK+ LS+IL+ + 
Sbjct  353  WGEDVHHFKPERFAGGVSKATNNNPVAFLPFGFGPRTCVGLNFAMVEAKIALSMILQHYK  412

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            F+LS  Y+HSPV  F V P HG+++IL ++
Sbjct  413  FSLSRNYVHSPVQVFMVRPHHGVKIILSRV  442



>ref|XP_012067825.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=514

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  E K+ LS+IL+R+ FTLSP+Y+HSPV   T+ P+HG++VIL  L
Sbjct  461  TCVGLNFAITEKKIALSMILQRYKFTLSPSYVHSPVQILTMCPQHGVQVILEAL  514



>gb|KHN47458.1| Secologanin synthase [Glycine soja]
Length=422

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +EAK+VLS++L+RF+F LSP Y H+PV   T+ PK+G  +ILHKL
Sbjct  371  LGQNFALLEAKMVLSLLLQRFSFELSPAYAHAPVTVLTLNPKYGAHIILHKL  422



>ref|XP_010046255.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=413

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  663  IKGIVEEESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFT  484
            I G V  ++ AF          +G NFA  EAK+ L++ILR ++FT+SP Y+H P   F 
Sbjct  340  IAGAVSNDAAAFLPFGLGPRNCVGSNFATTEAKITLAMILRHYSFTVSPDYVHLPTQTFM  399

Query  483  VTPKHGIRVILHKL  442
            + P+HG++VILH L
Sbjct  400  IRPQHGLKVILHPL  413



>ref|XP_002512038.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50707.1| cytochrome P450, putative [Ricinus communis]
Length=516

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  E K+ LS+IL+R+ FTLSPTY+HSPVH  T+ P++G+ +IL  L
Sbjct  463  TCVGLNFAITEKKIALSMILQRYRFTLSPTYVHSPVHILTMCPQYGVPIILEAL  516



>gb|KHG20903.1| Secologanin synthase [Gossypium arboreum]
Length=314

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 70/150 (47%), Gaps = 48/150 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI------  661
            DG+ RLK+V  I+ +  R YP                          L+P ++I      
Sbjct  163  DGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDKDH  222

Query  660  ----------KGIVEEESKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAF  529
                      +   E  SKA KS      +  G R+  G NFA +E K+ +++IL+RF F
Sbjct  223  WGDDAHEFRPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRFWF  282

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
             LSP+Y HSP    T+ P+HG ++ILHKLG
Sbjct  283  ELSPSYAHSPCTTMTLRPQHGAQIILHKLG  312



>gb|KHG08441.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  663  IKGIVEEESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFT  484
            I    +  S AF        + +G++FA  E KV LS+IL+R+AFTLSPTY+H+P    T
Sbjct  417  IASATKYNSAAFIPFSMGPRSCVGMSFATTETKVALSMILQRYAFTLSPTYVHAPFPVIT  476

Query  483  VTPKHGIRVILHKL  442
            + P+HGI+V+LH L
Sbjct  477  LQPQHGIQVMLHPL  490



>ref|XP_006442303.1| hypothetical protein CICLE_v10023520mg [Citrus clementina]
 gb|ESR55543.1| hypothetical protein CICLE_v10023520mg [Citrus clementina]
Length=351

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +E+K+ L++IL++F F LSPTYIH+P  G TV P+HG  +ILHK+
Sbjct  286  IGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI  337



>ref|XP_004151308.2| PREDICTED: cytochrome P450 CYP72A219 [Cucumis sativus]
Length=524

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LS+IL++F+FTLSPTY H+P+   T+ P+HG  +IL KL
Sbjct  473  IGQNFAMIEAKIALSMILQQFSFTLSPTYTHAPITHITIQPQHGAHLILRKL  524



>ref|XP_007149357.1| hypothetical protein PHAVU_005G063500g [Phaseolus vulgaris]
 gb|ESW21351.1| hypothetical protein PHAVU_005G063500g [Phaseolus vulgaris]
Length=515

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +EAK+VLS++L+RF+F +SP Y H+PV  FT+ PKHG  +IL KL
Sbjct  464  LGQNFALLEAKLVLSLLLQRFSFQISPAYAHAPVTVFTLHPKHGAHIILQKL  515



>gb|KHG26927.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  663  IKGIVEEESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFT  484
            I    +  S AF        + +G++FA  E KV LS+IL+R+AFTLSPTY+H+P    T
Sbjct  417  IASATKYNSAAFIPFSMGPRSCVGMSFATTETKVALSMILQRYAFTLSPTYVHAPFPVIT  476

Query  483  VTPKHGIRVILHKL  442
            + P+HGI+V+LH L
Sbjct  477  LQPQHGIQVMLHPL  490



>ref|XP_006495016.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=519

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +E+K+ L++IL++F F LSPTY+H+P  G TV P+HG  +ILHK+
Sbjct  468  LGQNFALLESKLALAMILQKFTFQLSPTYMHAPTRGVTVYPQHGANIILHKI  519



>gb|KDO36840.1| hypothetical protein CISIN_1g012962mg [Citrus sinensis]
Length=452

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (47%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFI--KIKGIVE-------------------------  646
            D I+RLKI+  I+ +  R YP +  I  K+K  V+                         
Sbjct  303  DNISRLKIMSMIINESLRLYPPVVLILRKVKKEVKLGKFVIPADVDITIPTLAVHHDPQI  362

Query  645  --EESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              EE   FK   +  G                    T +G N+A +EAK+ LS+IL+++ 
Sbjct  363  WGEEFHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYK  422

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSPTY+HSP    T+ P+HG++V+LH L
Sbjct  423  FTLSPTYVHSPASIITLRPQHGLQVLLHAL  452



>sp|H2DH17.1|C7A22_PANGI RecName: Full=Cytochrome P450 CYP749A22; AltName: Full=Cytochrome 
P450 CYP749A20 [Panax ginseng]
 gb|AEY75214.1| cytochrome P450 CYP749A20 [Panax ginseng]
Length=524

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 69/152 (45%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESK-----------------------  634
            DG+A+LK V+ I+ +  R YP  P I +   V+EE+K                       
Sbjct  375  DGLAKLKTVNMIINETLRLYP--PVIFLTRKVKEETKFGKLTLPANVHIVVPTLALHHDE  432

Query  633  --------AFKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRR  538
                     FK   +  G                      +GLNFA  EAK+ L++IL+ 
Sbjct  433  QIWGDDALLFKPERFSQGVAKATNNNAAAFFPFGLGPRSCVGLNFATNEAKIALAMILQC  492

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            ++F LSPTYIHSPV   TV P+HG++V+L  L
Sbjct  493  YSFALSPTYIHSPVQILTVRPQHGLQVMLQPL  524



>gb|KJB78243.1| hypothetical protein B456_012G185300 [Gossypium raimondii]
Length=513

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -1

Query  663  IKGIVEEESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFT  484
            I    +  S AF        + +G++FA  E KV LS+IL+R+AFTLSPTY+H+P    T
Sbjct  440  IASATKYNSAAFIPFSMGPRSCVGMSFATTETKVALSMILQRYAFTLSPTYVHAPFPVIT  499

Query  483  VTPKHGIRVILHKL  442
            + P+HGI+V+LH L
Sbjct  500  LQPQHGIQVMLHPL  513



>ref|XP_006442298.1| hypothetical protein CICLE_v10019876mg [Citrus clementina]
 gb|ESR55538.1| hypothetical protein CICLE_v10019876mg [Citrus clementina]
Length=491

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +E+K+ L++IL++F F LSPTY+H+P  G TV P+HG  +ILHK+
Sbjct  440  LGQNFALLESKLALAMILQKFTFQLSPTYMHAPTRGVTVYPQHGANIILHKI  491



>gb|KDO64199.1| hypothetical protein CISIN_1g022822mg [Citrus sinensis]
Length=291

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  GTRL  G NFA +E K++LS++L RF+F+LSP YIHSPV    + PKHG+R+++ ++
Sbjct  232  FGTGTRLCVGQNFAMLELKIMLSLLLSRFSFSLSPNYIHSPVFKMLLIPKHGMRLLVKRV  291



>ref|XP_004298349.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=506

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 69/150 (46%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIKG---I  652
            DGIA+LK +  I+ +  R YP                          L+P + +     +
Sbjct  357  DGIAKLKTMSMIINETLRLYPPAILLARKVSREVRLGKILVPANVELLVPTLALHHEPQL  416

Query  651  VEEESKAFKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRRFA  532
              EE + FK   +  G                      +G NFA +EAK+ +S+IL+R++
Sbjct  417  WGEEVELFKPERFSEGIAKATNDNMAAFMPFGLGPRICVGFNFAALEAKIAMSMILQRYS  476

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSP Y+HSP    TV P++G++VILH L
Sbjct  477  FTLSPGYVHSPFQYVTVRPQNGVQVILHPL  506



>gb|KDP35176.1| hypothetical protein JCGZ_10710 [Jatropha curcas]
Length=448

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA  E K+ LS+IL+ + FTLSPTY+HSPV+  TV P+HG++++LH L
Sbjct  397  VGYNFAITETKIALSMILQHYRFTLSPTYVHSPVNRLTVCPQHGMQIMLHPL  448



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LSIIL+ F+F LSP+Y H+P+   T+ P+HG  +ILHKL
Sbjct  466  VGQNFAMIEAKIALSIILQHFSFELSPSYTHAPISILTIQPQHGAHIILHKL  517



>ref|XP_004298351.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=517

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  EAK+ LS+IL+R++FTLSP YIHSP     + P+HG++V+L  L
Sbjct  464  TCVGLNFATTEAKIALSMILQRYSFTLSPAYIHSPCQSLLLRPQHGLQVLLQPL  517



>ref|XP_007045779.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY01611.1| Cytochrome P450, putative [Theobroma cacao]
Length=517

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G NFA +  KV L++IL+   FTLSP Y+HSPV  FT+ P+HGI+VILH L
Sbjct  462  TCVGFNFATVGTKVALAMILQHHTFTLSPAYVHSPVFHFTLVPQHGIQVILHSL  515



>ref|XP_004146005.2| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Cucumis sativus]
Length=530

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 67/149 (45%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPL--------------------------LPFIKIKGIVE-  646
            DG++RLK+V  I+ +  R YP                           LP + ++   E 
Sbjct  378  DGLSRLKVVTMILNEVLRLYPPVSMFGRLVKKETKLGKLTLPAGVMLGLPVVLMQCDPEL  437

Query  645  --EESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++  FK   +  G                     +GLNFA IEAK+ LS+IL+RF+ 
Sbjct  438  WGEDAHEFKPERFSEGVSKAAKNPGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSL  497

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LS +Y H+P+   T  P+HG  +ILHKL
Sbjct  498  ELSSSYTHAPIAAITTQPQHGAHIILHKL  526



>ref|XP_006477952.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=519

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +E+K+ L++IL++F F LSPTY+H+P  G TV P+HG  +ILHK+
Sbjct  468  LGQNFALLESKLALAMILQKFTFQLSPTYMHAPTRGVTVYPQHGANIILHKI  519



>ref|XP_007224155.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
 gb|EMJ25354.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
Length=493

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA +EAK+ L++IL+R++FTLSP Y+HSP+   TV P+ G+ VILH L
Sbjct  440  TCVGMNFAIVEAKIALAMILQRYSFTLSPGYVHSPIQFMTVRPQRGVPVILHSL  493



>ref|XP_008367032.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA  EAK+VLS+IL+R++FTLSP Y+H PV   T+ PK G++V+LH L
Sbjct  465  VGLNFANTEAKIVLSMILQRYSFTLSPGYVHLPVQYVTIHPKLGVQVMLHPL  516



>ref|XP_011654016.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]
Length=516

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G  FA IEAK+ LS+IL+RF+F LSP+Y HSP+   T  P+HG  +ILHKL
Sbjct  465  IGQTFAMIEAKMALSMILQRFSFELSPSYTHSPIASLTTQPQHGAHIILHKL  516



>gb|KCW85140.1| hypothetical protein EUGRSUZ_B01983 [Eucalyptus grandis]
Length=514

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  663  IKGIVEEESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFT  484
            I G V  ++ AF          +G NFA  EAK+ L++ILR ++FT+SP Y+H P   F 
Sbjct  441  IAGAVSNDAAAFLPFGLGPRNCVGSNFATTEAKITLAMILRHYSFTVSPDYVHLPTQTFM  500

Query  483  VTPKHGIRVILHKL  442
            + P+HG++VILH L
Sbjct  501  IRPQHGLKVILHPL  514



>emb|CAA49445.1| cytochrome P-450, partial [Catharanthus roseus]
Length=54

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+V+++IL+RF+F LSP+Y H+P    T+ P+HG  +IL KL
Sbjct  3    VGQNFAMLEAKLVMAMILQRFSFELSPSYAHAPTSIVTLQPQHGAHLILRKL  54



>ref|XP_007201627.1| hypothetical protein PRUPE_ppa021443mg [Prunus persica]
 gb|EMJ02826.1| hypothetical protein PRUPE_ppa021443mg [Prunus persica]
Length=392

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NF   EAK+ LS+IL+ ++FTLSP Y+H P+H  TV P+HG++V+LH L
Sbjct  339  TCVGMNFGITEAKIALSMILQCYSFTLSPGYVHFPLHYLTVRPQHGVQVMLHSL  392



>ref|XP_006437867.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
 gb|ESR51107.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
Length=509

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (47%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFI--KIKGIVE-------------------------  646
            D I+RLKI+  I+ +  R YP +  I  K+K  V+                         
Sbjct  360  DNISRLKIMSMIINESLRLYPPVVLILRKVKKEVKLGKFVIPADVDITIPTLAVHHDPQI  419

Query  645  --EESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              EE   FK   +  G                    T +G N+A +EAK+ LS+IL+++ 
Sbjct  420  WGEEFHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYK  479

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSPTY+HSP    T+ P+HG++V+LH L
Sbjct  480  FTLSPTYVHSPASIITLRPQHGLQVLLHAL  509



>ref|XP_006484250.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=509

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (47%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFI--KIKGIVE-------------------------  646
            D I+RLKI+  I+ +  R YP +  I  K+K  V+                         
Sbjct  360  DNISRLKIMSMIINESLRLYPPVVLILRKVKKEVKLGKFVIPADVDITIPTLAVHHDPQI  419

Query  645  --EESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              EE   FK   +  G                    T +G N+A +EAK+ LS+IL+++ 
Sbjct  420  WGEEFHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYK  479

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSPTY+HSP    T+ P+HG++V+LH L
Sbjct  480  FTLSPTYVHSPASIITLRPQHGLQVLLHAL  509



>gb|KHG18227.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 70/150 (47%), Gaps = 48/150 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI------  661
            DG+ RLK+V  I+ +  R YP                          L+P ++I      
Sbjct  367  DGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDKDH  426

Query  660  ----------KGIVEEESKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAF  529
                      +   E  SKA KS      +  G R+  G NFA +E K+ +++IL+RF F
Sbjct  427  WGDDAHEFRPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRFWF  486

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
             LSP+Y HSP    T+ P+HG ++ILHKLG
Sbjct  487  ELSPSYAHSPCTTMTLRPQHGAQIILHKLG  516



>ref|XP_012075440.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=519

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA  E K+ LS+IL+ + FTLSPTY+HSPV+  TV P+HG++++LH L
Sbjct  468  VGYNFAITETKIALSMILQHYRFTLSPTYVHSPVNRLTVCPQHGMQIMLHPL  519



>ref|XP_006442300.1| hypothetical protein CICLE_v100199321mg, partial [Citrus clementina]
 gb|ESR55540.1| hypothetical protein CICLE_v100199321mg, partial [Citrus clementina]
Length=271

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG +FA +E+K+ L++IL++F F LSPTY+H+P  G TV P+HG  +ILHK+
Sbjct  220  LGQSFALLESKLALAMILQKFTFQLSPTYMHAPTRGVTVYPQHGANIILHKI  271



>gb|KHG20902.1| Secologanin synthase [Gossypium arboreum]
Length=482

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 70/150 (47%), Gaps = 48/150 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI------  661
            DG+ RLK+V  I+ +  R YP                          L+P ++I      
Sbjct  331  DGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDKDH  390

Query  660  ----------KGIVEEESKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAF  529
                      +   E  SKA KS      +  G R+  G NFA +E K+ +++IL+RF F
Sbjct  391  WGDDAHEFRPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRFWF  450

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
             LSP+Y HSP    T+ P+HG ++ILHKLG
Sbjct  451  ELSPSYAHSPCTTMTLRPQHGAQIILHKLG  480



>ref|XP_008446467.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=525

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  615  YDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G+R  +G+NFA  EAK+ +S+IL+RF+FTLSP Y HSP    T+ P+HG+++ILH L
Sbjct  456  FGLGSRSCVGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAMFLTIAPQHGLQLILHPL  515

Query  441  G  439
             
Sbjct  516  S  516



>ref|XP_007224911.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
 gb|EMJ26110.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
Length=451

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +  NFA  EAK+ LS+IL+R+ FTLSP Y+HSP    TV P+HG++V LH L
Sbjct  398  TCVAFNFAITEAKIALSMILQRYTFTLSPAYVHSPYEYLTVRPQHGVQVALHSL  451



>ref|XP_009357376.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +E K+ LS+IL+RF+FTLSP YIHSP    TV P+HG++V+L  L
Sbjct  464  VGSNFATMETKIALSMILQRFSFTLSPAYIHSPYRLLTVRPQHGVQVMLRSL  515



>gb|KHN44046.1| Secologanin synthase, partial [Glycine soja]
Length=519

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+VLS++L++F+F LSP Y H+P  GFT+ PK G  +ILHKL
Sbjct  468  IGQNFALLEAKMVLSLLLQKFSFELSPAYAHAPTIGFTLNPKFGAHIILHKL  519



>ref|XP_009356542.1| PREDICTED: uncharacterized protein LOC103947363 [Pyrus x bretschneideri]
Length=1066

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597   LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             +GLNFA  EAK+VLS+IL+R++FTLSP Y+H PV   T+ PK G++V+LH L
Sbjct  1015  VGLNFANTEAKIVLSMILQRYSFTLSPGYVHLPVQYVTIHPKLGVQVMLHPL  1066


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LGLNFA  E K+VLS+IL+R++FTLS  Y+H P    T+ P+ G++V+LH L
Sbjct  465  LGLNFANTEVKIVLSMILQRYSFTLSQGYVHLPYPYVTIHPQLGVQVMLHPL  516



>ref|XP_006598147.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+VLS++L++F+F LSP Y H+P  GFT+ PK G  +ILHKL
Sbjct  472  IGQNFALLEAKMVLSLLLQKFSFELSPAYAHAPTIGFTLNPKFGAHIILHKL  523



>ref|XP_008364583.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA  EAK+ LS+IL+R++FTLSP Y+H P+   TV P+HG++V+LH L
Sbjct  466  VGLNFAINEAKIALSMILQRYSFTLSPGYVHLPIQYVTVRPQHGVQVMLHPL  517



>ref|XP_008346697.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA  EAK+ LS+IL+R++FTLSP Y+H P+   TV P+HG++V+LH L
Sbjct  466  VGLNFAINEAKIALSMILQRYSFTLSPGYVHLPIQYVTVRPQHGVQVMLHPL  517



>ref|XP_010098360.1| Secologanin synthase [Morus notabilis]
 gb|EXB74884.1| Secologanin synthase [Morus notabilis]
Length=237

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = -1

Query  660  KGIVEEESKAF---KSSCYDAG----TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHS  502
            KG+    SK +   +++ Y  G      LG NFA IE K+ L++ILR F+F LSP Y H+
Sbjct  156  KGVARSSSKEYDCNQTAFYPFGWGPRVCLGQNFAMIEVKMALAMILRHFSFELSPLYAHA  215

Query  501  PVHGFTVTPKHGIRVILHKLGE  436
            P  G T+ P+HG  +ILH+L  
Sbjct  216  PCVGLTLCPQHGAPLILHRLSS  237



>ref|XP_006495010.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=519

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +E+K+ L++IL++F F LSPTYIH+P  G TV P+HG  +ILHK+
Sbjct  468  IGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI  519



>ref|XP_007222124.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
 gb|EMJ23323.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
Length=498

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNFA  E K+ LS+IL+R+ FTLSP Y+HSP+H  TV P+HG++V L  L
Sbjct  445  TCVGLNFAITEVKIALSMILQRYTFTLSPGYVHSPLHLLTVRPQHGVQVRLQPL  498



>ref|XP_011659939.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]
Length=517

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LSIIL+ F+F LSP+Y H+P+   T  P+HG  +ILHKL
Sbjct  466  IGQNFAMIEAKIALSIILQHFSFELSPSYTHAPISILTTQPQHGAHIILHKL  517



>gb|KDP41353.1| hypothetical protein JCGZ_15760 [Jatropha curcas]
Length=475

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 70/152 (46%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEE-------------------------  640
            DGIARLKI+  IV +  R YP  P   I   V+ E                         
Sbjct  326  DGIARLKIMSMIVNESLRLYP--PVFNITREVQREVRLGNVIIPEKMAVCLPILAVQHNS  383

Query  639  -------------------SKAFKSSC-----YDAGTR--LGLNFAKIEAKVVLSIILRR  538
                               +KA K++      + +G R  +G NFA  E K+ LS+IL+ 
Sbjct  384  KVWGEDVNLFKPERFADGVAKATKNNIAAFLPFGSGARSCVGSNFATAEIKIALSMILQN  443

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + FTLSPTY+H+P+H  T+ P++G++++L  L
Sbjct  444  YRFTLSPTYVHAPIHVLTICPQYGLQILLEAL  475



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 69/149 (46%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KGI  652
            DG+ RLKIV  I+ +  R YP                           LP + +   + I
Sbjct  368  DGLNRLKIVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPMLLVHHDEEI  427

Query  651  VEEESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++K FK   +  G                     +GLNFA IEAK+ +++IL+RF+F
Sbjct  428  WGEDAKEFKPERFSEGVSKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFSF  487

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP+Y H+P    T+ P++G  +ILHKL
Sbjct  488  ELSPSYTHAPQSVITMQPQYGAPLILHKL  516



>ref|XP_007222983.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
 gb|EMJ24182.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
Length=516

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA +E+K+ L++IL+R++FTLSP Y+HSP+   TV P+ G+ VILH L
Sbjct  463  TCVGMNFAIVESKIALAMILQRYSFTLSPGYVHSPIQFMTVRPQRGVPVILHSL  516



>ref|XP_006442302.1| hypothetical protein CICLE_v100197311mg, partial [Citrus clementina]
 gb|ESR55542.1| hypothetical protein CICLE_v100197311mg, partial [Citrus clementina]
Length=420

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +E+K+ L++IL++F F LSPTY+H+P  G TV P+HG  +ILHK+
Sbjct  369  IGQNFALLESKLALAMILQKFTFQLSPTYMHAPTRGVTVYPQHGANIILHKI  420



>gb|KDO55401.1| hypothetical protein CISIN_1g038623mg, partial [Citrus sinensis]
Length=259

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
            LG NFA IEAK++LS+ILR+++F +SPTY+H+P+  FT+ P+HG +++  K+ 
Sbjct  206  LGQNFALIEAKIILSMILRQYSFVVSPTYVHAPMLIFTMQPQHGAQIVFSKIS  258



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 66/149 (44%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIKGIVE-  646
            DG++ LKIV  I+ +  R YP                           LP + +    E 
Sbjct  366  DGLSHLKIVTMILNEVLRLYPPVLSLARKVRKDVKLGNLSLPSEVQVFLPILLVHHDCEV  425

Query  645  --EESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              +++K FK   +  G                     +G NFA +E K+ LSIIL+RF+F
Sbjct  426  WGDDAKEFKPERFSEGVLKATNGRVSLFPFGGGPRICIGQNFALLEVKIALSIILQRFSF  485

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSPTY H+P    T+ P++G  +ILHKL
Sbjct  486  QLSPTYTHAPTAWLTLQPQYGAHLILHKL  514



>ref|XP_004135429.2| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis sativus]
Length=521

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
            +G+NFA  EAK+ +S+IL+RF+FTLSP Y HSP    T+ P+HG+++ILH L 
Sbjct  466  VGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAMLLTIAPQHGLQLILHPLS  518



>ref|XP_008243804.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA +E+K+ L++IL+R++FTLSP Y+HSP+   TV P+ G+ VILH L
Sbjct  463  TCVGMNFAIVESKIALAMILQRYSFTLSPGYVHSPIQFMTVRPQRGVPVILHSL  516



>ref|XP_006429655.1| hypothetical protein CICLE_v10011453mg [Citrus clementina]
 ref|XP_006481259.1| PREDICTED: cytochrome P450 714A1-like [Citrus sinensis]
 gb|ESR42895.1| hypothetical protein CICLE_v10011453mg [Citrus clementina]
Length=535

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  GTRL  G NFA +E K++LS++L RF+F+LSP YIHSPV    + PKHG+R+++ ++
Sbjct  476  FGTGTRLCVGQNFAMLELKIMLSLLLSRFSFSLSPNYIHSPVFKMLLIPKHGMRLLVKRV  535



>ref|XP_010052417.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW76383.1| hypothetical protein EUGRSUZ_D00765 [Eucalyptus grandis]
Length=516

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = -1

Query  615  YDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            +  GTR  +GLNFA +EAK+VL++IL+R++FTLSP Y+HSPV      P++G++VIL+
Sbjct  457  FGLGTRNCVGLNFATVEAKIVLAMILQRYSFTLSPAYVHSPVELHNSRPQYGVQVILN  514



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            LG NFA +EAK+ LS+IL+ F+F LSP+Y+H+P   FT+ P+HG  ++LHKL
Sbjct  471  LGQNFAMLEAKLALSMILQHFSFQLSPSYVHAPYTVFTLQPQHGALLVLHKL  522



>ref|XP_006495017.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Citrus 
sinensis]
Length=519

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +E+K+ L++IL++F F LSPTY+H+P  G TV P+HG  +ILHK+
Sbjct  468  IGQNFALLESKLALAMILQKFTFQLSPTYMHAPTRGVTVYPQHGANIILHKI  519



>ref|XP_007223137.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
 gb|EMJ24336.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
Length=516

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNF   EAK+ LS+IL+R+AFTLSP Y+H P+   TV P+HG++V+L  L
Sbjct  463  TCVGLNFGTTEAKIALSMILQRYAFTLSPGYVHLPLRYLTVRPQHGVQVMLQSL  516



>gb|KHG02805.1| Cytochrome P450 protein [Gossypium arboreum]
Length=382

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = -1

Query  660  KGIVE---EESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHG  490
            +GIV+     + AF        T +G+NFA  E K+ LS+IL+R+ FTLSPTY+H+P+  
Sbjct  306  EGIVKATNNNAAAFMPFGLGPRTCVGMNFAITETKIALSMILQRYTFTLSPTYVHAPLPN  365

Query  489  FTVTPKHGIRVILHKL  442
             ++ P+HG+ V+ H L
Sbjct  366  LSLKPQHGLHVLFHSL  381



>ref|XP_011070904.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  594  GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            GLNFA  EAK+ LS+IL+R+ FTLSP Y+HSP    TV P+HG++++L  L
Sbjct  461  GLNFASHEAKIALSMILQRYKFTLSPNYVHSPFIALTVQPQHGVQILLQPL  511



>ref|XP_007224470.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
 gb|EMJ25669.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
Length=510

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA  E K+ L++IL+R++FTLSP Y+HSP+   TV P  G++VILH L
Sbjct  457  TCVGMNFANAEVKIALAMILQRYSFTLSPGYVHSPIQYMTVRPHRGVQVILHSL  510



>ref|XP_008243779.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNF   EAK+ LS+IL+R+AFTLSP Y+H P+   TV P+HG++V+L  L
Sbjct  463  TCVGLNFGTTEAKIALSMILQRYAFTLSPGYVHLPLRYLTVRPQHGVQVMLQSL  516



>gb|KHG20728.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=988

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 10/76 (13%)
 Frame = -1

Query  627  KSSCYDAG----------TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            K++ Y+AG            +G NFA +E K+VLS+IL+R+   LSPTY+HSP+   TV 
Sbjct  913  KATNYNAGVFCPFGLGPRNCVGTNFATMETKIVLSMILQRYTIYLSPTYVHSPIPYITVQ  972

Query  477  PKHGIRVILHKLGEEG  430
            P+HGI+VIL  L  + 
Sbjct  973  PQHGIQVILESLHNDA  988


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+ FA  E K+ LS+IL+R+A TLSP Y+HSP+   ++ P+HGI++ +  L
Sbjct  423  TCVGMTFATTETKIALSMILQRYAITLSPAYVHSPIPVISLQPQHGIQIKMSAL  476



>gb|KHG20729.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=936

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 10/76 (13%)
 Frame = -1

Query  627  KSSCYDAG----------TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            K++ Y+AG            +G NFA +E K+VLS+IL+R+   LSPTY+HSP+   TV 
Sbjct  861  KATNYNAGVFCPFGLGPRNCVGTNFATMETKIVLSMILQRYTIYLSPTYVHSPIPYITVQ  920

Query  477  PKHGIRVILHKLGEEG  430
            P+HGI+VIL  L  + 
Sbjct  921  PQHGIQVILESLHNDA  936


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEG  430
            T +G+ FA  E K+ LS+IL+R+A TLSP Y+HSP+   ++ P+HGI+ +++  G +G
Sbjct  408  TCVGMTFATTETKIALSMILQRYAITLSPAYVHSPIPVISLQPQHGIQHMMNSQGIKG  465



>gb|KJB12898.1| hypothetical protein B456_002G043200 [Gossypium raimondii]
Length=518

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 69/150 (46%), Gaps = 48/150 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP------------------LLPF-----------------  670
            DG+ RLK+V  I+ +  R YP                  LLP                  
Sbjct  367  DGLNRLKVVTMILYEVLRLYPPVVELGRSVPKEIKLGNLLLPVGTEVSVPILQIHHDKDL  426

Query  669  -------IKIKGIVEEESKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAF  529
                    K +   E  SKA KS      +  G R+  G NFA +EAK+ +++IL+RF F
Sbjct  427  WGDDAREFKPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFALMEAKMAMAMILQRFWF  486

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
             LSP+Y HSP    T+ P+HG ++ILHKLG
Sbjct  487  ELSPSYAHSPYSRATLRPQHGAQIILHKLG  516



>gb|KDP35171.1| hypothetical protein JCGZ_10705 [Jatropha curcas]
Length=478

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            +G NFA  E K+ LS+IL+R+ FTLSPTY+HSPV    + P+HG++++LH
Sbjct  427  VGYNFANTETKIALSMILQRYRFTLSPTYVHSPVQILAMCPQHGMQIVLH  476



>ref|XP_008356573.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA  EAK+VLS+IL+R++FTL P Y+H P    TV P+HG++V+LH L
Sbjct  465  VGLNFAINEAKIVLSMILQRYSFTLXPGYVHLPTQYVTVRPQHGVQVMLHSL  516



>gb|EYU22578.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22579.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22580.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
Length=506

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  639  SKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIR  460
            + AF    Y     LGLNFA  EAK+ LS+IL+R+ FTLSP Y+HSP    T  P+HG++
Sbjct  441  ATAFLGFGYGPRICLGLNFASNEAKIALSMILQRYKFTLSPNYVHSPYIVLTAQPQHGVK  500

Query  459  VILHKL  442
            ++L  L
Sbjct  501  ILLQPL  506



>ref|XP_012075437.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=522

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            +G NFA  E K+ LS+IL+R+ FTLSPTY+HSPV    + P+HG++++LH
Sbjct  471  VGYNFANTETKIALSMILQRYRFTLSPTYVHSPVQILAMCPQHGMQIVLH  520



>gb|KHG27367.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 10/76 (13%)
 Frame = -1

Query  627  KSSCYDAG----------TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            K++ Y+AG            +G+NFA  E K+V+S+IL+R+  +LSPTY+HSP+   TV 
Sbjct  441  KATNYNAGAFCPFGLGPRNCVGMNFATTEMKIVVSMILQRYTISLSPTYVHSPIPYITVQ  500

Query  477  PKHGIRVILHKLGEEG  430
            P+HGI+VIL  L  + 
Sbjct  501  PQHGIQVILESLHNDA  516



>ref|XP_012067827.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=512

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 70/152 (46%), Gaps = 53/152 (35%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEE-------------------------  640
            DGIARLKI+  IV +  R YP  P   I   V+ E                         
Sbjct  363  DGIARLKIMSMIVNESLRLYP--PVFNITREVQREVRLGNVIIPEKMAVCLPILAVQHNS  420

Query  639  -------------------SKAFKSSC-----YDAGTR--LGLNFAKIEAKVVLSIILRR  538
                               +KA K++      + +G R  +G NFA  E K+ LS+IL+ 
Sbjct  421  KVWGEDVNLFKPERFADGVAKATKNNIAAFLPFGSGARSCVGSNFATAEIKIALSMILQN  480

Query  537  FAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + FTLSPTY+H+P+H  T+ P++G++++L  L
Sbjct  481  YRFTLSPTYVHAPIHVLTICPQYGLQILLEAL  512



>ref|XP_008243887.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103342098 
[Prunus mume]
Length=1035

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603   TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             T +G+NFA  E K+ L++IL+R++FTLSP Y+HSP+   TV P  G++VILH L
Sbjct  982   TCVGMNFANAEVKIALAMILQRYSFTLSPGYVHSPIQYMTVRPHRGVQVILHSL  1035


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 7/60 (12%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEGSQ  424
            T +G NFA  EAK+ LS+IL+R+         HSP    TV P+HG++V+LH LG+  +Q
Sbjct  462  TCVGFNFAITEAKISLSMILQRYT-------XHSPYEYLTVRPQHGVQVVLHSLGKHINQ  514



>gb|EMT11454.1| Secologanin synthase [Aegilops tauschii]
Length=524

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  618  CYDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHK  445
             + +G R  +G NFA +EAKV +S+IL+RF+F LSPTY+H+P    T+ P+HG+ V LH+
Sbjct  464  AFSSGPRNCIGQNFALLEAKVAISMILQRFSFELSPTYVHAPYAVLTLHPQHGVPVRLHR  523

Query  444  L  442
            L
Sbjct  524  L  524



>ref|XP_011470797.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=238

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G R+  G NFA  E K+ LS+IL+R++FTLSP Y+HSP    T+ P+HG+++IL  L
Sbjct  179  FGMGPRMCVGFNFATTEIKIALSMILQRYSFTLSPGYVHSPFQFMTLRPQHGVQIILQSL  238



>ref|XP_004295655.2| PREDICTED: cytochrome P450 CYP749A22-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460712.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=517

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIKG---I  652
            DGI+RLK ++ I+ +  R YP                          ++P + +     I
Sbjct  368  DGISRLKTMNMIINESLRLYPPVIQLVKRTEREVRLGKFIVPANIDLVIPIVALHHDPEI  427

Query  651  VEEESKAFKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRRFA  532
              +++K F+   +  G                      +G NFA IE K+ LS+IL+R+A
Sbjct  428  WGQDAKLFRPERFSEGIAKATKKNMAAFIPFGMGPRICVGFNFATIETKIALSMILQRYA  487

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLS  Y+HSP+   T+ P +G++VILH L
Sbjct  488  FTLSTGYVHSPLQVLTLRPHNGVQVILHSL  517



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 68/149 (46%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KGI  652
            DG+ RLK+V  I+ +  R YP                           LP I +   K I
Sbjct  370  DGLNRLKVVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPTILVHHDKEI  429

Query  651  VEEESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++  FK   ++ G                     +GLNFA IEAK+ +++IL+RFAF
Sbjct  430  WGEDATEFKPERFNEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFAF  489

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP Y H+P    T+ PK+G  ++LHKL
Sbjct  490  ELSPLYTHAPQSVITMQPKYGAPLVLHKL  518



>gb|KJB79907.1| hypothetical protein B456_013G071400 [Gossypium raimondii]
Length=513

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA  E K+ LS+IL+R+ FTLSPTY+H+P+   ++ P+HG+ V+ H L
Sbjct  459  TCVGMNFAITETKIALSMILQRYTFTLSPTYVHAPLPNLSLKPQHGLHVLFHSL  512



>gb|KDP41344.1| hypothetical protein JCGZ_15751 [Jatropha curcas]
Length=430

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEG  430
            +G+NFA  E K+ LS+ILRR+ FTLSPTYIHSP+    V+PK G+++IL  L ++ 
Sbjct  374  VGMNFAMAETKIALSMILRRYRFTLSPTYIHSPIVVIGVSPKKGLQIILQALEDQN  429



>ref|XP_009596805.1| PREDICTED: cytochrome P450 72A15-like [Nicotiana tomentosiformis]
Length=517

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -1

Query  648  EEESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKH  469
            ++   AF    +   T +G NFA IEAKV LS+IL++F+F LSPTY H+P    T+ P+H
Sbjct  448  DQTQMAFMPFGWGPRTCIGQNFAMIEAKVALSMILKQFSFKLSPTYAHAPYTVMTLQPQH  507

Query  468  GIRVILHKLG  439
            G +++ H+L 
Sbjct  508  GAQIMFHRLN  517



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 68/149 (46%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KGI  652
            DG+ RLK+V  I+ +  R YP                           LP I +   K I
Sbjct  371  DGLNRLKVVTMILHESLRLYPPTAALGRRITTKMKLGKLNLPEGVMLSLPTILVHHDKEI  430

Query  651  VEEESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++  FK   +  G                     +GLNFA IEAK+ +++IL+RFAF
Sbjct  431  WGEDATKFKPEKFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFAF  490

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP+Y H+P    T+ PK+G  ++LHKL
Sbjct  491  ELSPSYTHAPQSVITMQPKYGAPLMLHKL  519



>dbj|BAJ93197.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  618  CYDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHK  445
             + +G R  +G NFA +EAKV +S+IL+RF+F LSPTY+H+P    T+ P+HG+ V LH+
Sbjct  485  AFSSGPRNCIGQNFALLEAKVAISMILQRFSFELSPTYVHAPYTVLTLHPQHGVPVRLHR  544

Query  444  L  442
            L
Sbjct  545  L  545



>gb|KDO70290.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=452

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + +G R+  GLNFA  EAK+ LS+IL+R+ F LSP+Y+HSPV   T+ P+HG++VI   L
Sbjct  387  FSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQPL  446

Query  441  G  439
             
Sbjct  447  S  447



>ref|XP_010064522.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67638.1| hypothetical protein EUGRSUZ_F01383 [Eucalyptus grandis]
Length=510

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
            T +G NFA +EAK+ L++IL++F+F LSP Y+H+P +  T+ P+HG++VILHK+ 
Sbjct  456  TCVGQNFAMLEAKIALAMILQQFSFELSPFYVHAPCNVLTLQPQHGVQVILHKVN  510



>ref|XP_007210003.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
 gb|EMJ11202.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
Length=561

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA  EAK+ LS+IL+R AFTLSP Y HSP    TV P+H ++V+LH L
Sbjct  510  VGLNFAITEAKIALSMILQRHAFTLSPAYTHSPSQFLTVRPQHEVQVMLHSL  561



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 67/149 (45%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPL--------------------------LPFIKIKGIVE-  646
            DG++RLK+V  I+ +  R YP                           LP + I+   E 
Sbjct  377  DGLSRLKVVTMILNEVLRLYPPVSMFGRFIKKETKLGKLTLPAGVMLGLPTVLIQCDPEL  436

Query  645  --EESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++  FK   +  G                     +GLNFA IEAK+ LS+IL+RF+ 
Sbjct  437  WGEDAHEFKPERFFEGVSKATKNSGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSL  496

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LS +Y H+P+   T  P+HG  +ILHKL
Sbjct  497  ELSSSYTHAPIVAITTQPQHGAHIILHKL  525



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 68/149 (46%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KGI  652
            DG+ RLK+V  I+ +  R YP                           LP I +   K I
Sbjct  370  DGLNRLKVVTMILHESLRLYPPVSALGRRITTKTKLGELNLPAGVMLSLPTILVHHDKEI  429

Query  651  VEEESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++  FK   +  G                     +GLNFA IEAK+ +++IL+RFAF
Sbjct  430  WGEDATEFKPERFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMTMAMILQRFAF  489

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP+Y H+P    T+ PK+G  ++LH+L
Sbjct  490  ELSPSYTHAPQSVITMQPKYGAPLVLHRL  518



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 7/73 (10%)
 Frame = -1

Query  639  SKAFKSSC-----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTV  481
            SKA KS+      +  G R+  G NFA +EAK+VL++IL+RF F LSP+Y HSP+   T+
Sbjct  449  SKATKSNQLAFFPFGGGPRICIGQNFALMEAKMVLAMILKRFRFELSPSYAHSPITVITL  508

Query  480  TPKHGIRVILHKL  442
             P+HG  +ILHKL
Sbjct  509  RPQHGAHLILHKL  521



>gb|ERN17807.1| hypothetical protein AMTR_s00047p00169120 [Amborella trichopoda]
Length=140

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  633  AFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            AF    Y   T LGLNFA +E+K+ LS+IL R+A   SP+Y H+P+ G T+ P+HG+ +I
Sbjct  76   AFLPFGYGPRTCLGLNFAILESKLALSMILPRYALMPSPSYHHAPIVGITLAPQHGVPII  135

Query  453  LHKL  442
            ++ L
Sbjct  136  INPL  139



>emb|CDY51036.1| BnaA06g02990D [Brassica napus]
Length=512

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = -1

Query  639  SKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA KS      +  G R+  G NFA +EAK+ +++IL+RF+F LSPTY+H+P   FT+ 
Sbjct  441  SKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPTYVHAPYTVFTLH  500

Query  477  PKHGIRVILHKL  442
            P++G  +ILHKL
Sbjct  501  PQYGAHLILHKL  512



>ref|XP_010676734.1| PREDICTED: cytochrome P450 CYP72A219-like [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+VLS+IL+RFAF LSP+Y H+P     + P+HG  +ILH+L
Sbjct  472  IGQNFALIEAKLVLSMILQRFAFELSPSYTHAPTTLLALQPQHGAYLILHRL  523



>ref|XP_006493472.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=453

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
            LG NFA IEAK++LS+ILR+++F +SPTY+H+P+  FT+ P+HG +++  K+ 
Sbjct  400  LGQNFALIEAKIILSMILRQYSFVVSPTYVHAPMLIFTMQPQHGAQIVFSKIS  452



>ref|XP_009147881.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = -1

Query  639  SKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA KS      +  G R+  G NFA +EAK+ +++IL+RF+F LSPTY+H+P   FT+ 
Sbjct  441  SKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPTYVHAPYTVFTLH  500

Query  477  PKHGIRVILHKL  442
            P++G  +ILHKL
Sbjct  501  PQYGAHLILHKL  512



>ref|XP_012068355.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=513

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEG  430
            +G+NFA  E K+ LS+ILRR+ FTLSPTYIHSP+    V+PK G+++IL  L ++ 
Sbjct  457  VGMNFAMAETKIALSMILRRYRFTLSPTYIHSPIVVIGVSPKKGLQIILQALEDQN  512



>emb|CDP00470.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 68/152 (45%), Gaps = 49/152 (32%)
 Frame = -1

Query  747  QDGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI-----  661
             DGIARLK ++ I+ +C R YP                           LP + +     
Sbjct  364  SDGIARLKTMNMIINECLRLYPPVLTMTRKVGTEVRLGNLRLPTNINIYLPILALHHNPE  423

Query  660  -----------KGIVEEESKAFKSSC-----YDAGTR--LGLNFAKIEAKVVLSIILRRF  535
                       +   E  +KA  S+      +  G R  +GLNF   EAK+ LS+IL+R+
Sbjct  424  IWGKDVHLFKPERFAEGVAKATNSTAAAFFPFGLGPRTCVGLNFTTNEAKIALSMILQRY  483

Query  534  AFTLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
              TLSP Y+H P   F +TPK+G++VIL  + 
Sbjct  484  KLTLSPNYVHFPADIFILTPKYGVQVILQAIS  515



>ref|XP_004298348.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 69/150 (46%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--LLPFIKIKGIVE-------------------------  646
            DG+A+LK ++ I+ +  R YP  +L   K+ G V                          
Sbjct  358  DGMAKLKTMNMIINETLRLYPPAILLSRKVSGEVRLGNILVPANVELLVPTLALHHEPQF  417

Query  645  --EESKAFKSSCYDAGTR--------------------LGLNFAKIEAKVVLSIILRRFA  532
              EE + FK   +  G                      +G NFA +EAK+ +S+IL+R++
Sbjct  418  WGEEVELFKPERFSEGIAKATNENMAAFMPFGLGPRKCVGFNFAALEAKIAMSMILQRYS  477

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            FTLSP Y+HSP     V P++G++VILH L
Sbjct  478  FTLSPGYVHSPFQYVIVRPQNGVQVILHPL  507



>gb|AGX93061.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Vinca minor]
Length=520

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +  G R+  G NFA +EAK+ +S+ILRRFAF LSP+Y+H+P    T+ P++G  +ILHKL
Sbjct  461  FSLGPRMCIGQNFALLEAKMAMSLILRRFAFELSPSYVHAPFTLITMQPQYGAHLILHKL  520



>gb|KHG13385.1| Cytochrome P450 protein [Gossypium arboreum]
Length=290

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G+ FA  E K+ LS+IL+R++FTLSP Y+HSPV  FT+ P+HGI+VI   L
Sbjct  235  VGMTFATTETKIALSMILQRYSFTLSPAYVHSPVTIFTLKPEHGIQVIFESL  286



>ref|XP_006348799.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=423

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 65/151 (43%), Gaps = 49/151 (32%)
 Frame = -1

Query  747  QDGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIKG---  655
             D IARL+ ++ I+ +C R YP                           +P + +     
Sbjct  273  SDAIARLRTMNMIINECMRLYPPVIIVTRKVEREVRLGSMTLPANMTIFMPILALHHDPR  332

Query  654  IVEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRF  535
            I  E+   FK   +  G                    T +GLNF   EAK+ LS+IL+R+
Sbjct  333  IWGEDVHVFKPERFAEGVAKATNNNAAAFFPFGSGPRTCVGLNFTTNEAKITLSMILQRY  392

Query  534  AFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             FTLSP Y+H P   F +TPK G++V+L  +
Sbjct  393  KFTLSPNYVHYPSDIFLLTPKDGVKVVLESI  423



>gb|KJB12897.1| hypothetical protein B456_002G043200 [Gossypium raimondii]
Length=512

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 69/150 (46%), Gaps = 48/150 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP------------------LLPF-----------------  670
            DG+ RLK+V  I+ +  R YP                  LLP                  
Sbjct  361  DGLNRLKVVTMILYEVLRLYPPVVELGRSVPKEIKLGNLLLPVGTEVSVPILQIHHDKDL  420

Query  669  -------IKIKGIVEEESKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAF  529
                    K +   E  SKA KS      +  G R+  G NFA +EAK+ +++IL+RF F
Sbjct  421  WGDDAREFKPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFALMEAKMAMAMILQRFWF  480

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
             LSP+Y HSP    T+ P+HG ++ILHKLG
Sbjct  481  ELSPSYAHSPYSRATLRPQHGAQIILHKLG  510



>ref|XP_006437870.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51110.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=520

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + +G R+  GLNFA  EAK+ LS+IL+R+ F LSP+Y+HSPV   T+ P+HG++VI   L
Sbjct  455  FSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQPL  514

Query  441  G  439
             
Sbjct  515  S  515



>gb|KDO70289.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=546

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + +G R+  GLNFA  EAK+ LS+IL+R+ F LSP+Y+HSPV   T+ P+HG++VI   L
Sbjct  481  FSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQPL  540

Query  441  G  439
             
Sbjct  541  S  541



>ref|XP_006484252.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=520

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + +G R+  GLNFA  EAK+ LS+IL+R+ F LSP+Y+HSPV   T+ P+HG++VI   L
Sbjct  455  FSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQPL  514

Query  441  G  439
             
Sbjct  515  S  515



>ref|XP_006437871.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51111.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=546

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + +G R+  GLNFA  EAK+ LS+IL+R+ F LSP+Y+HSPV   T+ P+HG++VI   L
Sbjct  481  FSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQPL  540

Query  441  G  439
             
Sbjct  541  S  541



>ref|XP_008243891.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=444

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G+NFA +EAK+ L +IL+R++FTLSP Y+HSP+   TV P+ G+ VI+H L
Sbjct  391  TCVGMNFAIVEAKIALVMILQRYSFTLSPGYVHSPIQFMTVRPQRGVPVIIHSL  444



>gb|AJD25167.1| cytochrome P450 CYP72A326 [Salvia miltiorrhiza]
Length=518

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNFA IEAK+VL+++LRRF+F LSP+Y H+P+   T  P+HG  + L KL
Sbjct  467  IGLNFAMIEAKLVLAMMLRRFSFELSPSYTHAPMAALTTRPQHGAHLRLRKL  518



>gb|KDO70288.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=520

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + +G R+  GLNFA  EAK+ LS+IL+R+ F LSP+Y+HSPV   T+ P+HG++VI   L
Sbjct  455  FSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQPL  514

Query  441  G  439
             
Sbjct  515  S  515



>ref|XP_004146006.2| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]
Length=523

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IEAK+ LS+IL+ F+F LSP+Y H+P    T  P+HG  +ILHKL
Sbjct  472  IGQNFAMIEAKMALSMILQHFSFELSPSYTHTPFAALTTQPQHGAHIILHKL  523



>ref|XP_006427678.1| hypothetical protein CICLE_v10027532mg [Citrus clementina]
 gb|ESR40918.1| hypothetical protein CICLE_v10027532mg [Citrus clementina]
Length=506

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
            LG NFA IEAK++LS+ILR+++F +SPTY+H+P+  FT+ P+HG +++  K+ 
Sbjct  453  LGQNFALIEAKIILSMILRQYSFVVSPTYVHAPMLIFTMQPQHGAQIVFSKIS  505



>gb|EMS52653.1| Secologanin synthase [Triticum urartu]
Length=570

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  618  CYDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHK  445
             + +G R  +G NFA +EAKV +S+IL+RF+F LSPTY+H+P    T+ P+HG+ V LH+
Sbjct  510  AFSSGPRNCIGQNFALLEAKVAISMILQRFSFELSPTYMHAPYAVLTLHPQHGVPVRLHR  569

Query  444  L  442
            L
Sbjct  570  L  570



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -1

Query  639  SKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA KS      +  G R+  G NFA +EAK+ L++ILR+F F LSP+Y HSP    T+ 
Sbjct  447  SKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAMILRQFWFELSPSYAHSPCTNITLR  506

Query  477  PKHGIRVILHKL  442
            P+HG  +ILHKL
Sbjct  507  PQHGAHIILHKL  518



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHK  445
            T +G NFA IEAK+ L++IL++F F LSP+Y H+P+  FT+ P++G++VILHK
Sbjct  456  TCVGQNFAMIEAKMALAMILQQFTFELSPSYAHAPLTIFTLQPQYGVQVILHK  508



>ref|XP_010064521.1| PREDICTED: cytochrome P450 72A14-like [Eucalyptus grandis]
 gb|KCW67637.1| hypothetical protein EUGRSUZ_F01382 [Eucalyptus grandis]
Length=413

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHK  445
            +G NFA IEAK+ L++IL+RF F LSP+Y+H P   FT+ P++G ++ILHK
Sbjct  361  IGQNFALIEAKIALAMILQRFTFALSPSYVHGPFTVFTLQPQYGAQIILHK  411



>gb|KHN44049.1| Secologanin synthase [Glycine soja]
Length=219

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+VLS++L++F+F LSP Y H+P   FT+ PK G  +ILHKL
Sbjct  168  IGQNFALLEAKMVLSLLLQKFSFELSPAYAHAPTIVFTLNPKFGAHIILHKL  219



>ref|XP_002325505.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
 gb|EEE99886.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
Length=567

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRV  457
            T LG N+A IE K+ LS+IL+R+ FTLSPTY+H PVH  TV PK GI+ 
Sbjct  459  TCLGFNYAIIEGKIALSMILQRYRFTLSPTYVHHPVHLLTVCPKRGIQT  507



>dbj|BAB02395.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=506

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+ L++IL+RF+F LSP+Y+HSP   FT+ P+ G  +ILHKL
Sbjct  455  IGQNFALLEAKMALALILQRFSFELSPSYVHSPYRVFTIHPQCGAHLILHKL  506



>ref|XP_009356544.1| PREDICTED: uncharacterized protein LOC103947365 [Pyrus x bretschneideri]
Length=1141

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  594   GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             G NFA  EAK+ LS+IL+R+ F LSPTY HSP    TV P+HG++++LH L
Sbjct  1091  GSNFATTEAKIALSMILQRYTFXLSPTYTHSPSAFLTVRPQHGVQIMLHAL  1141


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLS---------PTYIHSPVHGFTVTPKHGIRVIL  451
            T +G++FA IE K+ LS+IL+R++FTLS         P Y+HS V  F + P+HG+++IL
Sbjct  460  TCVGMDFAIIEVKIALSMILQRYSFTLSXXXXXXXLSPAYVHSHVR-FILRPQHGVQIIL  518

Query  450  HKL  442
            H L
Sbjct  519  HPL  521



>ref|XP_002316008.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
 gb|EEF02179.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
Length=513

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +GLNF+  E K+ L++IL+ + FTLSPTYIHSP H  T++P+HG++++L  L
Sbjct  462  VGLNFSFTETKIALAMILQHYRFTLSPTYIHSPAHLLTMSPQHGVQIMLETL  513



>gb|KCW86459.1| hypothetical protein EUGRSUZ_B03127 [Eucalyptus grandis]
Length=495

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G++F   EAKV LS+IL+RF F LSP YIH PV+ F   P+HG+++I H L
Sbjct  443  VGMSFVMTEAKVALSMILQRFTFELSPAYIHCPVYNFMNRPQHGLQIIFHPL  494



>gb|KJB12904.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=518

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 6/73 (8%)
 Frame = -1

Query  639  SKAFKSSC----YDAGTRLGL--NFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA KS      +  G R+ +  NFA +EAK+ +++IL+RF F LSP+Y HSP    T+ 
Sbjct  444  SKATKSQVTFLPFGWGPRICIAQNFAMMEAKMAVAMILQRFWFELSPSYAHSPCSMVTLR  503

Query  477  PKHGIRVILHKLG  439
            P+HG ++ILHKLG
Sbjct  504  PQHGAQIILHKLG  516



>ref|XP_007212388.1| hypothetical protein PRUPE_ppa016261mg [Prunus persica]
 gb|EMJ13587.1| hypothetical protein PRUPE_ppa016261mg [Prunus persica]
Length=455

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 64/129 (50%), Gaps = 29/129 (22%)
 Frame = -1

Query  741  GIARLKIVDEIVEDCQRQYP-------------------LLPFIKI----------KGIV  649
            G+ RLKIVD I+ +  R YP                   L P +++          K I 
Sbjct  327  GLNRLKIVDMILYEVLRLYPPAIFTTREITKETKLGDISLPPGVQLAVPILFVHHDKEIW  386

Query  648  EEESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKH  469
             ++   FK       T +G NFA +EAK V+++IL+ F F LSP Y HSP +  T+ P++
Sbjct  387  GDDVHKFKPESTGPRTCIGQNFALMEAKTVITMILQWFTFELSPAYRHSPFNMLTLEPQY  446

Query  468  GIRVILHKL  442
            G ++I HK+
Sbjct  447  GTQIIFHKI  455



>emb|CAN71061.1| hypothetical protein VITISV_032613 [Vitis vinifera]
Length=281

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = -1

Query  615  YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            +  G+RL  G NFA +EAK+VL++IL+RF+FTLSP+Y H+P    T+ P+HG  +ILH
Sbjct  222  FGWGSRLCIGQNFAILEAKMVLAMILQRFSFTLSPSYSHAPCSLVTLKPQHGAHLILH  279



>sp|H1A988.1|C7254_GLYUR RecName: Full=11-oxo-beta-amyrin 30-oxidase; AltName: Full=Cytochrome 
P450 72A154 [Glycyrrhiza uralensis]
 dbj|BAL45207.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=523

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+VLS++L+ F+F LSPTY H P    T+ PKHG  +ILHKL
Sbjct  472  VGQNFALLEAKIVLSLLLQNFSFELSPTYAHVPTTVLTLQPKHGAPIILHKL  523



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 67/149 (45%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKI---KGI  652
            DG+ RLKIV  I+ +  R YP                          +LP I +   K I
Sbjct  370  DGLNRLKIVTMILNESLRLYPPADSLNRKTTTNTKLGELSLPAGVMLVLPIILLHHDKEI  429

Query  651  VEEESKAFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
              E++  FK   +  G                     +GLNF  IEAK+ L++IL+ F+F
Sbjct  430  WGEDATEFKPERFSEGVSKATKGQMTFFPFGGGPRICIGLNFTMIEAKMALAMILQHFSF  489

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP+Y H+P    T+ P++G  +ILHKL
Sbjct  490  ELSPSYTHAPQSVITIQPQYGAPLILHKL  518



>gb|ABR25638.1| cytochrome p450 72a1 [Oryza sativa Indica Group]
Length=136

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  618  CYDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHK  445
             + +G R  +G NFA IEAK V+++IL+RF+FTLSP Y+H+P    T+ PK+G+ +IL  
Sbjct  74   SFSSGPRACIGQNFAMIEAKAVIAMILQRFSFTLSPKYVHAPTDVITLWPKYGLPMILKS  133

Query  444  L  442
            L
Sbjct  134  L  134



>emb|CDY28093.1| BnaC06g02740D [Brassica napus]
Length=512

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+ +++IL+RF+F LSPTY+H+P   FT+ P++G  +ILHKL
Sbjct  461  IGQNFALLEAKMSMALILQRFSFELSPTYVHAPYTVFTLHPQYGAHLILHKL  512



>ref|NP_001175164.1| Os07g0419000 [Oryza sativa Japonica Group]
 dbj|BAH93892.1| Os07g0419000 [Oryza sativa Japonica Group]
Length=154

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -1

Query  615  YDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            + +G R  +G NFA IEAK V+++IL+RF+FTLSP Y+H+P    T+ PK+G+ +IL  L
Sbjct  83   FSSGPRSCIGQNFAMIEAKAVIAMILQRFSFTLSPKYVHAPTDVITLRPKYGLPMILKSL  142



>ref|XP_009358604.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=235

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  594  GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            G+NFA  E K+VLS+IL+R +  LSP Y+HSP    T+ P+HG++VILH L
Sbjct  181  GMNFATTEVKIVLSMILQRNSSALSPAYVHSPFQFLTLRPQHGVQVILHPL  231



>ref|XP_010041049.1| PREDICTED: cytochrome P450 734A1-like [Eucalyptus grandis]
Length=824

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 60/109 (55%), Gaps = 13/109 (12%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEGSQIT  418
            +GLNFA  E K+ +++IL+R++FTLSP YI  P H  T+ P+HG++VILH L  E   ++
Sbjct  704  VGLNFAMNEVKIAIAMILQRYSFTLSPGYIPLPAHFLTIHPQHGVKVILHSLQCE-HVVS  762

Query  417  RIVKTVGVIAAMGVAAWGAYKVVGSFGV-------GEEPDQRKKKMMKN  292
             I+  + ++        G     G  GV       G+EP     ++ +N
Sbjct  763  SIITPIALLLTCPTNELG-----GDCGVVFHLEHLGDEPRAHTMELAEN  806


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEGSQIT  418
            +GL FA  EAK+ +++IL+R++FTLSP YIH P     + P HG++VILH L       T
Sbjct  294  VGLYFAMNEAKITIAMILQRYSFTLSPDYIHLPTQILAMRPHHGVKVILHPLSRLSISDT  353

Query  417  RIVKTV  400
             +VK V
Sbjct  354  ELVKEV  359



>ref|NP_188081.1| cytochrome P450, family 72, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 gb|AEE75549.1| cytochrome P450, family 72, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=508

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+ L++IL+RF+F LSP+Y+HSP   FT+ P+ G  +ILHKL
Sbjct  457  IGQNFALLEAKMALALILQRFSFELSPSYVHSPYRVFTIHPQCGAHLILHKL  508



>gb|KHG14401.1| Cytochrome P450 protein [Gossypium arboreum]
Length=682

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 10/76 (13%)
 Frame = -1

Query  627  KSSCYDAG----------TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            K++ Y+AG            +G+NFA IE K+ LS+IL+R+  +LSP Y+HSP+   T+ 
Sbjct  607  KATNYNAGAFCPFGLGPRNCVGMNFAIIETKIALSMILQRYTISLSPAYVHSPIPYITIQ  666

Query  477  PKHGIRVILHKLGEEG  430
            P+HGI+VIL  L  + 
Sbjct  667  PQHGIQVILESLHNDA  682



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 66/151 (44%), Gaps = 52/151 (34%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESK-----------------------  634
            DG+  LKIV+ I+ +  R YP  P + +  IV EE+K                       
Sbjct  371  DGLNHLKIVNMILYEVLRLYP--PVVALGRIVSEETKLGKLTLPAGVQVSLPIIFLHHNR  428

Query  633  --------AFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRF  535
                     FK   +  G                     +G  FA +EAKV LS+IL+RF
Sbjct  429  EIWGDDAMEFKPERFSEGVSKAQKGQGIFFPFGWGPRICVGQTFAMLEAKVALSMILQRF  488

Query  534  AFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +F LSP+Y H+P    T+ P+HG  ++LHKL
Sbjct  489  SFELSPSYAHAPHTVITLQPQHGAHLLLHKL  519



>gb|AFO67239.1| putative cytochrome P450 monooxygenase, partial [Aralia elata]
Length=76

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA +EAK+ ++ IL + +F LSP+Y H+P++ FTV P++G  +ILHK+
Sbjct  25   IGQNFAMLEAKLAIATILTKLSFELSPSYTHAPLNLFTVQPQYGANLILHKI  76



>ref|XP_007226407.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
 gb|EMJ27606.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
Length=500

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G +F  IEAK+ LS+IL+  +FTLSP Y+HSP    T+ P+HG+RV LH L
Sbjct  447  TCVGFHFVTIEAKIALSMILQNHSFTLSPAYVHSPFQFLTLRPQHGVRVTLHPL  500



>ref|XP_007225594.1| hypothetical protein PRUPE_ppa026874mg, partial [Prunus persica]
 gb|EMJ26793.1| hypothetical protein PRUPE_ppa026874mg, partial [Prunus persica]
Length=338

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 65/131 (50%), Gaps = 32/131 (24%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESK--------------------AFK  625
            DGIA+LK +  ++ +C R Y   P   +    E E K                      K
Sbjct  210  DGIAKLKTMSMVINECLRLYS--PVGSLSRKAEREVKLGKLIVPANVDLHANRFTEGVAK  267

Query  624  SSCYDAG----------TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTP  475
            ++  +AG          T +GLNFA IEAK+ LS++L+R++FTLSP Y+H  +   T  P
Sbjct  268  ATNNNAGAFLPFGVGPRTCVGLNFAAIEAKIALSMVLQRYSFTLSPGYVHLSLQQVTNRP  327

Query  474  KHGIRVILHKL  442
              G++V+L+ L
Sbjct  328  LRGVQVMLYSL  338



>gb|KJB54457.1| hypothetical protein B456_009G035000 [Gossypium raimondii]
Length=517

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  633  AFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVI  454
            AF +  +   T +G NFA IEAKV L++IL+ F+F LSP+Y H+P    T+ P+HG ++I
Sbjct  454  AFFAFSWGPRTCIGKNFAMIEAKVALAMILQHFSFKLSPSYSHAPYTVMTLQPQHGAQII  513

Query  453  LHKL  442
            LH++
Sbjct  514  LHQI  517



>ref|XP_002988180.1| hypothetical protein SELMODRAFT_127819 [Selaginella moellendorffii]
 gb|EFJ10599.1| hypothetical protein SELMODRAFT_127819 [Selaginella moellendorffii]
Length=514

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 8/71 (11%)
 Frame = -1

Query  639  SKAFKS--SC----YDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFT  484
            S A KS  SC    +  G R  LG +FA+IEAKV +++IL+RF+F LSPTY HSPVH   
Sbjct  441  SSASKSHHSCAFLPFSQGQRVCLGQSFAQIEAKVAMAMILQRFSFRLSPTYRHSPVHRLA  500

Query  483  VTPKHGIRVIL  451
            + P+HG+ ++L
Sbjct  501  LQPQHGVPLLL  511



>gb|EYU22577.1| hypothetical protein MIMGU_mgv1a004830mg [Erythranthe guttata]
Length=508

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -1

Query  639  SKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIR  460
            + AF    Y     +GLNFA  EAK+ LS+IL+R+ FTLSP Y+HSP    T  P+HG++
Sbjct  443  ATAFLGFGYGPRICVGLNFASNEAKIALSMILQRYKFTLSPNYVHSPYIVLTTQPQHGVK  502

Query  459  VILHKL  442
            ++L  L
Sbjct  503  ILLQPL  508



>ref|XP_010054391.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=282

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILH  448
            +GLNFA +EAK+VL++IL+R++FTLSP Y+HSPV      P++G++VI +
Sbjct  231  VGLNFATVEAKIVLAMILQRYSFTLSPAYVHSPVELHNSRPQYGVQVIFN  280



>ref|XP_011457333.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=542

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G NFA IE K+ LS+IL+R++FTLSP Y+HSP    T  P+HG++V LH L
Sbjct  491  VGSNFAAIETKIALSMILQRYSFTLSPGYVHSPYPFLTFRPQHGLQVKLHSL  542



>ref|XP_002963468.1| hypothetical protein SELMODRAFT_80290 [Selaginella moellendorffii]
 gb|EFJ35339.1| hypothetical protein SELMODRAFT_80290 [Selaginella moellendorffii]
Length=514

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 8/71 (11%)
 Frame = -1

Query  639  SKAFKS--SC----YDAGTR--LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFT  484
            S A KS  SC    +  G R  LG +FA+IEAKV +++IL+RF+F LSPTY HSPVH   
Sbjct  441  SSASKSRHSCAFLPFSQGQRVCLGQSFAQIEAKVAMAMILQRFSFRLSPTYRHSPVHRLA  500

Query  483  VTPKHGIRVIL  451
            + P+HG+ ++L
Sbjct  501  LQPQHGLPLLL  511



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = -1

Query  639  SKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA KS      +  G R+  G NFA +EAK+ +++IL+RF+F LSP+Y+H+P + FT+ 
Sbjct  441  SKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQRFSFELSPSYVHAPYNVFTLH  500

Query  477  PKHGIRVILHKL  442
            P+ G  +ILHKL
Sbjct  501  PQFGAHLILHKL  512



>ref|XP_008219236.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=518

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +G  F  IEAK+ LS+IL+  +FTLSP Y+HSP    T+ P+HG+RV LH L
Sbjct  465  TCVGFQFVTIEAKIALSMILQNHSFTLSPAYVHSPFQFLTLRPQHGVRVTLHPL  518



>ref|XP_010046611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104435586 
[Eucalyptus grandis]
Length=1036

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  597   LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             +G++F   EAKV LS+IL+RF F LSP YIH PV+ F   P+HG+++I H L
Sbjct  984   VGMSFVMTEAKVALSMILQRFTFELSPAYIHCPVYNFMNRPQHGLQIIFHPL  1035


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 49/161 (30%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP--------------------------LLPFIKIK---GI  652
            DGIA+LK +  I+ +  R YP                           +P +K+     I
Sbjct  353  DGIAKLKTMGMIINESLRLYPPVVGLIRKVGTKTRLGKLVLPANIGLYIPNLKLHHDPQI  412

Query  651  VEEESKAFKSSCYDAG--------------------TRLGLNFAKIEAKVVLSIILRRFA  532
              ++++ FK   +  G                    T +G NFA  EAK+ LS+IL+R+ 
Sbjct  413  WGDDAQLFKPERFSEGVAKATNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYT  472

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKLGEEGSQITRIV  409
            F+L P Y+HS     T +P+HG++VI H L    S +  ++
Sbjct  473  FSLFPAYVHSHTQLLTTSPQHGVQVIFHALCSPESAMQLVI  513



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +G  FA +EAKVVL++IL+RF F LSP+Y H+PV   T+ P+HG  ++LHKL
Sbjct  467  IGQTFAMLEAKVVLAVILQRFYFELSPSYTHAPVTVVTIQPQHGAHLLLHKL  518



>gb|AJD25259.1| cytochrome P450 CYP749A37 [Salvia miltiorrhiza]
Length=508

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 67/150 (45%), Gaps = 49/150 (33%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYP-------------------LLP----FIKI---------  661
            +GIARLKI++ I+ +C R YP                   L P    FI +         
Sbjct  359  EGIARLKIMNMIINECLRLYPPALSLTRTVAKETKIGQLCLFPNTNIFISVLALHHNPRI  418

Query  660  --------------KGIVE---EESKAFKSSCYDAGTRLGLNFAKIEAKVVLSIILRRFA  532
                           G+VE     + AF        T +GLNF+  EAK+ LS+IL  + 
Sbjct  419  WGDDVHLFKPERFAHGVVEATHNNAAAFIPFGIGPRTCVGLNFSTNEAKIALSMILHNYK  478

Query  531  FTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            F LSP Y+H P+    + P++GI+VIL K+
Sbjct  479  FVLSPNYVHCPIENIILVPRNGIQVILEKI  508



>gb|EYU38223.1| hypothetical protein MIMGU_mgv1a005129mg [Erythranthe guttata]
Length=496

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 66/149 (44%), Gaps = 48/149 (32%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIK----------------------IKGIVEEESK-  634
            D + RLKIV  I+ +  R YP  P I                       I G+V  + K 
Sbjct  348  DALNRLKIVTMILNEVLRMYPPAPVISRTPTKTVKLGDMILPLGVDLLLIIGLVHNDPKI  407

Query  633  ------AFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRFAF  529
                   FK   +  G                     +G  FA IEAK+ +++IL+RF+F
Sbjct  408  WGDDVNEFKPERFSDGISSATKGQFSFIPFSLGPRVCIGQQFAMIEAKIAMAMILQRFSF  467

Query  528  TLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
             LSP+Y+H+P    T+ P++G R++LHKL
Sbjct  468  ELSPSYLHAPFPILTLQPQYGARLLLHKL  496



>ref|XP_011015642.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=420

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  603  TRLGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            T +GLNF+  E K+ L++IL+ + FTLSPTYIHSP H   ++P+HG++++L  L
Sbjct  367  TCVGLNFSVTETKIALAMILQHYRFTLSPTYIHSPAHLLAMSPQHGVQIMLETL  420



>ref|XP_011070335.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=527

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 69/151 (46%), Gaps = 52/151 (34%)
 Frame = -1

Query  744  DGIARLKIVDEIVEDCQRQYPLLPFIKIKGIVEEESK-----------------------  634
            +G+++LK++  I+ +  R YP  P +++  +VEEE+K                       
Sbjct  378  EGLSQLKVIPMILNEVLRLYP--PVVELSRLVEEETKLGEYTIPADTLLMLPIVILHRDP  435

Query  633  --------AFKSSCYDAGTR-------------------LGLNFAKIEAKVVLSIILRRF  535
                     FK   +  G                     +G N++ +EAK+VLS ILR F
Sbjct  436  EYWGEDANEFKPDRFAEGVLKATNGRPAFFPFGWGPRVCIGQNYSLMEAKLVLSNILRTF  495

Query  534  AFTLSPTYIHSPVHGFTVTPKHGIRVILHKL  442
            +F LSPTY H+P   FTV P+HG  +IL KL
Sbjct  496  SFELSPTYTHAPYVVFTVQPQHGAPLILRKL  526



>ref|XP_009146333.1| PREDICTED: cytochrome P450 72A13-like [Brassica rapa]
Length=512

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = -1

Query  639  SKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVT  478
            SKA KS      +  G R+  G NFA +EAK+ +++IL+RF+F LSP+Y+H+P + FT+ 
Sbjct  441  SKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQRFSFELSPSYVHAPYNVFTLH  500

Query  477  PKHGIRVILHKL  442
            P+ G  +ILHKL
Sbjct  501  PQFGAHLILHKL  512



>ref|XP_008446465.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=498

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  597  LGLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGFTVTPKHGIRVILHKLG  439
            +G+NFA  EAKV +SIIL++++FTLSP Y H+PV   T  P+ G++VILH + 
Sbjct  445  VGMNFAINEAKVAMSIILQKYSFTLSPAYAHTPVQFLTTCPQQGLQVILHSIS  497



>emb|CBI39918.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 6/75 (8%)
 Frame = -1

Query  648  EEESKAFKSSC----YDAGTRL--GLNFAKIEAKVVLSIILRRFAFTLSPTYIHSPVHGF  487
            E  SKA KS      +  G R+  G NFA +EAK+ L++IL+RF+F LSP+Y H+P+   
Sbjct  104  EGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISLT  163

Query  486  TVTPKHGIRVILHKL  442
            T+ P+HG  +ILH L
Sbjct  164  TMQPQHGAHLILHGL  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441662578200