BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11586

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    140   1e-34   Nicotiana sylvestris
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    135   1e-32   Sesamum indicum [beniseed]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    125   2e-29   Solanum lycopersicum
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    125   2e-29   Solanum tuberosum [potatoes]
emb|CDP14324.1|  unnamed protein product                                123   2e-28   Coffea canephora [robusta coffee]
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    122   4e-28   Nicotiana tomentosiformis
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    122   4e-28   Nicotiana tomentosiformis
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    119   3e-27   Nicotiana sylvestris
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    114   2e-25   Vitis vinifera
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    114   3e-25   Sesamum indicum [beniseed]
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             107   4e-23   Phaseolus vulgaris [French bean]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    106   2e-22   Cucumis melo [Oriental melon]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    106   2e-22   Cucumis sativus [cucumbers]
gb|KHG27523.1|  hypothetical protein F383_15264                         103   2e-21   Gossypium arboreum [tree cotton]
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                100   1e-20   Erythranthe guttata [common monkey flower]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             100   1e-20   Prunus persica
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977  99.4    4e-20   Prunus mume [ume]
ref|XP_012070457.1|  PREDICTED: uncharacterized protein LOC105632633  99.4    4e-20   Jatropha curcas
gb|KJB80963.1|  hypothetical protein B456_013G123300                  99.4    4e-20   Gossypium raimondii
gb|KJB80965.1|  hypothetical protein B456_013G123300                  99.4    4e-20   Gossypium raimondii
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...  98.2    9e-20   Citrus sinensis [apfelsine]
gb|KJB82581.1|  hypothetical protein B456_013G203000                  97.8    1e-19   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                  98.2    1e-19   Gossypium raimondii
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg           98.2    1e-19   Citrus clementina [clementine]
gb|KJB82579.1|  hypothetical protein B456_013G203000                  98.2    1e-19   Gossypium raimondii
gb|KJB82580.1|  hypothetical protein B456_013G203000                  97.4    1e-19   Gossypium raimondii
gb|KJB82582.1|  hypothetical protein B456_013G203000                  97.8    1e-19   Gossypium raimondii
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...  96.7    3e-19   Cicer arietinum [garbanzo]
gb|KHG04306.1|  Casein kinase I-like protein                          95.9    5e-19   Gossypium arboreum [tree cotton]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151  95.1    1e-18   
gb|EPS68531.1|  hypothetical protein M569_06230                       94.4    2e-18   Genlisea aurea
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210  94.0    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_007030718.1|  Kinase family protein                            93.6    3e-18   Theobroma cacao [chocolate]
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555  92.4    8e-18   Populus euphratica
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg              92.4    9e-18   Erythranthe guttata [common monkey flower]
ref|XP_002325416.1|  kinase family protein                            92.4    1e-17   
ref|XP_002525432.1|  casein kinase, putative                          90.9    3e-17   Ricinus communis
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...  90.1    5e-17   
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268  89.0    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010088042.1|  Casein kinase I isoform delta                    89.0    1e-16   
gb|KJB45108.1|  hypothetical protein B456_007G289500                  88.2    2e-16   Gossypium raimondii
gb|KHG17118.1|  Casein kinase I isoform delta                         88.2    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...  87.4    4e-16   Tarenaya hassleriana [spider flower]
gb|ABN09797.1|  Protein kinase                                        81.6    2e-14   Medicago truncatula
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684  82.0    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_003624626.1|  Casein kinase I isoform alpha                    82.0    3e-14   Medicago truncatula
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg           80.9    7e-14   Eutrema salsugineum [saltwater cress]
ref|XP_002884421.1|  kinase family protein                            77.0    1e-12   Arabidopsis lyrata subsp. lyrata
ref|NP_187044.1|  protein kinase family protein                       76.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...  76.3    2e-12   Glycine max [soybeans]
gb|KJB46017.1|  hypothetical protein B456_007G343500                  76.3    2e-12   Gossypium raimondii
gb|KJB46016.1|  hypothetical protein B456_007G343500                  75.5    4e-12   Gossypium raimondii
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...  74.3    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...  74.3    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...  72.0    4e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...  72.0    4e-11   
ref|XP_002873876.1|  kinase family protein                            71.2    7e-11   
ref|NP_197320.1|  protein kinase                                      71.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873  70.9    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369  70.5    1e-10   Phoenix dactylifera
emb|CDY29971.1|  BnaC01g40370D                                        69.7    3e-10   Brassica napus [oilseed rape]
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...  68.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...  68.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499  68.9    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016  68.6    6e-10   Elaeis guineensis
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg           67.0    2e-09   Capsella rubella
gb|KHF98002.1|  hypothetical protein F383_12939                       66.6    2e-09   Gossypium arboreum [tree cotton]
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226  65.5    5e-09   Brassica rapa
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg           65.5    6e-09   Capsella rubella
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147  65.5    6e-09   Camelina sativa [gold-of-pleasure]
emb|CDY50866.1|  BnaA05g37270D                                        65.1    8e-09   Brassica napus [oilseed rape]
emb|CDY21155.1|  BnaA01g33860D                                        64.3    1e-08   Brassica napus [oilseed rape]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg           63.9    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859  59.7    4e-07   Brassica rapa
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208  59.3    6e-07   Camelina sativa [gold-of-pleasure]
emb|CDY38493.1|  BnaA10g16650D                                        58.2    1e-06   Brassica napus [oilseed rape]
emb|CDY25451.1|  BnaC09g39660D                                        56.6    5e-06   Brassica napus [oilseed rape]
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881  56.2    7e-06   Brassica rapa
emb|CDY51243.1|  BnaA03g06950D                                        55.8    8e-06   Brassica napus [oilseed rape]
emb|CDX70801.1|  BnaC03g08850D                                        53.9    4e-05   
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...  49.7    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807  52.0    2e-04   Fragaria vesca subsp. vesca
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100  50.1    8e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRLGDLQPAP+P+GQEEN  LPTQNR RRRGGGGRGRGNA AVAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLQPAPEPSGQEENWVLPTQNRGRRRGGGGRGRGNATAVAKGPSA  60

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              R RP  AGRGRG+RLIDLDPEPP EA PQAV VGV EPA NR EGAADK+IAM+GGS 
Sbjct  61   ASRARPGGAGRGRGIRLIDLDPEPPCEAPPQAVPVGVAEPALNRAEGAADKNIAMEGGSR  120

Query  667  D  669
            D
Sbjct  121  D  121



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRLGDLQPAPQPT QEEN   P QN   R    GRGRGNAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPTNQEENFLAPAQN---RTRRRGRGRGNAAAVAKGPSA  57

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
                RP AAGRGRG+RLIDLDPEPP E  PQAV VG  EP FNRIEG ADK+IAMDGGSA
Sbjct  58   ATPTRPTAAGRGRGIRLIDLDPEPPCEVLPQAVGVGAGEPGFNRIEGVADKEIAMDGGSA  117

Query  667  D  669
            D
Sbjct  118  D  118



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 101/121 (83%), Gaps = 3/121 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQPAPQP GQEENL LPTQN   RR GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLVLPTQNRTRRRGGGGGRGRGNATAIGKGPS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGS  663
             G RGRP+ AGRGRG+RLIDLDPEPP E  PQ   VGV EPAFNR++GAADK IAMDGG 
Sbjct  61   -GTRGRPSGAGRGRGIRLIDLDPEPPCEGLPQVAPVGVAEPAFNRVDGAADKRIAMDGGG  119

Query  664  A  666
            +
Sbjct  120  S  120



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 102/121 (84%), Gaps = 3/121 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQPAPQP GQEENLALPTQN   RR GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLALPTQNRTRRRGGGGGRGRGNATAIGKGPS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGS  663
             G RGRP+ AGRGRG+RLIDLDPEP  E  PQA  VGV EPAFNR++GAADK IAMDGG 
Sbjct  61   -GTRGRPSGAGRGRGIRLIDLDPEPLCEGLPQAAPVGVAEPAFNRVDGAADKKIAMDGGG  119

Query  664  A  666
            +
Sbjct  120  S  120



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 99/123 (80%), Gaps = 4/123 (3%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLAL--PTQNrtrrrggggrgrgNAAAVAKGP  483
            MPELRSGARRSKRLGDLQPA QP  QEEN  +  PTQNRTRRRGGG     NAAAVAKGP
Sbjct  1    MPELRSGARRSKRLGDLQPAAQPAFQEENWLVQQPTQNRTRRRGGGRGRG-NAAAVAKGP  59

Query  484  STgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGG  660
            S     RPAAAGRGRG+RLIDLDPEPP E  PQAVA G  EPA NR+EGAADKDIAMDGG
Sbjct  60   SAATPARPAAAGRGRGIRLIDLDPEPPCEVLPQAVAPGAVEPALNRVEGAADKDIAMDGG  119

Query  661  SAD  669
            SAD
Sbjct  120  SAD  122



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MP+LR GARRSKRLGD QPAP+P+GQEEN  LPTQNR +RRGGGGRGRGNA AVAKGPS 
Sbjct  1    MPDLRRGARRSKRLGDPQPAPEPSGQEENWVLPTQNRGQRRGGGGRGRGNATAVAKGPSA  60

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              R RP  AGRGRG+RLIDLDPEPP E  PQAV VGV EPA NR EGAADK+IAM+GG+ 
Sbjct  61   ATRARPGGAGRGRGIRLIDLDPEPPCEVLPQAVPVGVAEPALNRAEGAADKNIAMEGGNR  120

Query  667  D  669
            D
Sbjct  121  D  121



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 98/126 (78%), Gaps = 6/126 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPA-PQPTGQEENLALP-TQNrtrrrggggrgrgN--AAAVAK  477
            MPELRSGARRSKRLGDLQPA PQP GQEENL LP TQNR RRRGGGG       A AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  478  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  654
            GPS   R RP+  GRGRG+RLIDLDPE P E  PQA  VGV EPAFNRIEGAADK+IAMD
Sbjct  62   GPSGTTRARPSGGGRGRGIRLIDLDPETPREVLPQAAPVGVAEPAFNRIEGAADKNIAMD  121

Query  655  -GGSAD  669
             GGSAD
Sbjct  122  GGGSAD  127



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 98/126 (78%), Gaps = 6/126 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPA-PQPTGQEENLALP-TQNrtrrrggggrgrgN--AAAVAK  477
            MPELRSGARRSKRLGDLQPA PQP GQEENL LP TQNR RRRGGGG       A AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  478  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  654
            GPS   R RP+ AGRGRG+RLIDLDPE P E  PQA  +GV EPAFNRIEGAADK IAMD
Sbjct  62   GPSGTTRARPSGAGRGRGIRLIDLDPETPCEVLPQAAPLGVAEPAFNRIEGAADKHIAMD  121

Query  655  -GGSAD  669
             GGSAD
Sbjct  122  GGGSAD  127



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   114 bits (286),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrg-NAAAVAKGPS  486
            MPELRSG RRSKRL DLQP+PQP  Q EN  LP QNR RRR GGGRGRG NA  +AKGPS
Sbjct  1    MPELRSGPRRSKRLDDLQPSPQPGDQAENWLLPAQNRPRRRVGGGRGRGCNATPLAKGPS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGS  663
              +  RPAAAGRGRG+RLIDLDPEPP E  P+A A+GV EPAFNR++  ADK+IAM+GGS
Sbjct  61   AAIATRPAAAGRGRGIRLIDLDPEPPCEVHPEAGALGVAEPAFNRVDAVADKEIAMEGGS  120

Query  664  AD  669
            A+
Sbjct  121  AE  122



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   114 bits (284),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 83/121 (69%), Positives = 87/121 (72%), Gaps = 4/121 (3%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRLGDLQPAPQ   QEE    P Q    R    GRGRGNAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLQPAPQTANQEEKFLAPAQ---TRTRRRGRGRGNAAAVAKGPSA  57

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
                RP AAGRGRGVRLIDLDPEPP E  P  V +   EPAFNRIEG A+K+I M+GGS 
Sbjct  58   ATPARPTAAGRGRGVRLIDLDPEPPREVLPPTVGLVAAEPAFNRIEGVANKEIPMEGGSG  117

Query  667  D  669
            D
Sbjct  118  D  118



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   107 bits (268),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 77/121 (64%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQP P P  Q EN A P QN   RR GGG    GNA AV KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPIDQGENWAQPAQNRTRRRVGGGRGRGGNATAVGKGPS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              V  R  AAGRGRG RLIDLDPEP    P+ VA+G  EP +N +E  A+ +IAM+GGSA
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPEPCEVLPEPVALGAPEPVYNHVEVVANNNIAMEGGSA  120

Query  667  D  669
            D
Sbjct  121  D  121



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrg-NAAAVAKGPS  486
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  NRTRRR  GGRGRG NA AVAKGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              +  RP AA RGRG+RLIDLDPEP    P+A A+G  EP FNR+E  A+KD+A++GGSA
Sbjct  61   VAIPARPTAARRGRGIRLIDLDPEPCEVLPEAGAIGAAEPVFNRVEAVANKDMAIEGGSA  120

Query  667  D  669
            D
Sbjct  121  D  121



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 ref|XP_011653470.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrg-NAAAVAKGPS  486
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  NRTRRR  GGRGRG NA AVAKGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              +  RP AA RGRG+RLIDLDPEP    P+A A+G  EP FNR+E  A+KD+A++GGSA
Sbjct  61   VAIPARPTAARRGRGIRLIDLDPEPCEVLPEAGAIGAAEPVFNRVEAVANKDMAIEGGSA  120

Query  667  D  669
            D
Sbjct  121  D  121



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 78/120 (65%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAK PS 
Sbjct  1    MPELRSGARKSKRLGDLQPPFQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKVPSP  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  R  A+GRGRG+RLIDLDPEP    P A  +   +PAFN++E  A+KDIAMDGGSAD
Sbjct  60   EVPNRTKASGRGRGIRLIDLDPEPCQVLPGAPPLADAQPAFNQVEVVANKDIAMDGGSAD  119



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   100 bits (250),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 78/123 (63%), Positives = 85/123 (69%), Gaps = 8/123 (7%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRLGDL P PQ   QEE    P Q    R    GRGRGNA+AVAKGPST
Sbjct  2    MPELRSGARRSKRLGDLHPTPQTANQEEEFLAPAQ---TRTRRRGRGRGNASAVAKGPST  58

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIE--GAADKDIAMDGG  660
                RP AAGRGRGVRLIDLDPEPP E  P+ V +G  E   NR+E  G ADK++AM+G 
Sbjct  59   ATPTRPTAAGRGRGVRLIDLDPEPPREVLPETVGLGAAE--LNRVEGVGVADKEVAMEGA  116

Query  661  SAD  669
            S D
Sbjct  117  SGD  119



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQP-TGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  486
            MPELRSG RRSKRL DLQP+ QP  GQ EN  LP QN+TRRR GGGRGR    AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNKTRRRAGGGRGR-GGNAVAKGPS  59

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGG-S  663
              +  R  AAGRGRGVRLIDLDPEP    P+A A+G  EP +NR+E  ADKDIAM+GG S
Sbjct  60   PAIPTRATAAGRGRGVRLIDLDPEPCEVRPEAAALGAAEPIYNRVEVVADKDIAMEGGAS  119

Query  664  AD  669
            AD
Sbjct  120  AD  121



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQP-TGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  486
            MPELRSG RRSKRL DLQP+ QP  GQ EN  LP QN+ RRR GGGRGR    AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNKPRRRAGGGRGR-GGNAVAKGPS  59

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGG-S  663
              +  R  AAGRGRGVRLIDLDPEP    P+A A+G  EP +NR+E  ADKDIAM+GG S
Sbjct  60   PAIPTRATAAGRGRGVRLIDLDPEPCEVRPEAAALGAAEPIYNRVEVVADKDIAMEGGAS  119

Query  664  AD  669
            AD
Sbjct  120  AD  121



>ref|XP_012070457.1| PREDICTED: uncharacterized protein LOC105632633 [Jatropha curcas]
 gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRL DLQ   QP    EN   PTQN+TRRR GG    GNA  VAKG S 
Sbjct  1    MPELRSGARRSKRLDDLQALQQPINPTENWIQPTQNKTRRRAGGRGRGGNATGVAKGASP  60

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             +  RP AAGRG+G+RLIDLDPEP    P   A+G  EP +NR+E  ADKDIAMDGGSAD
Sbjct  61   AIPARPTAAGRGQGIRLIDLDPEPCEVEP--AALGAAEPGYNRVEVVADKDIAMDGGSAD  118



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAKGPS 
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKGPSP  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    P A  +   +PAFN++E  A+KDIAMDGGSAD
Sbjct  60   EVPNRPKAAGRGRGIRLIDLDPEPCQVLPGAPPLADAQPAFNQVEVVANKDIAMDGGSAD  119



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAKGPS 
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKGPSP  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    P A  +   +PAFN++E  A+KDIAMDGGSAD
Sbjct  60   EVPNRPKAAGRGRGIRLIDLDPEPCQVLPGAPPLADAQPAFNQVEVVANKDIAMDGGSAD  119



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GGGRGRGNA AVAK P  
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK-PGI  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RLIDLDPEP    P+A A+   EP +N +E  ADKDIAM+GGSAD
Sbjct  60   --PARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAMEGGSAD  117



>gb|KJB82581.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=654

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+G SAD
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAMEGRSAD  119



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+G SAD
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAMEGRSAD  119



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GGGRGRGNA AVAK P  
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK-PGI  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RLIDLDPEP    P+A A+   EP +N +E  ADKDIAM+GGSAD
Sbjct  60   --PARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAMEGGSAD  117



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+G SAD
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAMEGRSAD  119



>gb|KJB82580.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=587

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+G SAD
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAMEGRSAD  119



>gb|KJB82582.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=696

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+G SAD
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAMEGRSAD  119



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 72/121 (60%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQPAP P  Q EN   P QN   RR GGG    GNA  V K  S
Sbjct  1    MPELRSGARRSKRLGDLQPAPLPVDQGENWTQPAQNRTRRRVGGGRGRGGNATGVGKASS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              V  R  AAGRGRG RLIDLDPEP    P+ VA+   EP +N +E  A+ +IAM+GGS 
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPEPCEVLPEPVALRAPEPLYNHVEVVANNNIAMEGGSG  120

Query  667  D  669
            D
Sbjct  121  D  121



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGP  
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRVGGRGRGNAAGVAKGPLA  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+G SAD
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPCQVLPQAEPLAAAGPAFNRVEVVADKDIAMEGRSAD  119



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 81/127 (64%), Positives = 87/127 (69%), Gaps = 7/127 (6%)
 Frame = +1

Query  310  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrg-NAAAVA  474
            MPELRSGAR    RSKRL +LQP+PQP  Q EN  LP  NRT RR G GRGRG NA AVA
Sbjct  1    MPELRSGARQARLRSKRLDELQPSPQPLDQAENCVLPAPNRTGRRVGAGRGRGCNATAVA  60

Query  475  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVA--VGVREPAFNRIEGAADKDIA  648
            K P      RP  AGRGRGVRLIDLDPE P E    VA  VG  EPAFN++EG  DKD  
Sbjct  61   KEPLGATPSRPVGAGRGRGVRLIDLDPELPHEVLPEVAPSVGAGEPAFNQVEGVGDKDFV  120

Query  649  MDGGSAD  669
            M+GGSA+
Sbjct  121  MEGGSAE  127



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRLGDLQ APQP  QE++    TQNRTRRRG G       A       +
Sbjct  1    MPELRSGARRSKRLGDLQSAPQPENQEQDFLPSTQNRTRRRGRGRGNAAAVAKGTAATPS  60

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
                RP AAGRGRG RLIDLD + P E  PQA+  GV +PA NRIEG  DK++AMDGGSA
Sbjct  61   ----RPTAAGRGRGARLIDLDLQTPCEVQPQALGGGVGDPALNRIEGVGDKEVAMDGGSA  116

Query  667  D  669
            D
Sbjct  117  D  117



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQP-TGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  486
            MPELRSG RRSKRL DLQP+ QP  GQ EN  LP QN+ RRR GGGRGR    AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNKPRRRAGGGRGR-GGNAVAKGPS  59

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD-GGS  663
              +  R  AAGRGRGVRLIDLDPEP    P+A A+G  +P +NR +  ADKDIAM+ GGS
Sbjct  60   PAIPTRQTAAGRGRGVRLIDLDPEPCEVRPEAAALGAADPIYNRADVVADKDIAMEGGGS  119

Query  664  AD  669
            AD
Sbjct  120  AD  121



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GG     NAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLDDLQP-PQPVDQAENWVLPAQNRTRRRVGGRGRG-NAAAVAKGPSP  58

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RLIDLDPEP    P+A  +   EPA NR+E  ADKDIAM+GGSAD
Sbjct  59   AVPTRPTAAGRGRGIRLIDLDPEPCQVLPEAAPLAAAEPALNRVEVVADKDIAMEGGSAD  118



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrt-rrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN+T RR GGG    GNAA VAKG S
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKTRRRAGGGRGRGGNAAGVAKGAS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
                 RP AAGRGRGVRLIDLDPEP    P   AVG  E  +NR+E  ADKDIAM+GGSA
Sbjct  61   --PATRPTAAGRGRGVRLIDLDPEPCQVEP--AAVGAAELGYNRLEVVADKDIAMEGGSA  116

Query  667  D  669
            +
Sbjct  117  E  117



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 73/120 (61%), Positives = 83/120 (69%), Gaps = 21/120 (18%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELR GARRSKRLGDLQ A     QEEN+    QNR R RG G     NAAAVAKGP+ 
Sbjct  1    MPELRRGARRSKRLGDLQAA----NQEENIVASAQNRPRGRGRGRG---NAAAVAKGPT-  52

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RLIDLDPEPP++          EPAFNR+EG ADK+IA++GGS +
Sbjct  53   ----RPTAAGRGRGIRLIDLDPEPPWQG---------EPAFNRVEGVADKEIAIEGGSGN  99



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 86/121 (71%), Gaps = 5/121 (4%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrt-rrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN+T RR GGG    GNAA VAKG S
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKTRRRAGGGRGRGGNAAGVAKGAS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
                 RP AAGRGRGVRLIDLDPEP    P   AVG  E  +NR+E  ADKDIAM+GGSA
Sbjct  61   --PTTRPTAAGRGRGVRLIDLDPEPCQVEP--AAVGAAELGYNRLEVVADKDIAMEGGSA  116

Query  667  D  669
            +
Sbjct  117  E  117



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRL DLQ   QP    +N   P QN+TRRR GG    GNA AVAKG S 
Sbjct  1    MPELRSGARRSKRLDDLQTLQQPVNPADNWIQPAQNKTRRRVGGRGRGGNATAVAKGASP  60

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             +  RP AAGRGRG+RLIDLDPEP     +A A+   EP +NR+E  ADKDIAM+ GSAD
Sbjct  61   AIPTRPTAAGRGRGIRLIDLDPEPC--EVEAAALRAAEPGYNRVEVVADKDIAMEDGSAD  118



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 79/120 (66%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q  TRRRGGGGRGRGNAAA+A     
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQTGTRRRGGGGRGRGNAAALA---KG  57

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AA RGRG+RLIDL+PEP    P   A+G  EPAFNR EG ADKDIA++GGSA+
Sbjct  58   AAPPRPTAACRGRGIRLIDLEPEPCDLHPAGGAIGAAEPAFNRAEGVADKDIAVEGGSAE  117



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 75/122 (61%), Positives = 88/122 (72%), Gaps = 9/122 (7%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRL +LQP PQ   Q +N ALPTQN+TRRRGGGGRGRGNA AV +G +T
Sbjct  1    MPELRSGARRSKRLDNLQPNPQQIEQADNWALPTQNKTRRRGGGGRGRGNATAVGRGRAT  60

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQA--VAVGVREPAFNRIEGAADKDIAMDGGS  663
                    AGRGRG+R IDLDPEP    P+   +     +PAFNR+E   +KDIAM+GGS
Sbjct  61   -------GAGRGRGIRFIDLDPEPCEVVPEVAALGAAAADPAFNRVEVVGEKDIAMEGGS  113

Query  664  AD  669
            A+
Sbjct  114  AE  115



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 76/122 (62%), Positives = 86/122 (70%), Gaps = 3/122 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSG RRSKRLGDLQP+PQP GQ EN  LPT N+ RRR GGGRGRG     AKGPS 
Sbjct  1    MPELRSGVRRSKRLGDLQPSPQPIGQAENWPLPTPNKPRRRVGGGRGRGGNGV-AKGPSP  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQ-AVAVGVREPAFNRIEGAADKDIAMD-GGS  663
             +  R  A GRGRG++L+DLDPEP    P+ A       PA+N +E  ADKDIAM+ GGS
Sbjct  60   AIPTRQTAGGRGRGIKLLDLDPEPCEVVPEGAGLGAAAGPAYNHLEVVADKDIAMEGGGS  119

Query  664  AD  669
            AD
Sbjct  120  AD  121



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 77/120 (64%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN   RR  GGRGRGNA  VAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPSP  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RL D DPE     P+A  +   EP FN+ E  ADKDIAM+GGS D
Sbjct  60   AVPTRPRAAGRGRGIRLTDFDPELCQVLPEAAPLAAAEPVFNQAEVVADKDIAMEGGSGD  119



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 77/120 (64%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN   RR  GGRGRGNA  VAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPSP  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
             V  RP AAGRGRG+RL D DPE     P+A  +   EP FN+ E  ADKDIAM+GGS D
Sbjct  60   AVPTRPRAAGRGRGIRLTDFDPELCQVLPEAAPLAAAEPVFNQAEVVADKDIAMEGGSGD  119



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 68/133 (51%), Gaps = 30/133 (23%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ-------------Nrtrrrggggrg  450
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q             N      G    
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQTGTRRRGGGRGRGNAAALAKGAAPP  60

Query  451  rgNAAAVAKGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGA  630
            R  AA   +G                 +RLIDL+PEP    P   A+G  EPAFNR EG 
Sbjct  61   RPTAACRGRG-----------------IRLIDLEPEPCDLHPAGGAIGAAEPAFNRAEGV  103

Query  631  ADKDIAMDGGSAD  669
            ADKDIA++GGSA+
Sbjct  104  ADKDIAVEGGSAE  116



>gb|ABN09797.1| Protein kinase [Medicago truncatula]
Length=573

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN   RR GGG    GNA  + KG S
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQNRTRRRVGGGRGRGGNATGLGKGSS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              V  R  AAGRGRG RLIDLDP+P    P+ VA+  +EP +N +E  A+ +IAM+GGS 
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPQPCDLLPEPVALRAQEPVYNNVEVVANNNIAMEGGSG  120

Query  667  D  669
            D
Sbjct  121  D  121



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 82/126 (65%), Gaps = 11/126 (9%)
 Frame = +1

Query  310  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgr-gNAAAVA  474
            MPELRSGAR    RSKRL DLQP+ Q   Q EN ALP  NRT RR G GRGR  NA AVA
Sbjct  1    MPELRSGARQARLRSKRLDDLQPSSQHPDQAENCALPAPNRTGRRVGAGRGRGCNATAVA  60

Query  475  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAM  651
            KGPS     R   AGRGR  RLIDLDPE P E  P+A  +     A N+ EG  DKD+AM
Sbjct  61   KGPSGATPARAIPAGRGRANRLIDLDPEAPHEVLPEAAKL-----AINQAEGVGDKDLAM  115

Query  652  DGGSAD  669
            +GGSA+
Sbjct  116  EGGSAE  121



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN   RR GGG    GNA  + KG S
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQNRTRRRVGGGRGRGGNATGLGKGSS  60

Query  487  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
              V  R  AAGRGRG RLIDLDP+P    P+ VA+  +EP +N +E  A+ +IAM+GGS 
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPQPCDLLPEPVALRAQEPVYNNVEVVANNNIAMEGGSG  120

Query  667  D  669
            D
Sbjct  121  D  121



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 78/125 (62%), Gaps = 16/125 (13%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKG---  480
            MPELRSGARRS+RL D QP PQ   Q EN+ALP Q  TRRRGGG       AA+AKG   
Sbjct  1    MPELRSGARRSRRLDD-QPNPQLVEQAENIALPPQTATRRRGGGRGRGN--AALAKGAVP  57

Query  481  --PSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  654
              P+   RGR           L DL+PEP    P A A+G  EPA NR EGAADKDIA++
Sbjct  58   PRPTAAGRGRGIR--------LTDLEPEPCEVRPAAGALGAAEPALNRAEGAADKDIAVE  109

Query  655  GGSAD  669
            GGSA+
Sbjct  110  GGSAE  114



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 78/121 (64%), Gaps = 7/121 (6%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP PQ   Q EN+ LP Q  TRRRGGG      A A       
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQAENIVLPPQTATRRRGGGRGRGNAALA-----KA  54

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAV-GVREPAFNRIEGAADKDIAMDGGSA  666
                RP AAGRGRG+RL DL+PEP    P A AV G  EPA NR+EG ADKDIA +GGSA
Sbjct  55   APPPRPTAAGRGRGIRLTDLEPEPCEVRPAAGAVIGATEPALNRVEGVADKDIAAEGGSA  114

Query  667  D  669
            +
Sbjct  115  E  115



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 82/120 (68%), Gaps = 6/120 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP P    Q EN+ LP Q  TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPPLVEQAENIVLPPQTATRRRGGGRGRGN--AALAKGAA-  56

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RL DL+PEP    P A A+G  EPA NR+EG ADKDIA +GGSA+
Sbjct  57   --PPRPTAAGRGRGIRLTDLEPEPCEVRPAAGAIGATEPALNRVEGVADKDIAAEGGSAE  114



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 79/122 (65%), Gaps = 2/122 (2%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPT--QNrtrrrggggrgrgNAAAVAKGP  483
            MPELRSGARRSKRLGDLQP P P  Q EN   P       RR GGG    GNA AV KGP
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPVDQGENWQQPAAPNRTRRRVGGGRGRGGNATAVGKGP  60

Query  484  STgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGS  663
            S  V  R  AAGRGRG RLIDLDPEP    P+ VA+G  EP +N +E  A+ +I M+GGS
Sbjct  61   SPAVPTRRTAAGRGRGARLIDLDPEPCEVLPEPVALGAPEPVYNNVEVVANNNIVMEGGS  120

Query  664  AD  669
             D
Sbjct  121  GD  122



>gb|KJB46017.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=739

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTG----QEENLALPTQNrtrrrggggrgrgNAAAVAK  477
            MP+LRSGARRSKR+ DLQP P        Q EN  L  QNRTRRR GG      AA VAK
Sbjct  1    MPDLRSGARRSKRIDDLQPPPPAHPQPVEQPENCVLLAQNRTRRRVGGRGRGN-AAGVAK  59

Query  478  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREP-AFNRIEGAADKDIAMD  654
            GPS  V  RP AAGRGRG+RLIDLDPEP    P A+ +   EP AFNR+E  ADKDIAM+
Sbjct  60   GPSAVVPTRPTAAGRGRGIRLIDLDPEPCQVLPGALPLVAAEPAAFNRVEVVADKDIAME  119

Query  655  GGSAD  669
            G S D
Sbjct  120  GNSGD  124



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 78/125 (62%), Positives = 85/125 (68%), Gaps = 6/125 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTG----QEENLALPTQNrtrrrggggrgrgNAAAVAK  477
            MP+LRSGARRSKR+ DLQP P        Q EN  L  QN   RR  GGRGRGNAA VAK
Sbjct  1    MPDLRSGARRSKRIDDLQPPPPAHPQPVEQPENCVLLAQN-RTRRRVGGRGRGNAAGVAK  59

Query  478  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREP-AFNRIEGAADKDIAMD  654
            GPS  V  RP AAGRGRG+RLIDLDPEP    P A+ +   EP AFNR+E  ADKDIAM+
Sbjct  60   GPSAVVPTRPTAAGRGRGIRLIDLDPEPCQVLPGALPLVAAEPAAFNRVEVVADKDIAME  119

Query  655  GGSAD  669
            G S D
Sbjct  120  GNSGD  124



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 78/120 (65%), Gaps = 7/120 (6%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP PQ   Q E +  P    T  R  GG      AA+AKGP+ 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSP---PTATRRRGGGRGRGNAALAKGPA-  55

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A +GGSAD
Sbjct  56   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPAINRVEGVADKDLAAEGGSAD  113



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 78/120 (65%), Gaps = 7/120 (6%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP PQ   Q E +  P    T  R  GG      AA+AKGP+ 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSP---PTATRRRGGGRGRGNAALAKGPA-  55

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A +GGSAD
Sbjct  56   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPAINRVEGVADKDLAAEGGSAD  113



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 80/125 (64%), Gaps = 5/125 (4%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQ-PAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQ P+P+   Q EN   PTQN+TRRRGGG     NAAA     +
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQNKTRRRGGGRGRGANAAAGLAKGA  60

Query  487  Tgv--rgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAF-NRIEGAADKDIAMD  654
                   +   AGRGRGVR+IDLDPE P E  PQ         A  NR+EG ADKDIAM+
Sbjct  61   QAAVGARQTGGAGRGRGVRVIDLDPEIPGEVLPQVAPAVGAAGAAQNRVEGGADKDIAME  120

Query  655  GGSAD  669
            GGS D
Sbjct  121  GGSGD  125



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 80/125 (64%), Gaps = 5/125 (4%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQ-PAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  486
            MPELRSGARRSKRLGDLQ P+P+   Q EN   PTQN+TRRRGGG     NAAA     +
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQNKTRRRGGGRGRGANAAAGLAKGA  60

Query  487  Tgv--rgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAF-NRIEGAADKDIAMD  654
                   +   AGRGRGVR+IDLDPE P E  PQ         A  NR+EG ADKDIAM+
Sbjct  61   QAAVGARQTGGAGRGRGVRVIDLDPEIPGEVLPQVAPAVGAAGAAQNRVEGGADKDIAME  120

Query  655  GGSAD  669
            GGS D
Sbjct  121  GGSGD  125



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 83/120 (69%), Gaps = 14/120 (12%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP+PQ TGQ +N+ LP Q  TRRRGGGGRGRGNAAA    P  
Sbjct  1    MPELRSGARRLR-----QPSPQVTGQADNIELPPQPVTRRRGGGGRGRGNAAAKGAAP--  53

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                    AGRGRG+RLIDL+ EP    P   AVG  EPAFN++EG A+KDIAM+GGSA+
Sbjct  54   --PRPTGGAGRGRGIRLIDLEAEPCEVRP---AVG--EPAFNQVEGVAEKDIAMEGGSAE  106



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 68/120 (57%), Positives = 79/120 (66%), Gaps = 16/120 (13%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP+PQ TGQ +N+ LP Q  TRRRGGGGRGRGNA   A     
Sbjct  1    MPELRSGARRLR-----QPSPQVTGQADNIELPPQPVTRRRGGGGRGRGNAKGAA-----  50

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                     GRGRG+RLIDL+ EP    P   AVG  EPAFN++E  A+KDIAM+GGSA+
Sbjct  51   -PPRPAGGVGRGRGIRLIDLEAEPCEVRP---AVG--EPAFNQVEAVAEKDIAMEGGSAE  104



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 70/120 (58%), Positives = 79/120 (66%), Gaps = 15/120 (13%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP+PQ   Q EN+ LP Q    RR GGGRGRGNAAA     S 
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQ-PVTRRRGGGRGRGNAAA----KSP  50

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                   AAGRGRG+RLIDL+ EP    P   AVG  EPAFN++EG ADKDIAM+GGSA+
Sbjct  51   APPRPAGAAGRGRGIRLIDLEAEPIEVRP---AVG--EPAFNQVEGVADKDIAMEGGSAE  105



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 77/132 (58%), Gaps = 13/132 (10%)
 Frame = +1

Query  310  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  474
            MPELRSGAR    +SK+L D+ P PQ   Q EN  LPT N   RR G G     NAAAV 
Sbjct  1    MPELRSGARQARLKSKKLDDIPPPPQRIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVV  60

Query  475  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAV------GVREPAFNR-IEGAA  633
            KGPS     RP   GRGRG+ LIDLDP+ P E     AV      G +    N+  EG A
Sbjct  61   KGPSA-TPVRPTVGGRGRGITLIDLDPDQPCEILPGAAVGGAAVPGAQGFILNQAAEGIA  119

Query  634  DKDIAMDGGSAD  669
            DKD+AMDGGSA+
Sbjct  120  DKDLAMDGGSAE  131



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 74/123 (60%), Gaps = 13/123 (11%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAA----AVAK  477
            MPELRSGARRS+RL D QP PQ   Q +N+ALP      RR GGGRGRGNAA    AV  
Sbjct  1    MPELRSGARRSRRLED-QPNPQVVEQADNIALPLPQTATRRRGGGRGRGNAALAKAAVPP  59

Query  478  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDG  657
             P+   RGR           L DL+PEP    P A  +G  EPA NR+EG AD+DIA +G
Sbjct  60   RPTAAGRGRGIR--------LRDLEPEPCEVLPAAGDLGATEPALNRVEGVADQDIAAEG  111

Query  658  GSA  666
            G +
Sbjct  112  GGS  114



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 80/120 (67%), Gaps = 6/120 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSPPPTATRRRGGGRGRGN--AALAKGAA-  56

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A +GGSA+
Sbjct  57   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPALNRVEGVADKDLAAEGGSAE  114



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 80/120 (67%), Gaps = 6/120 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSPPPTATRRRGGGRGRGN--AALAKGAA-  56

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A +GGSA+
Sbjct  57   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPALNRVEGVADKDLAAEGGSAE  114



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 80/120 (67%), Gaps = 6/120 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSPPPTATRRRGGGRGRGN--AALAKGAA-  56

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A +GGSA+
Sbjct  57   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPALNRVEGVADKDLAAEGGSAE  114



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 78/132 (59%), Gaps = 13/132 (10%)
 Frame = +1

Query  310  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  474
            MPELRSGAR    +SK+L D+   PQP  Q EN  LPT N   RR G G     NAAAVA
Sbjct  1    MPELRSGARQARLKSKKLDDIPLPPQPIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVA  60

Query  475  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAV------GVREPAFNR-IEGAA  633
            KGPS     RP   GRGRG+ LIDLDP+ P E     AV      G +    N+  EG A
Sbjct  61   KGPSA-TPVRPTVGGRGRGITLIDLDPDQPCEILAGAAVRGAAVPGAQGFILNQAAEGIA  119

Query  634  DKDIAMDGGSAD  669
            DKD+AMDGGSA+
Sbjct  120  DKDLAMDGGSAE  131



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 67/120 (56%), Positives = 75/120 (63%), Gaps = 15/120 (13%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGG      AA  A  P  
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQPVTRRRGGGRGRGNAAAKAAAPPR-  54

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                   AAGRGRG+RLIDL+ EP    P   AVG  EPA N++EG ADKDIAM+GGSAD
Sbjct  55   ----PTGAAGRGRGIRLIDLEAEPCEIRP---AVG--EPALNQVEGVADKDIAMEGGSAD  105



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 85/128 (66%), Gaps = 9/128 (7%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTG-------QEENLALPTQNrtrrrggggrgrgNAAA  468
            MP+LRSGARRSKR+ DLQP P P         Q EN  L  QN   RR  GGRGRGNAA 
Sbjct  1    MPDLRSGARRSKRIDDLQPPPPPHPPHPQPVEQPENCVLLAQN-RTRRRVGGRGRGNAAG  59

Query  469  VAKGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREP-AFNRIEGAADKDI  645
            VAKGP   V  RP AAGRGRG+RLIDLDPEP    P A+ +   EP AFNR+E  ADKDI
Sbjct  60   VAKGPLAVVPTRPTAAGRGRGIRLIDLDPEPCQVLPGALPLVAAEPAAFNRVEVVADKDI  119

Query  646  AMDGGSAD  669
            AM+G S D
Sbjct  120  AMEGRSGD  127



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPA--PQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGP  483
            MPELRSGARRS+RL D QP   PQ   Q EN+ALP Q  TRRRGGG     NAA      
Sbjct  1    MPELRSGARRSRRLED-QPNSNPQLVEQAENIALPPQTATRRRGGGRGRG-NAALAKAAV  58

Query  484  STgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGS  663
                       G      L DL+PEP    P A A+G  EPA NR+EG AD+DIA +GG 
Sbjct  59   PPRPAAAGRGRGIR----LRDLEPEPCEVLPAAGALGGAEPALNRVEGVADQDIAAEGGG  114

Query  664  A  666
            +
Sbjct  115  S  115



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 80/120 (67%), Gaps = 6/120 (5%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQAEVIVSPPPTGTRRRGGGRGRGN--AALAKGAA-  56

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                RP AAGRGRG+RL DL+PEP    P A A+G  EPA NR++G ADKD+A +GGSA+
Sbjct  57   --PPRPTAAGRGRGIRLTDLEPEPCEVRPAAGALGATEPAINRVDGVADKDLAAEGGSAE  114



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 65/120 (54%), Positives = 75/120 (63%), Gaps = 15/120 (13%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGG      AA      + 
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQPVTRRRGGGRGRGNAAAK-----AP  50

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                   AAGRGRG+RLIDL+ EP    P   AVG  EPAFN++EG ADKDIAM+GGSA+
Sbjct  51   APPRPTGAAGRGRGIRLIDLEAEPIEVRP---AVG--EPAFNQVEGVADKDIAMEGGSAE  105



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 62/120 (52%), Gaps = 8/120 (7%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            M ELRSGARRS+R+ D QP PQ   Q   L  P Q  T RR GG      AAAV   P+T
Sbjct  1    MRELRSGARRSRRIEDHQPNPQLL-QNILLPPPPQTATTRRRGGYAALAKAAAVPPRPTT  59

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                            L DL+PEP    P A  +G  E A NR+ G ADKD+A +GGS +
Sbjct  60   AAGRGRGIR-------LTDLEPEPCEVCPSAGVLGAAEAALNRVGGVADKDLAAEGGSPE  112



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 65/119 (55%), Gaps = 4/119 (3%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARRS+RL D    PQ   Q EN+  P      RR GGGRGRGNAA        
Sbjct  1    MPELRSGARRSRRLEDQPNNPQVVEQAENIVPPPPQTATRRRGGGRGRGNAALAKAAVPP  60

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSA  666
                     G      L DL+PEP    P A A+G  EPA NR+EG AD+DIA +GG +
Sbjct  61   RPAAAGRGRGIR----LRDLEPEPCEVRPAAGALGATEPALNRVEGVADQDIAAEGGGS  115



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 73/120 (61%), Positives = 82/120 (68%), Gaps = 12/120 (10%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGGGRGRG AAA+AK    
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQTVTRRRGGGGRGRGTAAALAK--GA  53

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                   AAGRGRG+RLIDL+ EP    P   AVG  E AFN+ EGAADKDIAM+GGSA+
Sbjct  54   APPRPAGAAGRGRGIRLIDLEAEPCEARP---AVG--EAAFNQAEGAADKDIAMEGGSAE  108



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 72/120 (60%), Gaps = 16/120 (13%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MP+LRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGGG GRG   A A   + 
Sbjct  1    MPDLRSGARRLR-----QPNPQAIEQAENIELPRQTTTRRRGGGGGGRGRGTAAALAKAA  55

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                   A GRGRG+RLIDL+ EP           V EPAFN+++G ADK IAM+GGS +
Sbjct  56   APPRPTGATGRGRGIRLIDLEAEP-----------VGEPAFNQVQGVADKGIAMEGGSPE  104



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 66/120 (55%), Gaps = 15/120 (13%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGG      AA     P  
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQPVTRRRGGGRGRGNAAAKAPAPPRP  55

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                      R     LIDL+ EP    P   AVG  EP FN++EG ADKDIAM+GGSA+
Sbjct  56   TGAAGRGRGIR-----LIDLEAEPIEVRP---AVG--EPVFNQVEGVADKDIAMEGGSAE  105



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 60/120 (50%), Positives = 71/120 (59%), Gaps = 17/120 (14%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGGG      AA     + 
Sbjct  1    MPELRSGARRLR-----QPNPQAIEQAENIELPRQTTTRRRGGGGGRGRGTAAALAK-AA  54

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                   AAGRGRG+RLIDL+ EP           V EPAFN+++G ADK+IAM+GGS +
Sbjct  55   APPRPTGAAGRGRGIRLIDLEAEP-----------VGEPAFNQVQGVADKNIAMEGGSPE  103



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 69/120 (58%), Gaps = 17/120 (14%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGGG      AA     + 
Sbjct  1    MPELRSGARRLR-----QPNPQAIEQAENIELPRQTTTRRRGGGGGRGRGTAAALAK-AA  54

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMDGGSAD  669
                   A GRGRG+RLIDL+ EP           + EPAFN+++G ADK IAM+GGS +
Sbjct  55   APPRPTGATGRGRGIRLIDLEAEP-----------IGEPAFNQVQGVADKGIAMEGGSPE  103



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 64/127 (50%), Gaps = 37/127 (29%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNA------AAV  471
            MPELRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGG      A      AA 
Sbjct  1    MPELRSGARRLR-----QPNPQAIEQAENIELPRQPATRRRGGGRGRGNAAPPRPTGAAA  55

Query  472  AKGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEG-AADKDIA  648
             +G                   LIDL+ EP           V EPAFN++EG AADKD A
Sbjct  56   GRGRGIR---------------LIDLEAEPV----------VGEPAFNQVEGVAADKDNA  90

Query  649  MDGGSAD  669
            M+GGSAD
Sbjct  91   MEGGSAD  97



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 64/127 (50%), Gaps = 37/127 (29%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNA------AAV  471
            MPELRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGG      A      AA 
Sbjct  1    MPELRSGARRLR-----QPNPQAIEQAENIELPRQPATRRRGGGRGRGNAAPPRPTGAAA  55

Query  472  AKGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEG-AADKDIA  648
             +G                   LIDL+ EP           V EPAFN++EG AADKD A
Sbjct  56   GRGRGIR---------------LIDLEAEPV----------VGEPAFNQVEGVAADKDNA  90

Query  649  MDGGSAD  669
            M+GGSAD
Sbjct  91   MEGGSAD  97



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 63/127 (50%), Gaps = 37/127 (29%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNA------AAV  471
            MPELRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGG      A      AA 
Sbjct  1    MPELRSGARRLR-----QPNPQAIDQAENIELPRQPATRRRGGGRGRGNAAPPRPTGAAA  55

Query  472  AKGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEG-AADKDIA  648
             +G                   LIDL+ EP           V EPAFN++ G AADKD A
Sbjct  56   GRGRGVR---------------LIDLEAEPV----------VGEPAFNQVAGVAADKDNA  90

Query  649  MDGGSAD  669
            M+GGSAD
Sbjct  91   MEGGSAD  97



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score = 49.7 bits (117),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 56/131 (43%), Positives = 63/131 (48%), Gaps = 13/131 (10%)
 Frame = +1

Query  310  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAK  477
            MP+ RSGAR    RSK+L D+    QP GQ EN  LP  NR R   G GRG   AAA AK
Sbjct  36   MPKQRSGARQGHLRSKKLDDIPAPSQPIGQAENPVLPAPNRRRGGAGRGRGSR-AAATAK  94

Query  478  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFE-----APQAVAVGVREPAF--NRIEGAAD  636
             PS                 + DLDP+ P E     A     V   E  F     EG AD
Sbjct  95   RPSVAPARPTVGGRGRGIGVI-DLDPDQPCEILPRAAAGGAVVVGAEGFFLNQAAEGIAD  153

Query  637  KDIAMDGGSAD  669
            KD+AM+GGS D
Sbjct  154  KDLAMEGGSGD  164


 Score = 23.1 bits (48),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 3/26 (12%)
 Frame = +2

Query  242  GLL---EKILTARLVTRVECDLHG*R  310
            GLL   EKI    LVT   C+LHG R
Sbjct  10   GLLRKDEKIEEGLLVTYCGCELHGKR  35



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 57/122 (47%), Positives = 65/122 (53%), Gaps = 19/122 (16%)
 Frame = +1

Query  310  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  489
            MPELRSG RRSKRL DLQP+ QP  Q +N     + R R           A AVAKGPS 
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPQQQPQN-----KPRRRAAAAAAGRGRGANAVAKGPS-  54

Query  490  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIE-GAADKDIAMD-GGS  663
                          VRLIDLDPEP    P        +P +NR++   ADKDIAM+ GGS
Sbjct  55   -PAAGRGRGAAAAAVRLIDLDPEP---CPA-------DPVYNRVQVVVADKDIAMEGGGS  103

Query  664  AD  669
            AD
Sbjct  104  AD  105



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +1

Query  310  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAK  477
            MPELRSGAR    RSK+L D+   PQP GQ EN  LP  N  RR G G      AAAVAK
Sbjct  1    MPELRSGARQGRLRSKKLEDIPVPPQPFGQAENPILPAPN-RRRGGAGRGRGSKAAAVAK  59

Query  478  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFE  570
            GPS     RP   GRGRG+ LIDLDP+ P E
Sbjct  60   GPSV-APARPTFGGRGRGIALIDLDPDQPCE  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1105426564043