BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11488

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602562.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    412   6e-138   Nicotiana tomentosiformis
dbj|BAL14273.1|  FK506-binding protein                                  412   9e-138   Nicotiana tabacum [American tobacco]
ref|XP_004242423.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    410   4e-137   
ref|XP_009803135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    409   9e-137   Nicotiana sylvestris
ref|XP_009787495.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    409   1e-136   Nicotiana sylvestris
ref|XP_009610546.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    407   3e-136   Nicotiana tomentosiformis
ref|XP_006363451.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    406   1e-135   Solanum tuberosum [potatoes]
ref|XP_006352668.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    405   2e-135   Solanum tuberosum [potatoes]
ref|XP_012085200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    405   3e-135   Jatropha curcas
ref|XP_004247044.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    404   6e-135   Solanum lycopersicum
ref|XP_002263566.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    404   1e-134   Vitis vinifera
ref|XP_010647328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    401   2e-133   
ref|XP_007049647.1|  Rotamase FKBP 1 isoform 2                          397   2e-133   
ref|XP_010247134.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    400   3e-133   Nelumbo nucifera [Indian lotus]
ref|XP_010247135.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    400   3e-133   Nelumbo nucifera [Indian lotus]
ref|XP_007049646.1|  Rotamase FKBP 1 isoform 1                          400   3e-133   
ref|XP_011089642.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    398   2e-132   Sesamum indicum [beniseed]
gb|KJB42561.1|  hypothetical protein B456_007G157600                    393   2e-132   Gossypium raimondii
gb|KJB42564.1|  hypothetical protein B456_007G157600                    395   3e-132   Gossypium raimondii
gb|KJB08782.1|  hypothetical protein B456_001G103400                    395   3e-132   Gossypium raimondii
gb|KJB08781.1|  hypothetical protein B456_001G103400                    397   3e-132   Gossypium raimondii
gb|KJB42562.1|  hypothetical protein B456_007G157600                    397   4e-132   Gossypium raimondii
gb|KJB08784.1|  hypothetical protein B456_001G103400                    397   5e-132   Gossypium raimondii
gb|KJB42563.1|  hypothetical protein B456_007G157600                    397   5e-132   Gossypium raimondii
emb|CDP03935.1|  unnamed protein product                                396   1e-131   Coffea canephora [robusta coffee]
gb|KJB42560.1|  hypothetical protein B456_007G157600                    391   1e-131   Gossypium raimondii
gb|KHG19334.1|  Peptidyl-prolyl cis-trans isomerase FKBP62 -like ...    395   2e-131   Gossypium arboreum [tree cotton]
gb|KDO40263.1|  hypothetical protein CISIN_1g008113mg                   395   2e-131   Citrus sinensis [apfelsine]
gb|KDO40268.1|  hypothetical protein CISIN_1g008113mg                   393   2e-131   Citrus sinensis [apfelsine]
gb|KDO40262.1|  hypothetical protein CISIN_1g008113mg                   395   2e-131   Citrus sinensis [apfelsine]
ref|XP_006437244.1|  hypothetical protein CICLE_v10031088mg             395   3e-131   
gb|KJB42559.1|  hypothetical protein B456_007G157600                    395   3e-131   Gossypium raimondii
gb|KDO40267.1|  hypothetical protein CISIN_1g008113mg                   392   3e-131   Citrus sinensis [apfelsine]
gb|KDO40265.1|  hypothetical protein CISIN_1g008113mg                   395   3e-131   Citrus sinensis [apfelsine]
ref|XP_006437245.1|  hypothetical protein CICLE_v10031088mg             395   3e-131   Citrus clementina [clementine]
gb|KDO40264.1|  hypothetical protein CISIN_1g008113mg                   394   4e-131   Citrus sinensis [apfelsine]
ref|XP_002535081.1|  peptidylprolyl isomerase, putative                 394   5e-131   Ricinus communis
gb|KDO40266.1|  hypothetical protein CISIN_1g008113mg                   394   6e-131   Citrus sinensis [apfelsine]
ref|XP_002534361.1|  peptidylprolyl isomerase, putative                 392   4e-130   
gb|EYU39186.1|  hypothetical protein MIMGU_mgv1a003614mg                389   5e-129   Erythranthe guttata [common monkey flower]
ref|XP_008778812.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    389   1e-128   Phoenix dactylifera
ref|XP_002301809.1|  hypothetical protein POPTR_0002s24970g             387   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_007134161.1|  hypothetical protein PHAVU_010G024500g             387   3e-128   Phaseolus vulgaris [French bean]
ref|XP_004510236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    387   4e-128   Cicer arietinum [garbanzo]
ref|XP_010036768.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    386   9e-128   Eucalyptus grandis [rose gum]
ref|XP_011622061.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    387   9e-128   Amborella trichopoda
ref|XP_006840897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    387   9e-128   Amborella trichopoda
ref|XP_010905157.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    386   1e-127   
ref|XP_010036767.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    386   1e-127   Eucalyptus grandis [rose gum]
ref|XP_010905156.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    385   1e-127   Elaeis guineensis
ref|XP_009410619.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    384   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011024590.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    385   3e-127   Populus euphratica
gb|KJB37902.1|  hypothetical protein B456_006G225400                    379   8e-127   Gossypium raimondii
gb|KJB37904.1|  hypothetical protein B456_006G225400                    383   8e-127   Gossypium raimondii
gb|KJB37903.1|  hypothetical protein B456_006G225400                    380   8e-127   Gossypium raimondii
ref|XP_009385667.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    384   9e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008458076.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    383   9e-127   Cucumis melo [Oriental melon]
gb|KJB37905.1|  hypothetical protein B456_006G225400                    383   1e-126   Gossypium raimondii
gb|KJB37901.1|  hypothetical protein B456_006G225400                    383   1e-126   Gossypium raimondii
ref|XP_010550903.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    381   3e-126   Tarenaya hassleriana [spider flower]
gb|KHF97531.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    382   3e-126   Gossypium arboreum [tree cotton]
emb|CDX86295.1|  BnaA06g30120D                                          381   1e-125   
emb|CDX85348.1|  BnaC07g26590D                                          380   1e-125   
ref|XP_008794657.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    380   1e-125   Phoenix dactylifera
ref|XP_010547132.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    380   2e-125   Tarenaya hassleriana [spider flower]
ref|XP_007140683.1|  hypothetical protein PHAVU_008G133100g             379   2e-125   Phaseolus vulgaris [French bean]
ref|XP_009372201.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    379   4e-125   Pyrus x bretschneideri [bai li]
ref|XP_004492269.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    378   5e-125   Cicer arietinum [garbanzo]
gb|EMT25795.1|  70 kDa peptidyl-prolyl isomerase                        379   6e-125   
gb|KHN10949.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              378   7e-125   Glycine soja [wild soybean]
ref|XP_010532918.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    378   7e-125   Tarenaya hassleriana [spider flower]
ref|XP_002883594.1|  peptidylprolyl isomerase                           377   1e-124   
ref|XP_008372538.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    378   2e-124   Malus domestica [apple tree]
ref|XP_009151655.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    377   3e-124   Brassica rapa
ref|XP_008792944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    376   5e-124   Phoenix dactylifera
ref|XP_004975324.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    377   7e-124   Setaria italica
ref|XP_002321107.2|  hypothetical protein POPTR_0014s14690g             375   1e-123   
ref|XP_010482107.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    375   1e-123   Camelina sativa [gold-of-pleasure]
ref|XP_003552100.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    374   1e-123   Glycine max [soybeans]
dbj|BAK01956.1|  predicted protein                                      375   2e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009349114.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    375   2e-123   Pyrus x bretschneideri [bai li]
ref|XP_011000006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    374   3e-123   Populus euphratica
ref|XP_004296967.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    374   3e-123   Fragaria vesca subsp. vesca
ref|XP_006375512.1|  hypothetical protein POPTR_0014s14690g             375   5e-123   
ref|XP_011000005.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    375   6e-123   Populus euphratica
gb|KHN21278.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              368   6e-123   Glycine soja [wild soybean]
ref|XP_008222791.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    373   9e-123   Prunus mume [ume]
gb|ABK95085.1|  unknown                                                 374   9e-123   Populus trichocarpa [western balsam poplar]
ref|XP_010442282.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    373   1e-122   
gb|EMS57053.1|  70 kDa peptidyl-prolyl isomerase                        373   1e-122   Triticum urartu
ref|XP_007222365.1|  hypothetical protein PRUPE_ppa003399mg             373   1e-122   Prunus persica
emb|CDP15134.1|  unnamed protein product                                372   2e-122   Coffea canephora [robusta coffee]
ref|XP_012078436.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    372   2e-122   Jatropha curcas
ref|XP_006297572.1|  hypothetical protein CARUB_v10013595mg             369   3e-122   
gb|AGT17361.1|  peptidylprolyl isomerase                                372   5e-122   Saccharum hybrid cultivar R570
ref|XP_004975323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    375   7e-122   
ref|XP_008382577.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    370   9e-122   
ref|XP_010100792.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         369   1e-121   
ref|XP_002865651.1|  hypothetical protein ARALYDRAFT_494919             369   3e-121   
emb|CDY15104.1|  BnaC03g44650D                                          358   4e-121   Brassica napus [oilseed rape]
ref|XP_006280236.1|  hypothetical protein CARUB_v10026151mg             369   4e-121   Capsella rubella
ref|XP_009406340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    369   6e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001052535.1|  Os04g0352400                                       369   7e-121   
ref|NP_001062292.1|  Os08g0525600                                       369   8e-121   
ref|XP_006659596.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    368   9e-121   Oryza brachyantha
ref|XP_004149324.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    367   1e-120   Cucumis sativus [cucumbers]
gb|EEC83911.1|  hypothetical protein OsI_29964                          368   1e-120   Oryza sativa Indica Group [Indian rice]
emb|CDY15103.1|  BnaC03g44640D                                          367   2e-120   Brassica napus [oilseed rape]
ref|XP_008439052.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    367   3e-120   Cucumis melo [Oriental melon]
ref|XP_011651108.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    367   3e-120   Cucumis sativus [cucumbers]
emb|CDY52281.1|  BnaA03g57740D                                          366   3e-120   Brassica napus [oilseed rape]
gb|AFK48238.1|  unknown                                                 366   4e-120   Lotus japonicus
ref|XP_006418643.1|  hypothetical protein EUTSA_v10002468mg             365   4e-120   Eutrema salsugineum [saltwater cress]
gb|ABK24451.1|  unknown                                                 366   6e-120   Picea sitchensis
ref|XP_010493687.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    365   9e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006358774.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    365   9e-120   Solanum tuberosum [potatoes]
ref|XP_004504385.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    365   1e-119   
ref|XP_004504386.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    365   1e-119   Cicer arietinum [garbanzo]
ref|XP_007034164.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    365   1e-119   
ref|XP_008669632.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    365   1e-119   Zea mays [maize]
ref|XP_007034165.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    363   2e-119   
ref|XP_002436973.1|  hypothetical protein SORBIDRAFT_10g012970          365   2e-119   Sorghum bicolor [broomcorn]
dbj|BAH19789.1|  AT5G48570                                              360   4e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004973965.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    363   4e-119   
gb|KHG01160.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    364   5e-119   Gossypium arboreum [tree cotton]
ref|XP_007034163.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    365   6e-119   
gb|EYU40640.1|  hypothetical protein MIMGU_mgv1a003616mg                363   6e-119   Erythranthe guttata [common monkey flower]
ref|XP_009136108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    362   7e-119   Brassica rapa
ref|XP_007034162.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    364   8e-119   
tpg|DAA48149.1|  TPA: hypothetical protein ZEAMMB73_593378              358   9e-119   
ref|NP_199668.1|  peptidyl-prolyl cis-trans isomerase FKBP65            363   9e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149790.1|  LOC100283417                                       362   1e-118   Zea mays [maize]
ref|XP_003547780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    362   1e-118   Glycine max [soybeans]
gb|KEH20636.1|  peptidyl-prolyl cis-trans isomerase FKBP62-like p...    362   2e-118   Medicago truncatula
gb|KJB71963.1|  hypothetical protein B456_011G150600                    363   2e-118   Gossypium raimondii
gb|KJB71964.1|  hypothetical protein B456_011G150600                    363   2e-118   Gossypium raimondii
ref|XP_003579568.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    363   2e-118   Brachypodium distachyon [annual false brome]
ref|XP_010488634.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    361   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010023594.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    362   3e-118   Eucalyptus grandis [rose gum]
ref|XP_010023593.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    362   5e-118   Eucalyptus grandis [rose gum]
dbj|BAB02082.1|  peptidylprolyl isomerase; FK506-binding protein        360   6e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395163.1|  hypothetical protein EUTSA_v10003906mg             360   7e-118   Eutrema salsugineum [saltwater cress]
gb|AAB82061.1|  rof1                                                    360   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189160.3|  rotamase FKBP 1                                       359   1e-117   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99990.1|  peptidylprolyl isomerase                               360   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466944.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    360   1e-117   Camelina sativa [gold-of-pleasure]
gb|AFK48961.1|  unknown                                                 357   1e-117   Medicago truncatula
ref|XP_004290160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    360   1e-117   Fragaria vesca subsp. vesca
gb|ACJ85592.1|  unknown                                                 357   1e-117   Medicago truncatula
gb|KHN44911.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              360   2e-117   Glycine soja [wild soybean]
gb|KEH22557.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           358   2e-117   Medicago truncatula
ref|NP_001118695.1|  rotamase FKBP 1                                    359   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520990.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    360   2e-117   Glycine max [soybeans]
ref|XP_006652190.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    359   2e-117   
ref|XP_010514063.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    358   6e-117   Camelina sativa [gold-of-pleasure]
ref|XP_004247908.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    358   1e-116   
ref|XP_010685108.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    357   1e-116   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009420312.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    357   2e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC73201.1|  hypothetical protein OsI_07270                          356   8e-116   Oryza sativa Indica Group [Indian rice]
gb|EEE57017.1|  hypothetical protein OsJ_06790                          356   9e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003626943.1|  70 kDa peptidyl-prolyl isomerase                   355   2e-115   Medicago truncatula
emb|CAA68913.1|  peptidylprolyl isomerase                               354   2e-115   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004952509.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    357   3e-115   Setaria italica
ref|XP_008244682.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    353   7e-115   Prunus mume [ume]
ref|XP_007200299.1|  hypothetical protein PRUPE_ppa003471mg             353   7e-115   Prunus persica
ref|NP_001046873.1|  Os02g0491400                                       356   7e-115   
gb|AFK35673.1|  unknown                                                 352   2e-114   Medicago truncatula
tpg|DAA48153.1|  TPA: hypothetical protein ZEAMMB73_593378              349   2e-114   
tpg|DAA48152.1|  TPA: hypothetical protein ZEAMMB73_593378              351   2e-114   
ref|XP_009373610.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    350   5e-114   Pyrus x bretschneideri [bai li]
ref|XP_008352304.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    349   1e-113   Malus domestica [apple tree]
ref|XP_002453845.1|  hypothetical protein SORBIDRAFT_04g019590          351   6e-113   Sorghum bicolor [broomcorn]
ref|XP_003574982.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    348   4e-112   Brachypodium distachyon [annual false brome]
gb|EMS49100.1|  70 kDa peptidyl-prolyl isomerase                        348   6e-112   Triticum urartu
ref|XP_003524915.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    344   2e-111   Glycine max [soybeans]
ref|XP_011084142.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    345   6e-111   Sesamum indicum [beniseed]
ref|XP_010552023.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    342   6e-111   Tarenaya hassleriana [spider flower]
dbj|BAJ95453.1|  predicted protein                                      345   1e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007153782.1|  hypothetical protein PHAVU_003G064500g             342   2e-110   Phaseolus vulgaris [French bean]
ref|XP_006492988.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    341   2e-110   
ref|XP_003574798.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        340   6e-110   Brachypodium distachyon [annual false brome]
gb|EMT24309.1|  70 kDa peptidyl-prolyl isomerase                        341   1e-109   
gb|AFW71473.2|  peptidyl-prolyl isomerase                               340   3e-109   
dbj|BAK02378.1|  predicted protein                                      338   3e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001151484.1|  LOC100285117                                       340   1e-108   Zea mays [maize]
gb|ACN30883.1|  unknown                                                 340   1e-108   Zea mays [maize]
ref|XP_003532733.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    336   3e-108   Glycine max [soybeans]
gb|KHN12365.1|  Peptidyl-prolyl cis-trans isomerase FKBP65              335   4e-108   Glycine soja [wild soybean]
pdb|3JYM|A  Chain A, Crystal Structure Of The 3 Fkbp Domains Of W...    328   8e-108   Triticum aestivum [Canadian hard winter wheat]
sp|Q43207.1|FKB70_WHEAT  RecName: Full=70 kDa peptidyl-prolyl iso...    333   4e-107   Triticum aestivum [Canadian hard winter wheat]
pdb|3JXV|A  Chain A, Crystal Structure Of The 3 Fkbp Domains Of W...    325   8e-107   Triticum aestivum [Canadian hard winter wheat]
gb|EMT19050.1|  70 kDa peptidyl-prolyl isomerase                        326   2e-103   
ref|XP_002977259.1|  hypothetical protein SELMODRAFT_443450             317   4e-101   Selaginella moellendorffii
gb|KJB28026.1|  hypothetical protein B456_005G022600                    303   2e-96    Gossypium raimondii
ref|XP_002992143.1|  hypothetical protein SELMODRAFT_134839             303   2e-95    
ref|XP_002979133.1|  hypothetical protein SELMODRAFT_110584             300   2e-94    
ref|XP_002988507.1|  hypothetical protein SELMODRAFT_183937             300   2e-94    
ref|XP_001769063.1|  predicted protein                                  295   1e-92    
gb|EPS59147.1|  hypothetical protein M569_15662                         279   2e-91    Genlisea aurea
ref|XP_011024591.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    290   5e-91    Populus euphratica
ref|XP_010244430.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    285   4e-89    Nelumbo nucifera [Indian lotus]
ref|XP_006647293.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    284   2e-88    
ref|XP_006380967.1|  hypothetical protein POPTR_0006s03190g             277   7e-86    
ref|XP_011040721.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    276   2e-85    Populus euphratica
gb|KEH19113.1|  peptidyl-prolyl cis-trans isomerase, FKBP-type pr...    272   3e-83    Medicago truncatula
ref|XP_002982601.1|  hypothetical protein SELMODRAFT_445274             270   7e-83    Selaginella moellendorffii
ref|XP_002993334.1|  hypothetical protein SELMODRAFT_449100             270   8e-83    Selaginella moellendorffii
emb|CDY15096.1|  BnaC03g44570D                                          273   9e-83    Brassica napus [oilseed rape]
ref|XP_010273188.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    264   4e-82    
ref|XP_012068190.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    268   9e-82    Jatropha curcas
ref|XP_010273182.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    267   4e-81    Nelumbo nucifera [Indian lotus]
gb|KJB42565.1|  hypothetical protein B456_007G157600                    261   3e-80    Gossypium raimondii
ref|XP_011074339.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    263   1e-79    Sesamum indicum [beniseed]
ref|XP_011074340.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    262   1e-79    Sesamum indicum [beniseed]
ref|XP_006482027.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    260   2e-79    Citrus sinensis [apfelsine]
gb|KDP24694.1|  hypothetical protein JCGZ_26469                         258   2e-79    Jatropha curcas
ref|XP_010061642.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    262   3e-79    Eucalyptus grandis [rose gum]
ref|XP_011079092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    259   4e-79    
gb|KJB53362.1|  hypothetical protein B456_009G2211001                   255   6e-79    Gossypium raimondii
gb|KJB53364.1|  hypothetical protein B456_009G2211001                   254   7e-79    Gossypium raimondii
emb|CBI32825.3|  unnamed protein product                                253   3e-78    Vitis vinifera
ref|XP_010111217.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         257   3e-78    
ref|XP_012087707.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    257   5e-78    Jatropha curcas
ref|XP_006430496.1|  hypothetical protein CICLE_v10011447mg             256   5e-78    
ref|XP_003520475.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    256   8e-78    Glycine max [soybeans]
ref|XP_006472323.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    258   1e-77    Citrus sinensis [apfelsine]
ref|XP_007018460.1|  FKBP-type peptidyl-prolyl cis-trans isomeras...    257   2e-77    
ref|XP_010653645.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    254   2e-77    Vitis vinifera
ref|XP_011017099.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    256   3e-77    Populus euphratica
ref|XP_009596526.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    251   3e-77    
gb|EYU20825.1|  hypothetical protein MIMGU_mgv1a004220mg                254   3e-77    Erythranthe guttata [common monkey flower]
ref|XP_011013750.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    256   3e-77    Populus euphratica
ref|XP_002302401.1|  peptidyl-prolyl cis-trans isomerase FKBP-typ...    255   4e-77    
ref|XP_010673091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    253   8e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009764948.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   1e-76    Nicotiana sylvestris
ref|XP_009596524.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    253   1e-76    Nicotiana tomentosiformis
ref|XP_009596525.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    253   1e-76    Nicotiana tomentosiformis
ref|XP_009764947.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   1e-76    Nicotiana sylvestris
ref|XP_009764944.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    252   3e-76    Nicotiana sylvestris
ref|XP_009764942.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    252   3e-76    Nicotiana sylvestris
ref|XP_009764943.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    252   3e-76    Nicotiana sylvestris
ref|XP_004493326.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    251   5e-76    Cicer arietinum [garbanzo]
ref|XP_009764945.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    251   5e-76    Nicotiana sylvestris
ref|XP_009764949.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    251   6e-76    Nicotiana sylvestris
ref|XP_007162035.1|  hypothetical protein PHAVU_001G118200g             253   7e-76    Phaseolus vulgaris [French bean]
ref|XP_006364803.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    250   2e-75    
ref|XP_006433656.1|  hypothetical protein CICLE_v10003372mg             251   3e-75    Citrus clementina [clementine]
ref|XP_002526205.1|  peptidylprolyl isomerase, putative                 248   4e-75    
gb|KHG02788.1|  Peptidyl-prolyl cis-trans isomerase FKBP65 -like ...    251   5e-75    Gossypium arboreum [tree cotton]
ref|XP_010327744.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    248   5e-75    Solanum lycopersicum
ref|XP_008790247.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    250   1e-74    Phoenix dactylifera
gb|KCW47938.1|  hypothetical protein EUGRSUZ_K01672                     244   1e-74    Eucalyptus grandis [rose gum]
ref|XP_010327743.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    247   2e-74    
emb|CDP01264.1|  unnamed protein product                                248   3e-74    Coffea canephora [robusta coffee]
ref|XP_010926682.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    247   4e-74    Elaeis guineensis
ref|XP_002283423.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase        247   7e-74    Vitis vinifera
ref|XP_010038854.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    245   1e-73    Eucalyptus grandis [rose gum]
ref|XP_010936158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   2e-73    
ref|XP_002947775.1|  hypothetical protein VOLCADRAFT_103560             246   3e-73    Volvox carteri f. nagariensis
ref|XP_007221858.1|  hypothetical protein PRUPE_ppa019344mg             244   6e-73    Prunus persica
ref|XP_010936157.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   6e-73    Elaeis guineensis
gb|KHN25146.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              239   7e-72    Glycine soja [wild soybean]
ref|XP_010090815.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         241   1e-71    Morus notabilis
ref|XP_010096077.1|  Peptidyl-prolyl cis-trans isomerase FKBP65         241   1e-71    Morus notabilis
ref|XP_006363450.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   2e-71    Solanum tuberosum [potatoes]
ref|XP_008352129.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    232   2e-71    
ref|XP_002510075.1|  peptidylprolyl isomerase, putative                 241   3e-71    Ricinus communis
ref|XP_011040722.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    237   4e-71    Populus euphratica
ref|XP_008220384.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    239   4e-71    Prunus mume [ume]
ref|XP_010553660.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    234   1e-70    
gb|KCW48408.1|  hypothetical protein EUGRSUZ_K02110                     235   2e-70    Eucalyptus grandis [rose gum]
ref|XP_006356849.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   4e-70    Solanum tuberosum [potatoes]
ref|XP_009412296.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    238   5e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553659.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase ...    236   2e-69    Tarenaya hassleriana [spider flower]
ref|XP_008778813.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    232   3e-69    
ref|XP_009371078.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    230   1e-68    
ref|XP_004238080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   7e-68    Solanum lycopersicum
ref|XP_001771977.1|  predicted protein                                  230   9e-68    
ref|XP_006857116.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   1e-67    Amborella trichopoda
gb|ERN18583.1|  hypothetical protein AMTR_s00065p00132670               231   1e-67    
gb|AIU40165.1|  peptidyl-prolyl cis-trans isomerase                     225   7e-67    
ref|XP_009360953.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    228   7e-67    
ref|XP_008393705.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    227   2e-66    
gb|KDO52833.1|  hypothetical protein CISIN_1g036950mg                   224   5e-66    
ref|XP_005845726.1|  hypothetical protein CHLNCDRAFT_36304              223   9e-65    
ref|XP_012068191.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    219   9e-64    
ref|XP_010513402.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    219   4e-63    
ref|XP_010249734.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   3e-62    
ref|XP_011397815.1|  Peptidyl-prolyl cis-trans isomerase FKBP62         213   3e-61    
ref|XP_006576767.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    209   3e-60    
gb|KEH40009.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           209   7e-60    
ref|XP_009764360.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    210   8e-60    
gb|KDD74899.1|  FKBP-type peptidyl-prolyl cis-trans isomerase           209   9e-60    
gb|AES59301.2|  FKBP-type peptidyl-prolyl cis-trans isomerase           209   1e-59    
ref|XP_002888213.1|  hypothetical protein ARALYDRAFT_338459             209   1e-59    
ref|XP_009613897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    209   2e-59    
ref|XP_003589050.1|  70 kDa peptidyl-prolyl isomerase                   209   3e-59    
ref|XP_006302078.1|  hypothetical protein CARUB_v10020064mg             207   5e-59    
gb|KDO81460.1|  hypothetical protein CISIN_1g0137552mg                  196   2e-58    
ref|XP_004338843.1|  peptidylprolyl cis-trans isomerase, FKBP-typ...    201   4e-58    
ref|XP_005091067.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   1e-53    
ref|XP_007160929.1|  hypothetical protein PHAVU_001G029000g             191   2e-53    
ref|XP_005091066.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   2e-53    
ref|NP_001036992.1|  FK506-binding protein FKBP59 homologue             189   5e-53    
ref|XP_007160928.1|  hypothetical protein PHAVU_001G029000g             191   5e-53    
ref|XP_009764362.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   5e-53    
ref|XP_005536149.1|  probable peptidylprolyl isomerase                  191   1e-52    
ref|XP_003544491.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   2e-52    
ref|XP_002499621.1|  fkbp-type peptidyl-prolyl cis-trans isomerase      189   3e-52    
emb|CEF99577.1|  Peptidyl-prolyl cis-trans isomerase,FKBP-type,do...    189   4e-52    
ref|XP_009613898.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   4e-52    
ref|XP_011552564.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    183   4e-51    
ref|XP_011552213.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    183   5e-51    
gb|EHJ66575.1|  hypothetical protein KGM_01971                          184   5e-51    
ref|XP_011553509.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    183   6e-51    
ref|XP_008192785.1|  PREDICTED: FK506-binding protein 59                184   6e-51    
gb|KJB53363.1|  hypothetical protein B456_009G2211001                   179   8e-51    
ref|XP_005703171.1|  FK506-binding protein 4/5                          184   1e-50    
ref|XP_011552563.1|  PREDICTED: FK506-binding protein 59-like iso...    183   1e-50    
ref|XP_011552212.1|  PREDICTED: FK506-binding protein 59-like iso...    183   1e-50    
ref|XP_011553508.1|  PREDICTED: FK506-binding protein 59-like iso...    182   2e-50    
ref|XP_011436909.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    181   2e-50    
ref|XP_011436901.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    180   1e-49    
ref|XP_003058204.1|  fkbp-type peptidyl-prolyl cis-trans isomerase      182   1e-49    
ref|XP_011867411.1|  PREDICTED: FK506-binding protein 59 isoform X2     178   2e-49    
ref|XP_002108502.1|  hypothetical protein TRIADDRAFT_51478              178   6e-49    
ref|XP_012068192.1|  PREDICTED: 70 kDa peptidyl-prolyl isomerase-...    179   7e-49    
ref|XP_011867410.1|  PREDICTED: FK506-binding protein 59 isoform X1     177   1e-48    
ref|XP_003550301.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    179   2e-48    
gb|KHN36977.1|  Peptidyl-prolyl cis-trans isomerase FKBP62              179   2e-48    
ref|XP_012143743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    175   3e-48    
ref|XP_006610563.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    175   4e-48    
ref|XP_006563315.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    175   5e-48    
ref|XP_003704657.1|  PREDICTED: FK506-binding protein 59 isoform X1     176   6e-48    
ref|XP_395748.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    175   1e-47    
ref|XP_006610562.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    175   1e-47    
ref|XP_003425066.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    174   2e-47    
emb|CDP06238.1|  unnamed protein product                                172   2e-47    
ref|XP_011269873.1|  PREDICTED: FK506-binding protein 59                174   2e-47    
ref|XP_007244105.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    173   3e-47    
ref|XP_010005403.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    174   3e-47    
ref|XP_005834996.1|  FKBP-type peptidyl-prolyl cis-trans isomerase      175   4e-47    
emb|CDY00829.1|  BnaCnng00290D                                          171   4e-47    
ref|XP_005988495.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    173   6e-47    
ref|XP_011692862.1|  PREDICTED: FK506-binding protein 59 isoform X2     172   6e-47    
ref|XP_011474896.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    172   9e-47    
gb|AAH71516.1|  FK506 binding protein 4                                 172   1e-46    
ref|NP_958877.1|  peptidyl-prolyl cis-trans isomerase FKBP4             172   1e-46    
ref|XP_004925303.1|  PREDICTED: FK506-binding protein 59-like           165   1e-46    
ref|XP_005173673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    172   1e-46    
ref|XP_003690671.1|  PREDICTED: FK506-binding protein 59-like           172   2e-46    
ref|XP_011134873.1|  PREDICTED: FK506-binding protein 59-like iso...    172   2e-46    
sp|Q9XSI2.2|FKBP5_SAGOE  RecName: Full=Peptidyl-prolyl cis-trans ...    171   2e-46    
gb|EAZ12354.1|  hypothetical protein OsJ_02246                          174   2e-46    
ref|XP_005730200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    171   2e-46    
gb|KDR19080.1|  FK506-binding protein 4                                 172   2e-46    
ref|XP_011692859.1|  PREDICTED: FK506-binding protein 59 isoform X1     171   2e-46    
ref|XP_011134875.1|  PREDICTED: FK506-binding protein 59-like iso...    171   2e-46    
ref|XP_007903293.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    171   3e-46    
ref|NP_001043354.1|  Os01g0563000                                       170   3e-46    
ref|XP_004226643.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    171   4e-46    
ref|XP_003489581.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    171   4e-46    
ref|XP_008992594.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    171   5e-46    
emb|CBY23605.1|  unnamed protein product                                169   5e-46    
ref|XP_006789463.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    170   6e-46    
ref|NP_001266943.1|  peptidyl-prolyl cis-trans isomerase FKBP5          170   6e-46    
emb|CBY35372.1|  unnamed protein product                                169   7e-46    
ref|XP_003440636.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    170   7e-46    
ref|XP_004770751.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   8e-46    
gb|EEC70903.1|  hypothetical protein OsI_02450                          165   8e-46    
ref|XP_011495235.1|  PREDICTED: FK506-binding protein 59                170   9e-46    
sp|Q9XT11.2|FKBP5_AOTNA  RecName: Full=Peptidyl-prolyl cis-trans ...    170   9e-46    
ref|XP_003402736.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    170   9e-46    
ref|XP_006739186.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    170   9e-46    
pdb|3O5D|A  Chain A, Crystal Structure Of A Fragment Of Fkbp51 Co...    165   1e-45    
dbj|BAD44999.1|  peptidylprolyl isomerase-like                          169   1e-45    
ref|XP_008297922.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   1e-45    
ref|XP_008691621.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   1e-45    
ref|XP_007254408.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    170   1e-45    
ref|XP_538880.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    169   1e-45    
ref|XP_004770745.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   1e-45    
ref|XP_006633817.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   2e-45    
ref|XP_006633816.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   2e-45    
ref|XP_003463231.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    169   2e-45    
ref|XP_008071742.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   2e-45    
ref|XP_004553313.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   2e-45    
ref|XP_004817385.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   3e-45    
ref|XP_011636239.1|  PREDICTED: FK506-binding protein 59                169   3e-45    
ref|XP_004596393.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   3e-45    
ref|XP_011280550.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   4e-45    
ref|XP_008932530.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   4e-45    
ref|XP_003789178.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   4e-45    
ref|XP_010783544.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   4e-45    
ref|XP_010297653.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    165   5e-45    
ref|XP_003789179.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    168   6e-45    
ref|XP_003737657.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   6e-45    
ref|XP_004817379.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   6e-45    
dbj|BAD44998.1|  peptidylprolyl isomerase-like                          170   6e-45    
ref|XP_004407808.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   7e-45    
ref|NP_001124689.1|  peptidyl-prolyl cis-trans isomerase FKBP5          167   7e-45    
ref|XP_005387173.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   8e-45    
ref|NP_001075779.1|  peptidyl-prolyl cis-trans isomerase FKBP4          167   9e-45    
ref|XP_010180828.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   9e-45    
ref|XP_011366147.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   1e-44    
ref|XP_009565641.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   1e-44    
ref|XP_006923924.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   1e-44    
ref|NP_001084593.1|  FK506 binding protein 4, 59kDa                     167   1e-44    
ref|XP_011157100.1|  PREDICTED: FK506-binding protein 59 isoform X1     166   1e-44    
ref|XP_010014743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   1e-44    
ref|XP_002199016.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   1e-44    
ref|XP_005061551.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   1e-44    
ref|XP_005531080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   1e-44    
ref|XP_005494596.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
gb|ACO09466.1|  FK506-binding protein 4                                 166   2e-44    
ref|XP_006144244.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
gb|AAA86245.1|  FKBP54                                                  166   2e-44    
ref|XP_010573701.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
ref|XP_009636479.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
ref|XP_010573703.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
ref|XP_005513744.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
gb|AAX36739.1|  FK506 binding protein 5                                 166   2e-44    
gb|ERL93953.1|  hypothetical protein D910_11239                         162   2e-44    
ref|XP_005529445.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
emb|CDQ63883.1|  unnamed protein product                                166   2e-44    
ref|XP_005142250.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   2e-44    
ref|XP_003384075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   2e-44    
dbj|BAD96527.1|  FK506 binding protein 5 variant                        166   2e-44    
ref|XP_011590477.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
ref|XP_003202649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
ref|NP_004108.1|  peptidyl-prolyl cis-trans isomerase FKBP5 isofo...    166   2e-44    
ref|XP_003771370.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    166   2e-44    
ref|XP_518427.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    166   2e-44    
ref|XP_004043925.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
gb|KFB39023.1|  AGAP009347-PA-like protein                              166   2e-44    
ref|XP_009894963.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
ref|XP_010135429.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   2e-44    
gb|KHN08915.1|  Peptidyl-prolyl cis-trans isomerase FKBP65              163   3e-44    
gb|AAI11051.1|  FK506 binding protein 5                                 166   3e-44    
ref|XP_005084139.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-44    
ref|XP_010402716.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-44    
gb|ENN71324.1|  hypothetical protein YQE_11984                          163   3e-44    
gb|ELK02594.1|  FK506-binding protein 4                                 166   3e-44    
ref|NP_001182266.1|  peptidyl-prolyl cis-trans isomerase FKBP4          166   3e-44    
pdb|1KT0|A  Chain A, Structure Of The Large Fkbp-like Protein, Fk...    166   3e-44    
ref|XP_008642915.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-44    
ref|XP_003796486.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-44    
ref|XP_011157101.1|  PREDICTED: FK506-binding protein 59 isoform X2     166   3e-44    
ref|XP_007644424.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-44    
ref|XP_005023535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   3e-44    
ref|XP_009463941.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-44    
ref|XP_009096587.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-44    
ref|XP_006180531.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-44    
gb|KFO90341.1|  Peptidyl-prolyl cis-trans isomerase FKBP5               164   4e-44    
ref|XP_006759086.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-44    
ref|XP_001499248.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44    
ref|XP_008528289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44    
pdb|4TW8|A  Chain A, The Fk1-fk2 Domains Of Fkbp52 In Complex Wit...    160   4e-44    
gb|EFB14016.1|  hypothetical protein PANDA_002230                       165   4e-44    
ref|XP_006202142.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44    
ref|XP_006101307.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44    
ref|XP_010582940.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   4e-44    
gb|EFZ19736.1|  hypothetical protein SINV_08536                         166   4e-44    
ref|XP_009665812.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44    
gb|ETN60901.1|  fk506-binding protein                                   165   4e-44    
ref|XP_010149712.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   5e-44    
ref|XP_005881801.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   5e-44    
ref|XP_005429420.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   5e-44    
ref|XP_010947329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   5e-44    
ref|XP_003226528.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   5e-44    
ref|XP_009020007.1|  hypothetical protein HELRODRAFT_185002             165   5e-44    
ref|XP_005492860.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   5e-44    
emb|CAG31642.1|  hypothetical protein RCJMB04_9b10                      162   6e-44    
ref|XP_008109533.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   6e-44    
ref|XP_005492861.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   6e-44    
ref|XP_002914343.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   6e-44    
ref|XP_004424279.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   7e-44    
ref|XP_004869380.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   7e-44    
gb|KFV64423.1|  Peptidyl-prolyl cis-trans isomerase FKBP4               164   7e-44    
tpg|DAA29159.1|  TPA: peptidyl-prolyl cis-trans isomerase FKBP4         165   7e-44    
ref|XP_004624255.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   7e-44    
ref|NP_001005431.1|  peptidyl-prolyl cis-trans isomerase FKBP5          164   8e-44    
ref|XP_011335898.1|  PREDICTED: FK506-binding protein 59                164   8e-44    
ref|XP_001865043.1|  FK506-binding protein 59                           164   8e-44    
ref|XP_006628654.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    166   8e-44    
ref|XP_008547908.1|  PREDICTED: FK506-binding protein 59                164   8e-44    
ref|XP_006276953.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   9e-44    
ref|XP_008310110.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    163   9e-44    
pdb|4LAV|A  Chain A, Crystal Structure Analysis Of Fkbp52, Crysta...    159   9e-44    
ref|XP_007971022.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   9e-44    
ref|XP_006025307.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-43    
ref|XP_004778377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-43    
ref|NP_001006250.1|  peptidyl-prolyl cis-trans isomerase FKBP4          164   1e-43    
ref|NP_001012174.1|  peptidyl-prolyl cis-trans isomerase FKBP5          164   1e-43    
ref|XP_007534316.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-43    
ref|XP_008497681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-43    
ref|NP_001084916.1|  uncharacterized protein LOC431968                  164   1e-43    
ref|XP_007627247.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-43    
ref|NP_001029494.1|  peptidyl-prolyl cis-trans isomerase FKBP4          164   1e-43    
ref|XP_005059495.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   1e-43    
ref|XP_004279047.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-43    



>ref|XP_009602562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=573

 Score =   412 bits (1059),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 206/231 (89%), Positives = 217/231 (94%), Gaps = 3/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+PPAE MD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GWETPE GDEVEVH
Sbjct  3    EDFDIPPAEGMDEDMDLPDD-PIMKVGEEKEIGNQGLKKKLVKEGEGWETPEAGDEVEVH  61

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  62   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  121

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+LAEGEKWENPKD DEV VKYEA 
Sbjct  122  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILAEGEKWENPKDLDEVLVKYEAL  181

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE+GT+V KSD VEFTV++G+FCPAL KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  182  LENGTVVGKSDGVEFTVQDGYFCPALAKAVKTMKKGEKVQLTVKPQYGFGE  232


 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 110/210 (52%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  151  DGGIFKKILAEGEKWENPKDLDEVLVKYEALLENGTVVGKS----DGVEFTVQDGYFCPA  206

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +P NATLQ ++EL+SW  V  + 
Sbjct  207  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPSNATLQINLELVSWKIVSSVT  266

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K         ++ EF  +E 
Sbjct  267  DDKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEE  326

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV TMKKGE   LT+ P+Y FG
Sbjct  327  QVIDGLDRAVMTMKKGEVALLTIAPEYAFG  356


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 8/139 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  268  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEEQ  327

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  328  VIDGLDRAVMTMKKGEVALLTIAPEYAFGSSESKQDLAVIPPNSTVHYEVELVSFVKDKE  387

Query  504  ICKDGGIFKKVLAEGEKWE  560
               D    +K+ A G+K E
Sbjct  388  SW-DMNTPEKIEAAGKKKE  405



>dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum]
Length=573

 Score =   412 bits (1058),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 206/231 (89%), Positives = 217/231 (94%), Gaps = 3/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+PPAE MD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GWETPE GDEVEVH
Sbjct  3    EDFDIPPAEGMDEDMDLPDD-PIMKVGEEKEIGNQGLKKKLVKEGEGWETPEAGDEVEVH  61

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  62   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  121

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+LAEGEKWENPKD DEV VKYEA 
Sbjct  122  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILAEGEKWENPKDFDEVLVKYEAL  181

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE+GT+V KSD VEFTV++G+FCPAL KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  182  LENGTVVGKSDGVEFTVQDGYFCPALAKAVKTMKKGEKVQLTVKPQYGFGE  232


 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 110/210 (52%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  151  DGGIFKKILAEGEKWENPKDFDEVLVKYEALLENGTVVGKS----DGVEFTVQDGYFCPA  206

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +P NATLQ ++EL+SW  V  + 
Sbjct  207  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPSNATLQINLELVSWKIVSSVT  266

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K         ++ EF  +E 
Sbjct  267  DDKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEE  326

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV TMKKGE   LT+ P+Y FG
Sbjct  327  QVIDGLDRAVMTMKKGEVALLTIAPEYAFG  356


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 8/139 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  268  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEEQ  327

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  328  VIDGLDRAVMTMKKGEVALLTIAPEYAFGSSESKQDLAVIPPNSTVHYEVELVSFVKDKE  387

Query  504  ICKDGGIFKKVLAEGEKWE  560
               D    +K+ A G+K E
Sbjct  388  SW-DMNTPEKIEAAGKKKE  405



>ref|XP_004242423.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=574

 Score =   410 bits (1054),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/231 (87%), Positives = 215/231 (93%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            +DF +PP E MD D+DLP+D+  MKVGEEKEIG+QGLKKKLVKEG GWETPEPGDEVEVH
Sbjct  3    DDFGIPPVEGMDEDMDLPEDSSTMKVGEEKEIGNQGLKKKLVKEGEGWETPEPGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+L EGEKWENPKD DEV VKYEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILTEGEKWENPKDLDEVLVKYEAQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE+GT+V KSD VEFTV++GHFCPAL KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  183  LENGTVVGKSDGVEFTVQDGHFCPALAKAVKTMKKGEKVQLTVKPQYGFGE  233


 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 112/210 (53%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDLDEVLVKYEAQLENGTVVGKS----DGVEFTVQDGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKTVSNVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L DGT+  K         ++ EF  +E 
Sbjct  268  DDKKVVKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGESEDNLFEFKTDEE  327

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV TMKKGE   LT+ P+Y FG
Sbjct  328  QVIDGLDRAVMTMKKGEAALLTIAPEYAFG  357


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 8/139 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G LLDGT F      G      F+F   + Q
Sbjct  269  DKKVVKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGESEDNLFEFKTDEEQ  328

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS---PPTIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S++  K+
Sbjct  329  VIDGLDRAVMTMKKGEAALLTIAPEYAFGSSESKQDSAVVPPNSTVHYEVELVSFLKDKE  388

Query  504  ICKDGGIFKKVLAEGEKWE  560
               D    +K+ A G+K E
Sbjct  389  SW-DMSTPEKIEAAGKKKE  406



>ref|XP_009803135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=573

 Score =   409 bits (1051),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 215/231 (93%), Gaps = 3/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE-MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+PPAE MD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GWETPE GDEVEVH
Sbjct  3    EDFDIPPAEGMDEDMDLPDD-PIMKVGEEKEIGNQGLKKKLVKEGEGWETPESGDEVEVH  61

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  62   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  121

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPN TLQFDVELLSW SVKDICKDGGIFKK+LAEGEKWENPKD DEV VKYEA 
Sbjct  122  GSPPTIPPNTTLQFDVELLSWASVKDICKDGGIFKKILAEGEKWENPKDLDEVLVKYEAL  181

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE+GT+V KSD VEFTV++G+FCPAL KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  182  LENGTVVGKSDGVEFTVQDGYFCPALAKAVKTMKKGEKVQLTVKPQYGFGE  232


 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 111/210 (53%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  151  DGGIFKKILAEGEKWENPKDLDEVLVKYEALLENGTVVGKS----DGVEFTVQDGYFCPA  206

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW  V  + 
Sbjct  207  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKIVSSVT  266

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K         ++ EF  +E 
Sbjct  267  DDKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEE  326

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV TMKKGE   LT+ P+Y FG
Sbjct  327  QVIDGLDRAVMTMKKGEVALLTIAPEYAFG  356


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 8/139 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  268  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHDGENEDELFEFKTDEEQ  327

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+
Sbjct  328  VIDGLDRAVMTMKKGEVALLTIAPEYAFGSSESKQDLVVIPPNSTVHYEVELVSFVKDKE  387

Query  504  ICKDGGIFKKVLAEGEKWE  560
               D    +K+ A G+K E
Sbjct  388  SW-DMNTQEKIEAAGKKKE  405



>ref|XP_009787495.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
sylvestris]
Length=570

 Score =   409 bits (1050),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 198/229 (86%), Positives = 213/229 (93%), Gaps = 1/229 (0%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            E FD+P  + +D+DLPD++P+MKVGEEKEIG +GLKKKLVKEG  W+TPEPGDEVEVHYT
Sbjct  3    EGFDIPAMD-EDMDLPDESPIMKVGEEKEIGKEGLKKKLVKEGEKWDTPEPGDEVEVHYT  61

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  62   GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGESGS  121

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+L EGEKWENPKD DEV VKYEARLE
Sbjct  122  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILTEGEKWENPKDLDEVLVKYEARLE  181

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DG+L+ KSD VEF V+EGHFCPA+ KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  182  DGSLIGKSDGVEFAVQEGHFCPAIAKAVKTMKKGEKVQLTVKPQYGFGE  230


 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 110/210 (52%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F + +G     
Sbjct  149  DGGIFKKILTEGEKWENPKDLDEVLVKYEARLEDGSLIGKS----DGVEFAVQEGHFCPA  204

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V  + 
Sbjct  205  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASTDGGAVPPNATLQINLELVSWKTVSSVT  264

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K         D+ EF  +E 
Sbjct  265  DDKKVIKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFLKKGHDGENEDDLFEFKTDEE  324

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV +MKKGE   L +  +Y FG
Sbjct  325  QVIDGLDRAVMSMKKGEVALLIIAAEYAFG  354


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 7/120 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  266  DKKVIKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFLKKGHDGENEDDLFEFKTDEEQ  325

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + +MKKGE  +  I  + A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  326  VIDGLDRAVMSMKKGEVALLIIAAEYAFGSSESKQDLGIVPPNSTVYYEVELVSFVKEKE  385



>ref|XP_009610546.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana 
tomentosiformis]
Length=565

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/229 (86%), Positives = 211/229 (92%), Gaps = 5/229 (2%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDFD+P      +DLPD++P+MKVGEEKEIG QGLKKKLVKEG  W+TPEPGDEVEVHYT
Sbjct  3    EDFDIPA-----MDLPDESPIMKVGEEKEIGKQGLKKKLVKEGEKWDTPEPGDEVEVHYT  57

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  58   GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGESGS  117

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+L EG+KWENPKD DEV VKYEARLE
Sbjct  118  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILTEGDKWENPKDLDEVLVKYEARLE  177

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DG+L+ KSD VEF V+EGHFCPA+ KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  178  DGSLIGKSDGVEFAVQEGHFCPAIAKAVKTMKKGEKVQLTVKPQYGFGE  226


 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 111/210 (53%), Gaps = 18/210 (9%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F + +G     
Sbjct  145  DGGIFKKILTEGDKWENPKDLDEVLVKYEARLEDGSLIGKS----DGVEFAVQEGHFCPA  200

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V  + 
Sbjct  201  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASGDGGAVPPNATLQINLELVSWKTVSSVT  260

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K         D+ EF  +E 
Sbjct  261  DDKKVIKKILKEGEGYEKP-NGAVVKLKLIGKLQDGTVFLKKGHDGENEDDLFEFKTDEE  319

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV +MKKGE   L + P+Y FG
Sbjct  320  QVIDGLDRAVMSMKKGEVALLIIAPEYAFG  349


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 9/139 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  262  DKKVIKKILKEGEGYEKPN-GAVVKLKLIGKLQDGTVFLKKGHDGENEDDLFEFKTDEEQ  320

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + +MKKGE  +  I P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  321  VIDGLDRAVMSMKKGEVALLIIAPEYAFGSSESKQDLGVVPPNSTVYYEVELVSFVKEKE  380

Query  504  ICKDGGIFKKVLAEGEKWE  560
               D    +K+ A G+K E
Sbjct  381  SW-DMNTPEKIEAAGKKKE  398



>ref|XP_006363451.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Solanum tuberosum]
Length=555

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 214/231 (93%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            +DFD+P AE   DD+DLPD++P+MKVGEEKEIG +GLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    DDFDIPGAEGMDDDMDLPDESPIMKVGEEKEIGKEGLKKKLVKEGEGWDTPEAGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKK E  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKAENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPN+TLQFDVELLSWVSVKDICKDGGIFKK+L +GEKWENP D DEV VKYEA+
Sbjct  123  GSPPTIPPNSTLQFDVELLSWVSVKDICKDGGIFKKILTKGEKWENPMDLDEVLVKYEAQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG+LV KSD VEFTV+EGHFCPA+ KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  183  LEDGSLVGKSDGVEFTVQEGHFCPAIAKAVKTMKKGEKVQLTVKPQYGFGE  233


 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 108/210 (51%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ +G  WE P   DEV V Y   L DG+    S       +FT+ +G     
Sbjct  152  DGGIFKKILTKGEKWENPMDLDEVLVKYEAQLEDGSLVGKS----DGVEFTVQEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ  +EL++W +V  + 
Sbjct  208  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASGDGGAVPPNATLQISLELVTWKTVSSVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P     V +K   +L+DGT+  K         ++ EF  +E 
Sbjct  268  DDKKVIKKILKEGEGFEKPNAGAVVKMKLIGKLQDGTVFIKKGHNGENEDELFEFKTDEE  327

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV +MKKGE   L + P Y FG
Sbjct  328  QVIDGLDRAVMSMKKGEVALLIIAPDYAFG  357


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F   + Q
Sbjct  269  DKKVIKKILKEGEGFEKPNAGAVVKMKLIGKLQDGTVFIKKGHNGENEDELFEFKTDEEQ  328

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + +MKKGE  +  I PD A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  VIDGLDRAVMSMKKGEVALLIIAPDYAFGPSESKQDLGVVPPNSTVYYEVELVSFVKEKE  388



>ref|XP_006352668.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
tuberosum]
Length=574

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 212/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDF +PP E   +D+DLPDD+  +KVGEEKEIG+QGLKKKLVKEG GW+TP PGDEVEVH
Sbjct  3    EDFGIPPVEGMNEDMDLPDDSSTLKVGEEKEIGNQGLKKKLVKEGEGWDTPAPGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRG PFKFTLGQGQVIKGWDQGI TMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGDPFKFTLGQGQVIKGWDQGINTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+L EGEKWENPKD DEV VKYEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILTEGEKWENPKDLDEVFVKYEAQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE+GT+V KSD VEFTV++GHFCPAL KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  183  LENGTVVGKSDGVEFTVQDGHFCPALAKAVKTMKKGEKVQLTVKPQYGFGE  233


 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 112/210 (53%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L +GT    S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDLDEVFVKYEAQLENGTVVGKS----DGVEFTVQDGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +PPNATLQ ++EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKTVSNVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L DGT+  K         ++ EF  +E 
Sbjct  268  DDKKVLKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGENEDNLFEFKTDEE  327

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +AV TMKKGE   LT+ P+Y FG
Sbjct  328  QVIDGLDRAVMTMKKGEAALLTIAPEYAFG  357


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 80/139 (58%), Gaps = 8/139 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG----TPFKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G LLDGT F      G      F+F   + Q
Sbjct  269  DKKVLKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGENEDNLFEFKTDEEQ  328

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            VI G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  VIDGLDRAVMTMKKGEAALLTIAPEYAFGSSESKQDLAVVPPNSTVHYEVELVSFVKDKE  388

Query  504  ICKDGGIFKKVLAEGEKWE  560
               D    +K+ A G+K E
Sbjct  389  SW-DMNTPEKIEAAGKKKE  406



>ref|XP_012085200.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Jatropha 
curcas]
 gb|KDP45275.1| hypothetical protein JCGZ_15140 [Jatropha curcas]
Length=572

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/232 (85%), Positives = 213/232 (92%), Gaps = 3/232 (1%)
 Frame = +3

Query  72   EDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            ED D+P  E   MDD+DL D++PV+KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVEV
Sbjct  3    EDLDVPAGEEMMMDDIDLADESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG 
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGA  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L EGEKWENPKD DEV VKYEA
Sbjct  123  SGSPPTIPPNATLQFDVELLSWSSVKDICKDGGVFKKILVEGEKWENPKDLDEVLVKYEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +LEDGT+VAKSD VEFTV+EGHFCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  QLEDGTVVAKSDGVEFTVKEGHFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  153  DGGVFKKILVEGEKWENPKDLDEVLVKYEAQLEDGTVVAKS----DGVEFTVKEGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGNEAAVPPNATLQITLELVSWKTVSEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P D   V +K   +LEDGT+  K       ++ EF  +E   
Sbjct  269  DDKKVIKKILKEGEGYERPNDGSVVKLKLMGKLEDGTVFFKKGHDNEDELFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV +MKKGE   +T+ P+Y FG
Sbjct  329  IDGLDKAVASMKKGEVALVTIAPEYAFG  356


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYERPNDGSVVKLKLMGKLEDGTVFFKKGHDNEDELFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ + +MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+  
Sbjct  330  DGLDKAVASMKKGEVALVTIAPEYAFGSSESKQELAVVPPNSTVYYEVELVSFVKEKESW  389

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  390  -DMNTQEKIEAAGKKKE  405



>ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum 
lycopersicum]
Length=557

 Score =   404 bits (1038),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 215/231 (93%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            +DFD+P AE   DD+DLPD++P+MKVG+EK IG +GLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    DDFDIPGAEGMDDDMDLPDESPIMKVGDEKVIGKEGLKKKLVKEGEGWDTPEAGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDG+KFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGSKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPN+TLQFDVELLSWVSVKDICKDGGIFKK+L +GEKWENPKD DEV VKYEA+
Sbjct  123  GSPPTIPPNSTLQFDVELLSWVSVKDICKDGGIFKKILTKGEKWENPKDLDEVLVKYEAQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG+LV KSD VEFTV+EGHFCPA+ KAVKTMKKGEKVQLTVKPQYGFGE
Sbjct  183  LEDGSLVGKSDGVEFTVQEGHFCPAIAKAVKTMKKGEKVQLTVKPQYGFGE  233


 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 108/210 (51%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ +G  WE P+  DEV V Y   L DG+    S       +FT+ +G     
Sbjct  152  DGGIFKKILTKGEKWENPKDLDEVLVKYEAQLEDGSLVGKS----DGVEFTVQEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE G P +     +PPNA LQ  +EL++W  V  + 
Sbjct  208  IAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASGDGGAVPPNAPLQISLELVTWKIVSSVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--------DIVEFTVEEG  665
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K         ++ EF ++E 
Sbjct  268  DDKKVIKKILKEGEGFEKPNEGAVVKMKLIGKLQDGTVFIKKGHNGENEDELFEFMIDEE  327

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +A  +MKKGE   L + P Y FG
Sbjct  328  QVIDGLDRAAMSMKKGEVALLIIAPDYAFG  357


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 8/139 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP----FKFTLGQGQ  332
            D+ + KK++KEG G+E P  G  V++   G L DGT F      G      F+F + + Q
Sbjct  269  DKKVIKKILKEGEGFEKPNEGAVVKMKLIGKLQDGTVFIKKGHNGENEDELFEFMIDEEQ  328

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKD  503
            VI G D+   +MKKGE  +  I PD A+G S S      +PPN+T+ ++VEL+S+V  K+
Sbjct  329  VIDGLDRAAMSMKKGEVALLIIAPDYAFGLSESKQDLGVVPPNSTVYYEVELVSFVKEKE  388

Query  504  ICKDGGIFKKVLAEGEKWE  560
               D    +K+ A G+K E
Sbjct  389  SW-DMNTQEKIEATGKKKE  406



>ref|XP_002263566.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X1 [Vitis vinifera]
 emb|CBI29552.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 213/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P AE   DD+DLPD++P++KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAAEEMNDDMDLPDESPILKVGEEKEIGKQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GS  TIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EG+KWENPKD DEV VKYEAR
Sbjct  123  GSSTTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIVTEGDKWENPKDLDEVFVKYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGTLVAKSD VEFTV+E +FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTLVAKSDGVEFTVKEDYFCPALSKAVKTMKKGEKVILTVKPQYGFGE  233


 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  WE P+  DEV V Y   L DGT    S       +FT+ +      
Sbjct  152  DGGIFKKIVTEGDKWENPKDLDEVFVKYEARLEDGTLVAKS----DGVEFTVKEDYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I T+ P   +GE G P +     +PPNATL+  +EL+SW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVILTVKPQYGFGEKGKPASGEEGAVPPNATLEITLELVSWKTVTEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K       D+ EF  ++   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEGEDLFEFKTDDEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+   Y FG
Sbjct  328  IDGLDRAVMTMKKGEVALLTIHSDYAFG  355


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F       G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEGEDLFEFKTDDEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ + TMKKGE  + TI  D A+G S S      +PPN+T+ ++VEL S+V  K+  
Sbjct  329  DGLDRAVMTMKKGEVALLTIHSDYAFGSSESSQELAVVPPNSTVYYEVELESFVKDKESW  388

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  389  -DMNTEEKIEAAGKKKE  404



>ref|XP_010647328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X2 [Vitis vinifera]
Length=595

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 213/231 (92%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P AE   DD+DLPD++P++KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAAEEMNDDMDLPDESPILKVGEEKEIGKQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GS  TIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EG+KWENPKD DEV VKYEAR
Sbjct  123  GSSTTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIVTEGDKWENPKDLDEVFVKYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGTLVAKSD VEFTV+E +FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTLVAKSDGVEFTVKEDYFCPALSKAVKTMKKGEKVILTVKPQYGFGE  233


 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  WE P+  DEV V Y   L DGT    S       +FT+ +      
Sbjct  152  DGGIFKKIVTEGDKWENPKDLDEVFVKYEARLEDGTLVAKS----DGVEFTVKEDYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I T+ P   +GE G P +     +PPNATL+  +EL+SW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVILTVKPQYGFGEKGKPASGEEGAVPPNATLEITLELVSWKTVTEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K       D+ EF  ++   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEGEDLFEFKTDDEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+   Y FG
Sbjct  328  IDGLDRAVMTMKKGEVALLTIHSDYAFG  355


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F       G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEGEDLFEFKTDDEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ + TMKKGE  + TI  D A+G S S      +PPN+T+ ++VEL S+V  K+  
Sbjct  329  DGLDRAVMTMKKGEVALLTIHSDYAFGSSESSQELAVVPPNSTVYYEVELESFVKDKE-S  387

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  388  WDMNTEEKIEAAGKKKE  404



>ref|XP_007049647.1| Rotamase FKBP 1 isoform 2 [Theobroma cacao]
 gb|EOX93804.1| Rotamase FKBP 1 isoform 2 [Theobroma cacao]
Length=475

 Score =   397 bits (1020),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/232 (84%), Positives = 211/232 (91%), Gaps = 3/232 (1%)
 Frame = +3

Query  72   EDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            EDFD+P AE    DD+DLPD++P+ KVGEEKEIG QGLKKKLVKEG GWETP+ GDEVEV
Sbjct  3    EDFDIPAAEDMMNDDMDLPDESPIWKVGEEKEIGKQGLKKKLVKEGEGWETPDNGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIK MKKGE  IFTIPP+LAYGE
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKKMKKGENAIFTIPPELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EG+KWE PKD DEV V YEA
Sbjct  123  SGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILIEGDKWETPKDLDEVLVNYEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +LEDGT+VAK+D VEFTV+EGHFCPAL +AVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  KLEDGTVVAKADGVEFTVKEGHFCPALARAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 117/208 (56%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WETP+  DEV V+Y   L DGT       +    +FT+ +G     
Sbjct  153  DGGIFKKILIEGDKWETPKDLDEVLVNYEAKLEDGTVVA----KADGVEFTVKEGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNA+LQ  +EL+SW +V ++ 
Sbjct  209  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNASLQITLELVSWKTVTEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE ++ P +  +V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  269  DDKKVIKKILKEGEGYDRPNEGADVQVKLIGKLQDGTVFLKKGHNEGEELFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE  QLT+ P+Y FG
Sbjct  329  IDGLDRAVMKMKKGEVAQLTIAPEYAFG  356


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G++ P  G +V+V   G L DGT F     + G   F+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYDRPNEGADVQVKLIGKLQDGTVFLKKGHNEGEELFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKDIC  509
             G D+ +  MKKGE    TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+  
Sbjct  330  DGLDRAVMKMKKGEVAQLTIAPEYAFGSSESQQDLGLVPPNSTVYYEVELVSFVKEKESW  389

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  390  -DINTQEKIEAAGKKKE  405



>ref|XP_010247134.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Nelumbo nucifera]
Length=572

 Score =   400 bits (1028),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 210/231 (91%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMPPAE   +D+DLPD++PV+KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPPAEEMNEDMDLPDESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            Y GTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPPDLAYG S
Sbjct  63   YIGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPDLAYGAS  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKDPDEV VKYEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWSSVKDICKDGGIFKKILTEGEKWENPKDPDEVFVKYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE G +V+KSD VEFTV+ G FCPAL KAVKTMKKGEKV LTVKPQY FGE
Sbjct  183  LEGGAVVSKSDGVEFTVKTGFFCPALAKAVKTMKKGEKVLLTVKPQYAFGE  233


 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 110/207 (53%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L  G     S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDPDEVFVKYEAKLEGGAVVSKSDG----VEFTVKTGFFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE G P       IPPN+ LQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYAFGEKGRPACGDEGAIPPNSVLQITLELVSWKTVTEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  + KK+L EGE +E P D   V VK   +L+DGT+  K      +  EF  ++    
Sbjct  268  DDKKVQKKILKEGEGYERPNDGTVVKVKLIGKLQDGTIFLKKGHDEEEPFEFKTDDEQVI  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   +T+ P+YGFG
Sbjct  328  DGLDRAVMTMKKGEVALVTIAPEYGFG  354


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 78/136 (57%), Gaps = 5/136 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ ++KK++KEG G+E P  G  V+V   G L DGT F     D   PF+F     QVI 
Sbjct  269  DKKVQKKILKEGEGYERPNDGTVVKVKLIGKLQDGTIFLKKGHDEEEPFEFKTDDEQVID  328

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ + TMKKGE  + TI P+  +G S S      +PPN+TL ++VE++S+V  K+   
Sbjct  329  GLDRAVMTMKKGEVALVTIAPEYGFGSSESKQQLAVVPPNSTLIYEVEMVSFVKEKESW-  387

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G K E
Sbjct  388  DMNTEEKIEAAGNKKE  403



>ref|XP_010247135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Nelumbo nucifera]
Length=571

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 210/231 (91%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMPPAE   +D+DLPD++PV+KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPPAEEMNEDMDLPDESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            Y GTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPPDLAYG S
Sbjct  63   YIGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPDLAYGAS  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKDPDEV VKYEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWSSVKDICKDGGIFKKILTEGEKWENPKDPDEVFVKYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE G +V+KSD VEFTV+ G FCPAL KAVKTMKKGEKV LTVKPQY FGE
Sbjct  183  LEGGAVVSKSDGVEFTVKTGFFCPALAKAVKTMKKGEKVLLTVKPQYAFGE  233


 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 110/207 (53%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L  G     S       +FT+  G     
Sbjct  152  DGGIFKKILTEGEKWENPKDPDEVFVKYEAKLEGGAVVSKSDG----VEFTVKTGFFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE G P       IPPN+ LQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYAFGEKGRPACGDEGAIPPNSVLQITLELVSWKTVTEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  + KK+L EGE +E P D   V VK   +L+DGT+  K      +  EF  ++    
Sbjct  268  DDKKVQKKILKEGEGYERPNDGTVVKVKLIGKLQDGTIFLKKGHDEEEPFEFKTDDEQVI  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   +T+ P+YGFG
Sbjct  328  DGLDRAVMTMKKGEVALVTIAPEYGFG  354


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 78/136 (57%), Gaps = 5/136 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ ++KK++KEG G+E P  G  V+V   G L DGT F     D   PF+F     QVI 
Sbjct  269  DKKVQKKILKEGEGYERPNDGTVVKVKLIGKLQDGTIFLKKGHDEEEPFEFKTDDEQVID  328

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ + TMKKGE  + TI P+  +G S S      +PPN+TL ++VE++S+V  K+   
Sbjct  329  GLDRAVMTMKKGEVALVTIAPEYGFGSSESKQQLAVVPPNSTLIYEVEMVSFVKEKESW-  387

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G K E
Sbjct  388  DMNTEEKIEAAGNKKE  403



>ref|XP_007049646.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
 gb|EOX93803.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao]
Length=573

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/232 (84%), Positives = 211/232 (91%), Gaps = 3/232 (1%)
 Frame = +3

Query  72   EDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            EDFD+P AE    DD+DLPD++P+ KVGEEKEIG QGLKKKLVKEG GWETP+ GDEVEV
Sbjct  3    EDFDIPAAEDMMNDDMDLPDESPIWKVGEEKEIGKQGLKKKLVKEGEGWETPDNGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIK MKKGE  IFTIPP+LAYGE
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKKMKKGENAIFTIPPELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EG+KWE PKD DEV V YEA
Sbjct  123  SGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILIEGDKWETPKDLDEVLVNYEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +LEDGT+VAK+D VEFTV+EGHFCPAL +AVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  KLEDGTVVAKADGVEFTVKEGHFCPALARAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 117/208 (56%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WETP+  DEV V+Y   L DGT       +    +FT+ +G     
Sbjct  153  DGGIFKKILIEGDKWETPKDLDEVLVNYEAKLEDGTVVA----KADGVEFTVKEGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNA+LQ  +EL+SW +V ++ 
Sbjct  209  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNASLQITLELVSWKTVTEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE ++ P +  +V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  269  DDKKVIKKILKEGEGYDRPNEGADVQVKLIGKLQDGTVFLKKGHNEGEELFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE  QLT+ P+Y FG
Sbjct  329  IDGLDRAVMKMKKGEVAQLTIAPEYAFG  356


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G++ P  G +V+V   G L DGT F     + G   F+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYDRPNEGADVQVKLIGKLQDGTVFLKKGHNEGEELFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKDIC  509
             G D+ +  MKKGE    TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+  
Sbjct  330  DGLDRAVMKMKKGEVAQLTIAPEYAFGSSESQQDLGLVPPNSTVYYEVELVSFVKEKESW  389

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  390  -DINTQEKIEAAGKKKE  405



>ref|XP_011089642.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Sesamum 
indicum]
Length=573

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/230 (85%), Positives = 210/230 (91%), Gaps = 2/230 (1%)
 Frame = +3

Query  75   DFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  248
            DF +PPA    +D+DLP++   MKVGEEKEIG+QGLKKKLVKEG GW+TP+ GDEVEVHY
Sbjct  4    DFGIPPATGLDEDMDLPEETSYMKVGEEKEIGEQGLKKKLVKEGEGWDTPDSGDEVEVHY  63

Query  249  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  428
            TG LLDGTKFDSSRDRG PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESG
Sbjct  64   TGILLDGTKFDSSRDRGEPFTFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESG  123

Query  429  SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
            SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+L EGEKWENPKDPDEV VKYEARL
Sbjct  124  SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILKEGEKWENPKDPDEVLVKYEARL  183

Query  609  EDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ED T++AKSD VEFTV+EGHFCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  184  EDETVIAKSDGVEFTVQEGHFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 116/209 (56%), Gaps = 16/209 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L D T    S       +FT+ +G     
Sbjct  152  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDETVIAKS----DGVEFTVQEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL   +ELLSW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDEEAVPPNATLNIALELLSWKTVSNVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-------SDIVEFTVEEGH  668
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K       +D+ EF V+E  
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTIFVKKGHGDDENDLFEFKVDEEQ  327

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L +AVKTMKKGE   LTV P+Y FG
Sbjct  328  VIEGLDRAVKTMKKGEAALLTVAPEYAFG  356


 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 82/138 (59%), Gaps = 7/138 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F       D    F+F + + QV
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTIFVKKGHGDDENDLFEFKVDEEQV  328

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDI  506
            I+G D+ +KTMKKGE  + T+ P+ A+G S S      +PPN+TL +DVEL+S+V  K+ 
Sbjct  329  IEGLDRAVKTMKKGEAALLTVAPEYAFGSSESQQELARVPPNSTLCYDVELVSFVKEKES  388

Query  507  CKDGGIFKKVLAEGEKWE  560
              D    +K+ A G+K E
Sbjct  389  W-DMDTAEKIEAAGKKKE  405



>gb|KJB42561.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=435

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/231 (85%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L  GEKWENPKDPDEV V YEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTGGEKWENPKDPDEVLVNYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+VAK+D  EFTV EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTVVAKADGKEFTVMEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  268  DDKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVMTMKKGEVALLTIAPEYAFG  355


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (60%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++  K+  
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKDKE-S  387

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  388  WDMNTPEKIEAAGKKKE  404



>gb|KJB42564.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=516

 Score =   395 bits (1016),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/231 (85%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L  GEKWENPKDPDEV V YEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTGGEKWENPKDPDEVLVNYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+VAK+D  EFTV EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTVVAKADGKEFTVMEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  268  DDKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVMTMKKGEVALLTIAPEYAFG  355


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++  K+
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKDKE  386



>gb|KJB08782.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=516

 Score =   395 bits (1016),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 213/233 (91%), Gaps = 3/233 (1%)
 Frame = +3

Query  69   MEDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            MEDFD+P AE    +D+DLPD++P++KVGEEKEIG+QGLKKKLVKEG GWE PE GDEVE
Sbjct  1    MEDFDIPAAEDMMNEDMDLPDESPILKVGEEKEIGNQGLKKKLVKEGEGWEYPEIGDEVE  60

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  IFTIPP LAYG
Sbjct  61   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPALAYG  120

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L EG+KWENPKD DEV + YE
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILIEGDKWENPKDLDEVLINYE  180

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+VAK++ VEFTV++G FCPAL +AVKTMKKGEKV LTVKPQYGFGE
Sbjct  181  AKLEDGTVVAKAEGVEFTVKDGLFCPALARAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++ EG  WE P+  DEV ++Y   L DGT       +    +FT+  G     
Sbjct  152  DGGLFKKILIEGDKWENPKDLDEVLINYEAKLEDGTVVA----KAEGVEFTVKDGLFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNATLLITLELVSWKTVTEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  ++   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   LT+ P+Y FG
Sbjct  328  IEGLDRAVLNMKKGEVALLTIAPEYAFG  355


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     + G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+  
Sbjct  329  EGLDRAVLNMKKGEVALLTIAPEYAFGSSESKQEFAVVPPNSTVYYEVELVSFVKEKE-S  387

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  388  WDLNTQEKIEAAGKKKE  404



>gb|KJB08781.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
 gb|KJB08783.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=572

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 213/233 (91%), Gaps = 3/233 (1%)
 Frame = +3

Query  69   MEDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            MEDFD+P AE    +D+DLPD++P++KVGEEKEIG+QGLKKKLVKEG GWE PE GDEVE
Sbjct  1    MEDFDIPAAEDMMNEDMDLPDESPILKVGEEKEIGNQGLKKKLVKEGEGWEYPEIGDEVE  60

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  IFTIPP LAYG
Sbjct  61   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPALAYG  120

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L EG+KWENPKD DEV + YE
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILIEGDKWENPKDLDEVLINYE  180

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+VAK++ VEFTV++G FCPAL +AVKTMKKGEKV LTVKPQYGFGE
Sbjct  181  AKLEDGTVVAKAEGVEFTVKDGLFCPALARAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++ EG  WE P+  DEV ++Y   L DGT       +    +FT+  G     
Sbjct  152  DGGLFKKILIEGDKWENPKDLDEVLINYEAKLEDGTVVA----KAEGVEFTVKDGLFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNATLLITLELVSWKTVTEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  ++   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   LT+ P+Y FG
Sbjct  328  IEGLDRAVLNMKKGEVALLTIAPEYAFG  355


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     + G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+  
Sbjct  329  EGLDRAVLNMKKGEVALLTIAPEYAFGSSESKQEFAVVPPNSTVYYEVELVSFVKEKE-S  387

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  388  WDLNTQEKIEAAGKKKE  404



>gb|KJB42562.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=563

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/231 (85%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L  GEKWENPKDPDEV V YEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTGGEKWENPKDPDEVLVNYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+VAK+D  EFTV EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTVVAKADGKEFTVMEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  268  DDKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVMTMKKGEVALLTIAPEYAFG  355


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++ VK
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKVK  385



>gb|KJB08784.1| hypothetical protein B456_001G103400 [Gossypium raimondii]
Length=568

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 213/233 (91%), Gaps = 3/233 (1%)
 Frame = +3

Query  69   MEDFDMPPAE---MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            MEDFD+P AE    +D+DLPD++P++KVGEEKEIG+QGLKKKLVKEG GWE PE GDEVE
Sbjct  1    MEDFDIPAAEDMMNEDMDLPDESPILKVGEEKEIGNQGLKKKLVKEGEGWEYPEIGDEVE  60

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  IFTIPP LAYG
Sbjct  61   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPALAYG  120

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L EG+KWENPKD DEV + YE
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILIEGDKWENPKDLDEVLINYE  180

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+VAK++ VEFTV++G FCPAL +AVKTMKKGEKV LTVKPQYGFGE
Sbjct  181  AKLEDGTVVAKAEGVEFTVKDGLFCPALARAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++ EG  WE P+  DEV ++Y   L DGT       +    +FT+  G     
Sbjct  152  DGGLFKKILIEGDKWENPKDLDEVLINYEAKLEDGTVVA----KAEGVEFTVKDGLFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LARAVKTMKKGEKVLLTVKPQYGFGEKGKPATGAEGAVPPNATLLITLELVSWKTVTEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  ++   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   LT+ P+Y FG
Sbjct  328  IEGLDRAVLNMKKGEVALLTIAPEYAFG  355


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     + G   F+F     QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVQVKLIGKLQDGTIFLKKGHNEGEELFEFKTDDEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+S+V  K+  
Sbjct  329  EGLDRAVLNMKKGEVALLTIAPEYAFGSSESKQEFAVVPPNSTVYYEVELVSFVKEKE-S  387

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  388  WDLNTQEKIEAAGKKKE  404



>gb|KJB42563.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=564

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 196/231 (85%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L  GEKWENPKDPDEV V YEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTGGEKWENPKDPDEVLVNYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+VAK+D  EFTV EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTVVAKADGKEFTVMEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  268  DDKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVMTMKKGEVALLTIAPEYAFG  355


 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (60%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++  K+  
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKDKESW  388

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  389  -DMNTPEKIEAAGKKKE  404



>emb|CDP03935.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 210/234 (90%), Gaps = 6/234 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLD-----LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            EDFDMP AE   +      LP+DN  +KVGEEKEIG +GLKKKLVKEG GW+TPE GDEV
Sbjct  3    EDFDMPSAEGMGMGMDDMDLPEDNS-LKVGEEKEIGKEGLKKKLVKEGEGWDTPENGDEV  61

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAY
Sbjct  62   EVHYTGTLLDGTKFDSSRDRGTPFKFPLGQGQVIKGWDQGIKTMKKGENAVFTIPPELAY  121

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+LAEGEKWE+PKD DEV VKY
Sbjct  122  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILAEGEKWEHPKDLDEVLVKY  181

Query  597  EARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EARLEDGT+VAKS  VEFTV+EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  182  EARLEDGTIVAKSVEVEFTVQEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  235


 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 113/209 (54%), Gaps = 16/209 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  154  DGGIFKKILAEGEKWEHPKDLDEVLVKYEARLEDGTIVAKS----VEVEFTVQEGHFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  ++EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPVSGDQGAVPPNATLNINLELVSWKTVSNVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-------DIVEFTVEEGH  668
             D  + KK+L EGE +E P +   V +K   +L+D T+  K        D++EF  +E  
Sbjct  270  DDKKVIKKILKEGEGYEKPNEGAVVKLKLVGKLQDSTVFVKKGYGDDEDDLLEFKTDEEQ  329

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L KAV  MKKGE   LT+ P+Y FG
Sbjct  330  VIEGLDKAVMAMKKGEVALLTIAPEYAFG  358


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 77/138 (56%), Gaps = 7/138 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS---RDRGTPFKFTLGQGQV  335
            D+ + KK++KEG G+E P  G  V++   G L D T F       D     +F   + QV
Sbjct  271  DKKVIKKILKEGEGYEKPNEGAVVKLKLVGKLQDSTVFVKKGYGDDEDDLLEFKTDEEQV  330

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDI  506
            I+G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+Q++ EL+S+V  K+ 
Sbjct  331  IEGLDKAVMAMKKGEVALLTIAPEYAFGSTESQQELAVVPPNSTVQYEAELVSFVKEKES  390

Query  507  CKDGGIFKKVLAEGEKWE  560
              D    +K+ A G+K E
Sbjct  391  W-DMNTQEKIEAAGKKKE  407



>gb|KJB42560.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=422

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/231 (85%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L  GEKWENPKDPDEV V YEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTGGEKWENPKDPDEVLVNYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+VAK+D  EFTV EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTVVAKADGKEFTVMEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  268  DDKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVMTMKKGEVALLTIAPEYAFG  355


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 8/133 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD--  503
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++ V    
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKVSGSV  388

Query  504  -ICKDGGIFKKVL  539
             +CK  G   K+ 
Sbjct  389  CLCKFFGCVSKLF  401



>gb|KHG19334.1| Peptidyl-prolyl cis-trans isomerase FKBP62 -like protein [Gossypium 
arboreum]
Length=564

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/231 (84%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L  GEKWENPKDPD+V V YEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTGGEKWENPKDPDKVLVNYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+VAK+D  EFTV EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTVVAKADGKEFTVMEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  D+V V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDKVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAGGAEGAVPPNATLQITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  268  DDKKVMKKILKEGEGYERPNEGAVVKVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVMTMKKGEVALLTIAPEYAFG  355


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (60%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVKVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ + TMKKGE  + TI P+ A+G S S     ++PPN+T+ ++VE++S++  K+  
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSESKQELASVPPNSTVYYEVEMVSFIKDKESW  388

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  389  -DMNTPEKIEAAGKKKE  404



>gb|KDO40263.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=577

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40268.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=492

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40262.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=567

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>ref|XP_006437244.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 gb|ESR50484.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=559

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAFVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAFVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KJB42559.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=589

 Score =   395 bits (1016),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 196/231 (85%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E   DD+DLP D P +KVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVH
Sbjct  3    EDFDIPLVEDVNDDIDLPGDVPTLKVGEEKEIGKQGLKKKLVKEGEGWENPETGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFALGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L  GEKWENPKDPDEV V YEA+
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTGGEKWENPKDPDEVLVNYEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+VAK+D  EFTV EGHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LEDGTVVAKADGKEFTVMEGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  233


 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  152  DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  268  DDKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVMTMKKGEVALLTIAPEYAFG  355


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 94/171 (55%), Gaps = 16/171 (9%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  269  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK---  500
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++ V    
Sbjct  329  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKVSGSV  388

Query  501  ------DICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS  635
                    C + G    +L + E W +   P+++    + + E+G ++ KS
Sbjct  389  CLCKFFGCCINSGFGNLLLQDKESW-DMNTPEKIEAAGKKK-EEGNVLFKS  437



>gb|KDO40267.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=496

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40265.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=572

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+   K+  
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSFEKEKESW  388

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  389  -DMNTEEKIEAAGKKKE  404



>ref|XP_006437245.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
 ref|XP_006484806.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Citrus 
sinensis]
 gb|ESR50485.1| hypothetical protein CICLE_v10031088mg [Citrus clementina]
Length=572

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAFVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAFVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>gb|KDO40264.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=562

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=574

 Score =   394 bits (1013),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/233 (84%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFD+P   EM   DD+DL D +P++KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVE
Sbjct  3    EDFDIPAGDEMMMNDDVDLGDQSPILKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
             SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV V +E
Sbjct  123  ASGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVLVNFE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+VAKSD VEF V+EGHFCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  183  AQLEDGTVVAKSDGVEFAVKEGHFCPALAKAVKTMKKKEKVLLTVKPQYGFGE  235


 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 113/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V++   L DGT    S       +F + +G     
Sbjct  154  DGGIFKKILVEGEKWENPKDLDEVLVNFEAQLEDGTVVAKS----DGVEFAVKEGHFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKKEKVLLTVKPQYGFGEKGKPASNGEGAVPPNATLQITLELVSWKTVSEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P D   V +K   +L+DGT+  K       ++ EFT +E   
Sbjct  270  DDKKVMKKILKEGEGYERPNDGSLVKLKLIGKLQDGTVFLKKGHDNEEELFEFTTDEEQV  329

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +T+ P+Y FG
Sbjct  330  IEGLDRAVLAMKKGEVALVTIAPEYAFG  357


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 80/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+FT  + QVI
Sbjct  271  DKKVMKKILKEGEGYERPNDGSLVKLKLIGKLQDGTVFLKKGHDNEEELFEFTTDEEQVI  330

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+  
Sbjct  331  EGLDRAVLAMKKGEVALVTIAPEYAFGASESKQELAVIPPNSTVYYEVELVSFVKEKESW  390

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  391  -DMNTQEKIEAAGKKKE  406



>gb|KDO40266.1| hypothetical protein CISIN_1g008113mg [Citrus sinensis]
Length=557

 Score =   394 bits (1011),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 207/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A EMD D+DLPDD P+MKVGEEKEIG+QGLKKKLVKEG GW+TPE GDEVEVH
Sbjct  3    EDFDIPAANEMDADMDLPDDAPMMKVGEEKEIGNQGLKKKLVKEGEGWDTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDR TPFKFTLGQG VIKGWD GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRSTPFKFTLGQGNVIKGWDIGIKTMKKGENAVFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV V YEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVNYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +V K+D VEFTV++GHFCP L KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  LEDGMVVGKADGVEFTVKDGHFCPTLAKAVKTMKKGEKVLLAVKPQYGFGE  233


 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V+Y   L DG        +    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVLVNYEARLEDGMVVG----KADGVEFTVKDGHFCPT  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE     SG+   +PPNATLQ  +EL+SW +V +I 
Sbjct  208  LAKAVKTMKKGEKVLLAVKPQYGFGEKGKSASGNEGAVPPNATLQIALELVSWKTVSEIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EG+ +E P +   V VK   +L+DGT+  K        + EF  +E   
Sbjct  268  DDKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKK E   LT+ P+Y FG
Sbjct  328  IDGLDRAVITMKKNEVALLTIAPEYAFG  355


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGDGFERPNEGAVVKVKLIGKLQDGTVFVKKGHSEEEQLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G + S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVITMKKNEVALLTIAPEYAFGSAESQQELAVVPPNSTVHYEVELVSF  381



>ref|XP_002534361.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF28026.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=583

 Score =   392 bits (1007),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/233 (84%), Positives = 209/233 (90%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFD+P   EM   DD+DL D +P++KVGEEKEIG QGLKKKLVKEG GW+TP+ GDEVE
Sbjct  3    EDFDIPAGDEMMMNDDVDLGDQSPILKVGEEKEIGKQGLKKKLVKEGEGWDTPDNGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
             SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV V +E
Sbjct  123  ASGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVLVNFE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+VAKSD VEF V+EGHFCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  183  AQLEDGTVVAKSDGVEFAVKEGHFCPALAKAVKTMKKKEKVLLTVKPQYGFGE  235


 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 113/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V++   L DGT    S       +F + +G     
Sbjct  154  DGGIFKKILVEGEKWENPKDLDEVLVNFEAQLEDGTVVAKS----DGVEFAVKEGHFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKKEKVLLTVKPQYGFGEKGKPASNGEGAVPPNATLQITLELVSWKTVSEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P D   V +K   +L+DGT+  K       ++ EFT +E   
Sbjct  270  DDKKVMKKILKEGEGYERPNDGSLVKLKLIGKLQDGTVFLKKGHDNEEELFEFTTDEEQV  329

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +T+ P+Y FG
Sbjct  330  IEGLDRAVLAMKKGEVALVTIAPEYAFG  357


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 80/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+FT  + QVI
Sbjct  271  DKKVMKKILKEGEGYERPNDGSLVKLKLIGKLQDGTVFLKKGHDNEEELFEFTTDEEQVI  330

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+V  K+  
Sbjct  331  EGLDRAVLAMKKGEVALVTIAPEYAFGASESKQELAVIPPNSTVYYEVELVSFVKEKE-S  389

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  390  WDMNTQEKIEAAGKKKE  406



>gb|EYU39186.1| hypothetical protein MIMGU_mgv1a003614mg [Erythranthe guttata]
Length=574

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 193/232 (83%), Positives = 208/232 (90%), Gaps = 3/232 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            +DFDMP A   MD D+DLP+ +  MKVG+EKEIG QGLKKKLVKEG GW+TP+ GDEV V
Sbjct  3    DDFDMPAAAEGMDEDMDLPEGSNFMKVGDEKEIGSQGLKKKLVKEGEGWDTPDNGDEVAV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTL+DGTKFDSSRDRG PF FTLGQGQVIKGWD GIKTMKKGE  IFTIP +LAYGE
Sbjct  63   HYTGTLVDGTKFDSSRDRGEPFTFTLGQGQVIKGWDLGIKTMKKGENAIFTIPAELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+L EGEKWENPKDPDEV VKYE 
Sbjct  123  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILKEGEKWENPKDPDEVFVKYEV  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +L+DGT+V+KSD VEFTVEEGHFCPAL+KAVKTMKKGE V LTVKPQYGFGE
Sbjct  183  KLDDGTVVSKSDGVEFTVEEGHFCPALSKAVKTMKKGEAVLLTVKPQYGFGE  234


 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 116/209 (56%), Gaps = 16/209 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+ +G     
Sbjct  153  DGGIFKKILKEGEKWENPKDPDEVFVKYEVKLDDGTVV--SKSDGV--EFTVEEGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL   +EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEAVLLTVKPQYGFGEKGKPASDGDGAVPPNATLNITLELVSWKTVSNVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-------SDIVEFTVEEGH  668
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K       +D+ EF V+E  
Sbjct  269  DDKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHGDDENDLFEFKVDEEQ  328

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L KAV  MKKGE   L + P+Y FG
Sbjct  329  VIEGLDKAVIAMKKGEVALLKIAPEYAFG  357


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 78/138 (57%), Gaps = 7/138 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F       D    F+F + + QV
Sbjct  270  DKKVVKKILKEGEGYEKPNEGAVVKLKLIGKLQDGTVFIKKGHGDDENDLFEFKVDEEQV  329

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDI  506
            I+G D+ +  MKKGE  +  I P+ A+G S S      +PPN+T+ ++ EL+S+V  K+ 
Sbjct  330  IEGLDKAVIAMKKGEVALLKIAPEYAFGSSESKQELAIVPPNSTVYYEAELVSFVKDKES  389

Query  507  CKDGGIFKKVLAEGEKWE  560
              D    +K+ A G+K E
Sbjct  390  W-DMNTEEKIEAAGKKKE  406



>ref|XP_008778812.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779082.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Phoenix 
dactylifera]
Length=578

 Score =   389 bits (998),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/234 (82%), Positives = 210/234 (90%), Gaps = 5/234 (2%)
 Frame = +3

Query  72   EDFDMPPAEMDDL-DLPDD----NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            EDFD+P  E + + DLP+D    +P++KVGEEKEIG QGLKKKL+KEG GWETPE GDEV
Sbjct  3    EDFDLPAGEEEMMNDLPNDDYEPHPILKVGEEKEIGRQGLKKKLLKEGQGWETPEVGDEV  62

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTLLDG+KFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAY
Sbjct  63   EVHYTGTLLDGSKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAY  122

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKW+NPKD DEV V Y
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWDNPKDRDEVLVNY  182

Query  597  EARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EARLEDGT+++KSD VEFTV++G+FCPAL+KAVKTMKKGEKV L VKPQY FGE
Sbjct  183  EARLEDGTVISKSDGVEFTVKDGYFCPALSKAVKTMKKGEKVLLAVKPQYAFGE  236


 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 110/207 (53%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V+Y   L DGT    S       +FT+  G     
Sbjct  155  DGGIFKKILVEGEKWDNPKDRDEVLVNYEARLEDGTVISKS----DGVEFTVKDGYFCPA  210

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GE G   +     +PPNATL  ++EL+SW +V +I 
Sbjct  211  LSKAVKTMKKGEKVLLAVKPQYAFGEKGRAASGDEGAVPPNATLDVELELISWKTVTEIG  270

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE ++ P D   V VK   +LEDGT+  K      +  EF  +E    
Sbjct  271  DDKKILKKILKEGEGYQRPNDGAVVKVKLIGKLEDGTVFVKKGHDEEEPFEFKTDEEQVI  330

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L + V TMKKGE   +T+ P+Y F 
Sbjct  331  EGLDRTVVTMKKGELALVTIPPEYAFS  357


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G++ P  G  V+V   G L DGT F     D   PF+F   + QVI+G D+ + TMK
Sbjct  282  EGEGYQRPNDGAVVKVKLIGKLEDGTVFVKKGHDEEEPFEFKTDEEQVIEGLDRTVVTMK  341

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            KGE  + TIPP+ A+  + S      +PPN+T+ ++VEL+S+
Sbjct  342  KGELALVTIPPEYAFSSTESKQDLAVVPPNSTVYYEVELVSF  383



>ref|XP_002301809.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
 gb|EEE81082.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa]
Length=575

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 210/235 (89%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA-EM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            EDF++P   EM     D LDLPD+ P++KVGEEKEIG+QGLKKKL+KEG GW+TP+ GDE
Sbjct  3    EDFELPTGDEMMMNNGDQLDLPDEGPMLKVGEEKEIGNQGLKKKLLKEGEGWDTPDNGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP DLA
Sbjct  63   VEVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPADLA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YG SGSPPTIPPNATLQFDVELLSW S+KDICKDGGIFKK+L EGEKWENPKD DEV V+
Sbjct  123  YGSSGSPPTIPPNATLQFDVELLSWSSIKDICKDGGIFKKILVEGEKWENPKDLDEVLVR  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA+LEDG+++A+SD VEFTV++GHFCPAL +AVKTMK GEKV LTVKPQYGFGE
Sbjct  183  YEAQLEDGSVIARSDGVEFTVKDGHFCPALARAVKTMKMGEKVLLTVKPQYGFGE  237


 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 112/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG    S   R    +FT+  G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVLVRYEAQLEDG----SVIARSDGVEFTVKDGHFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMK GE  + T+ P   +GE G P +     +PPNA +Q  +EL++W +V ++ 
Sbjct  212  LARAVKTMKMGEKVLLTVKPQYGFGEKGKPASGDESAVPPNANIQITLELVAWKTVTEVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  + KK+L EG+ ++ P +   V VK   +L+DGT+  K     S++ EF  +E    
Sbjct  272  DDKKVIKKILKEGDGYDRPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVI  331

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   LT+ P+Y FG
Sbjct  332  DGLDRAVSTMKKGELALLTIAPEYAFG  358


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK++KEG G++ P  G  V+V   G L DGT F    +D    F+F   + QVI 
Sbjct  273  DKKVIKKILKEGDGYDRPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVID  332

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ +++EL+S+
Sbjct  333  GLDRAVSTMKKGELALLTIAPEYAFGSSESQQELAVVPPNSTVCYEIELVSF  384



>ref|XP_007134161.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
 gb|ESW06155.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris]
Length=574

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 207/233 (89%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM--DDLDLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            +DFDMPPA+   DD +   D   PV+KVGEEKEIG QGLKKKL+KEG GW TPE GDEV+
Sbjct  3    DDFDMPPADSMNDDFNFGGDLETPVLKVGEEKEIGQQGLKKKLLKEGEGWNTPEVGDEVQ  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFGFTLGQGQVIKGWDQGIVTMKKGENALFTIPAELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK++ EGEKWENPKD DEV V YE
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKIVTEGEKWENPKDLDEVLVNYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGTLVAKSD VEFTVE+G+FCPAL+KAVKTMKKGEKV L+VKPQYGFGE
Sbjct  183  ARLEDGTLVAKSDGVEFTVEDGYFCPALSKAVKTMKKGEKVILSVKPQYGFGE  235


 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK+V EG  WE P+  DEV V+Y   L DGT    S       +FT+  G     
Sbjct  154  DGGLFKKIVTEGEKWENPKDLDEVLVNYEARLEDGTLVAKS----DGVEFTVEDGYFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I ++ P   +GE G P       +PPNA+L+  +EL+SW +V D+ 
Sbjct  210  LSKAVKTMKKGEKVILSVKPQYGFGEKGKPAHGDEGAVPPNASLEITLELVSWKTVSDVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGTL  K       ++ EF  +E   
Sbjct  270  DDKKVIKKILKEGEGYERPNEGAVVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQV  329

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P+YGFG
Sbjct  330  IDGLDRAVLTMKKGEVALLTIAPEYGFG  357


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F      D G  F+F   + QVI
Sbjct  271  DKKVIKKILKEGEGYERPNEGAVVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQVI  330

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+  +G S S      +P N+TL ++VEL+S+
Sbjct  331  DGLDRAVLTMKKGEVALLTIAPEYGFGSSESQQELAVVPSNSTLYYEVELVSF  383



>ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cicer 
arietinum]
Length=577

 Score =   387 bits (994),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLP----DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            EDFD+P  E   DD D      D+N ++KVGEEKEIG QGLKKKL+KEG  WETP+ GDE
Sbjct  3    EDFDIPATEPMNDDFDFAGVGDDENLILKVGEEKEIGKQGLKKKLIKEGEAWETPDVGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            V+VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LA
Sbjct  63   VQVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPAELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L EGEKWENPKDPDEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILKEGEKWENPKDPDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA L+DGTLVAKSD VEF V++GHFCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  YEACLDDGTLVAKSDGVEFAVKDGHFCPALSKAVKTMKKGEKVILTVKPQYGFGE  237


 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 113/209 (54%), Gaps = 16/209 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++KEG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  156  DGGLFKKILKEGEKWENPKDPDEVFVKYEACLDDGTLVAKS----DGVEFAVKDGHFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  212  LSKAVKTMKKGEKVILTVKPQYGFGEKGKPAHGDEGAVPPNATLQIALELVSWKTVSEVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-------SDIVEFTVEEGH  668
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K       +D+ EF  +E  
Sbjct  272  DDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHSDDEADLFEFKTDEEQ  331

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L +AV TMKKGE   LT+ P+Y FG
Sbjct  332  VIDGLDRAVMTMKKGEVASLTIAPEYAFG  360


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 79/138 (57%), Gaps = 7/138 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  335
            D+ + KK++KEG G+E P  G  V++   G L DGT F     S D    F+F   + QV
Sbjct  273  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHSDDEADLFEFKTDEEQV  332

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDI  506
            I G D+ + TMKKGE    TI P+ A+G S S      +PPN+TL +++EL+S+V  K+ 
Sbjct  333  IDGLDRAVMTMKKGEVASLTIAPEYAFGSSESQKELAVVPPNSTLYYELELVSFVKDKES  392

Query  507  CKDGGIFKKVLAEGEKWE  560
              D    +K+ A G+K E
Sbjct  393  W-DMNTEEKIEAAGKKKE  409



>ref|XP_010036768.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW48406.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=574

 Score =   386 bits (991),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 208/234 (89%), Gaps = 5/234 (2%)
 Frame = +3

Query  72   EDFDMPPA-EMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            EDFD+PPA EM++     D+    PVMK G+EKEIG QGLKKKLVKEG  WETP+ GDEV
Sbjct  4    EDFDIPPADEMNEDFDLPDDDDDAPVMKAGDEKEIGKQGLKKKLVKEGDAWETPDNGDEV  63

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAY
Sbjct  64   EVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAY  123

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GE+GSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VKY
Sbjct  124  GEAGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVLVKY  183

Query  597  EARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            E +LEDGT +A+SD VEFTV+EGHFCPA+ KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  184  EVQLEDGTTIARSDGVEFTVKEGHFCPAVAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 116/208 (56%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    +R  G   +FT+ +G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVLVKYEVQLEDGTTI--ARSDGV--EFTVKEGHFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  212  VAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDEGAVPPNATLQITLELVSWKTVSEVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ +F ++E   
Sbjct  272  DDKKVIKKILKEGEGYERPNEGAVVEVKLIGKLQDGTVFVKKGHDDSEELFKFKIDEEQV  331

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV  MKKGE   LTV P+Y FG
Sbjct  332  VDGLDKAVMNMKKGEVALLTVAPEYAFG  359


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  VEV   G L DGT F      D    FKF + + QV+
Sbjct  273  DKKVIKKILKEGEGYERPNEGAVVEVKLIGKLQDGTVFVKKGHDDSEELFKFKIDEEQVV  332

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ +  MKKGE  + T+ P+ A+G S S      +PP++T+ ++VEL+S+V  K+  
Sbjct  333  DGLDKAVMNMKKGEVALLTVAPEYAFGSSESKQDLAVVPPSSTVYYEVELVSFVKDKESW  392

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  393  -DMNTEEKIEAAGKKKE  408



>ref|XP_011622061.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X1 [Amborella trichopoda]
Length=593

 Score =   387 bits (993),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/231 (84%), Positives = 208/231 (90%), Gaps = 3/231 (1%)
 Frame = +3

Query  75   DFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  248
            DF +P A EM+ D DL DD+P +KVGEEKEIG +GLKKKLV EG+GWETPE GDEVEVHY
Sbjct  16   DFGIPDAGEMNEDFDLSDDSPALKVGEEKEIGKEGLKKKLVNEGSGWETPENGDEVEVHY  75

Query  249  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  428
            TGTLLDGT+FDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG SG
Sbjct  76   TGTLLDGTQFDSSRDRGAPFKFKLGQGQVIKGWDQGIKTMKKGEKAIFTIPPELAYGASG  135

Query  429  SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
            S PTIPPNATLQFDVELLSW SVKDICKDGGIFKK+LAEGEKWENPKD DEV VKYE RL
Sbjct  136  SEPTIPPNATLQFDVELLSWSSVKDICKDGGIFKKILAEGEKWENPKDLDEVLVKYEVRL  195

Query  609  -EDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             EDGT+V+KS+ VEFTV+EG+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  196  EEDGTIVSKSEGVEFTVKEGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  246


 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL-DGTKFDSSRDRGTPFKFTLGQGQVIK  341
            D G+ KK++ EG  WE P+  DEV V Y   L  DGT    S+  G   +FT+ +G    
Sbjct  164  DGGIFKKILAEGEKWENPKDLDEVLVKYEVRLEEDGTIV--SKSEGV--EFTVKEGYFCP  219

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPP------TIPPNATLQFDVELLSWVSVKD  503
               + +KTMKKGE  + T+ P   +GE G          +P NATL   +EL+SW +V +
Sbjct  220  ALSKAVKTMKKGEKVLLTVKPQYGFGEKGGEACGEEGAAVPSNATLHVTLELVSWKTVSE  279

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHF  671
            +  D  + KKVL EGE++E P D   V VK+  +L DGT+  +        EF   E   
Sbjct  280  VTDDKKVLKKVLKEGERYEKPNDGAVVKVKFTGKLLDGTVFVQKGSDEKPFEFMTGEEQV  339

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV +MKKGE   +T+ P+Y F 
Sbjct  340  IEGLDRAVMSMKKGEVALVTISPEYAFS  367


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKK  374
            EG  +E P  G  V+V +TG LLDGT F        PF+F  G+ QVI+G D+ + +MKK
Sbjct  293  EGERYEKPNDGAVVKVKFTGKLLDGTVFVQKGSDEKPFEFMTGEEQVIEGLDRAVMSMKK  352

Query  375  GECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            GE  + TI P+ A+    +      +P N+T+Q+D+EL+S+   K+
Sbjct  353  GEVALVTISPEYAFSSVNTQQDLAVVPANSTVQYDLELMSFAKEKE  398



>ref|XP_006840897.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 isoform 
X2 [Amborella trichopoda]
 gb|ERN02572.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda]
Length=592

 Score =   387 bits (993),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/231 (84%), Positives = 208/231 (90%), Gaps = 3/231 (1%)
 Frame = +3

Query  75   DFDMPPA-EMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  248
            DF +P A EM+ D DL DD+P +KVGEEKEIG +GLKKKLV EG+GWETPE GDEVEVHY
Sbjct  16   DFGIPDAGEMNEDFDLSDDSPALKVGEEKEIGKEGLKKKLVNEGSGWETPENGDEVEVHY  75

Query  249  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  428
            TGTLLDGT+FDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG SG
Sbjct  76   TGTLLDGTQFDSSRDRGAPFKFKLGQGQVIKGWDQGIKTMKKGEKAIFTIPPELAYGASG  135

Query  429  SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
            S PTIPPNATLQFDVELLSW SVKDICKDGGIFKK+LAEGEKWENPKD DEV VKYE RL
Sbjct  136  SEPTIPPNATLQFDVELLSWSSVKDICKDGGIFKKILAEGEKWENPKDLDEVLVKYEVRL  195

Query  609  -EDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             EDGT+V+KS+ VEFTV+EG+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  196  EEDGTIVSKSEGVEFTVKEGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  246


 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL-DGTKFDSSRDRGTPFKFTLGQGQVIK  341
            D G+ KK++ EG  WE P+  DEV V Y   L  DGT    S+  G   +FT+ +G    
Sbjct  164  DGGIFKKILAEGEKWENPKDLDEVLVKYEVRLEEDGTIV--SKSEGV--EFTVKEGYFCP  219

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPP------TIPPNATLQFDVELLSWVSVKD  503
               + +KTMKKGE  + T+ P   +GE G          +P NATL   +EL+SW +V +
Sbjct  220  ALSKAVKTMKKGEKVLLTVKPQYGFGEKGGEACGEEGAAVPSNATLHVTLELVSWKTVSE  279

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHF  671
            +  D  + KKVL EGE++E P D   V VK+  +L DGT+  +        EF   E   
Sbjct  280  VTDDKKVLKKVLKEGERYEKPNDGAVVKVKFTGKLLDGTVFVQKGSDEKPFEFMTGEEQV  339

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV +MKKGE   +T+ P+Y F 
Sbjct  340  IEGLDRAVMSMKKGEVALVTISPEYAFS  367


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKK  374
            EG  +E P  G  V+V +TG LLDGT F        PF+F  G+ QVI+G D+ + +MKK
Sbjct  293  EGERYEKPNDGAVVKVKFTGKLLDGTVFVQKGSDEKPFEFMTGEEQVIEGLDRAVMSMKK  352

Query  375  GECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            GE  + TI P+ A+    +      +P N+T+Q+D+EL+S+   K+
Sbjct  353  GEVALVTISPEYAFSSVNTQQDLAVVPANSTVQYDLELMSFAKEKE  398



>ref|XP_010905157.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Elaeis 
guineensis]
Length=573

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 207/233 (89%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            +DFD+P   EM   D +D  D++PV+KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVE
Sbjct  3    DDFDLPAGDEMMNEDAMDFADESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPEVGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV VKYE
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVKYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+++KS+ VEFTV++G FCPAL KAVKTMKK EKV LTVKPQY FGE
Sbjct  183  ARLEDGTVISKSEGVEFTVKDGFFCPALAKAVKTMKKSEKVLLTVKPQYAFGE  235


 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  154  DGGIIKKILKEGEKWENPKDLDEVLVKYEARLEDGTVI--SKSEGV--EFTVKDGFFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I 
Sbjct  210  LAKAVKTMKKSEKVLLTVKPQYAFGEKGRPASGDESAVPPNATLNVELELVSWKTVSEIG  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  I KKVL EGE +E P D   V+VK   +L+DGT+  K         EF  +E    
Sbjct  270  DDKKILKKVLKEGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEEQVI  329

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   +T+  +Y FG
Sbjct  330  EGLDRAVITMKKGEVAYITIPHEYAFG  356


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 82/140 (59%), Gaps = 6/140 (4%)
 Frame = +3

Query  156  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  329
            EIGD + + KK++KEG G+E P  G  V V   G L DGT F     D   PF+F   + 
Sbjct  267  EIGDDKKILKKVLKEGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEE  326

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
            QVI+G D+ + TMKKGE    TIP + A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  327  QVIEGLDRAVITMKKGEVAYITIPHEYAFGSAESKQDLAVVPPNSTVIYEVELVSFVKEK  386

Query  501  DICKDGGIFKKVLAEGEKWE  560
            +   D    +K+ A G+K E
Sbjct  387  ESW-DMNNAEKIEAAGKKKE  405



>ref|XP_010036767.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW48407.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis]
Length=576

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 208/234 (89%), Gaps = 5/234 (2%)
 Frame = +3

Query  72   EDFDMPPA-EMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            EDFD+PPA EM++     D+    PVMK G+EKEIG QGLKKKLVKEG  WETP+ GDEV
Sbjct  4    EDFDIPPADEMNEDFDLPDDDDDAPVMKAGDEKEIGKQGLKKKLVKEGDAWETPDNGDEV  63

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAY
Sbjct  64   EVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAY  123

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GE+GSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VKY
Sbjct  124  GEAGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVLVKY  183

Query  597  EARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            E +LEDGT +A+SD VEFTV+EGHFCPA+ KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  184  EVQLEDGTTIARSDGVEFTVKEGHFCPAVAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 116/208 (56%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    +R  G   +FT+ +G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVLVKYEVQLEDGTTI--ARSDGV--EFTVKEGHFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATLQ  +EL+SW +V ++ 
Sbjct  212  VAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDEGAVPPNATLQITLELVSWKTVSEVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ +F ++E   
Sbjct  272  DDKKVIKKILKEGEGYERPNEGAVVEVKLIGKLQDGTVFVKKGHDDSEELFKFKIDEEQV  331

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV  MKKGE   LTV P+Y FG
Sbjct  332  VDGLDKAVMNMKKGEVALLTVAPEYAFG  359


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  VEV   G L DGT F      D    FKF + + QV+
Sbjct  273  DKKVIKKILKEGEGYERPNEGAVVEVKLIGKLQDGTVFVKKGHDDSEELFKFKIDEEQVV  332

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ +  MKKGE  + T+ P+ A+G S S      +PP++T+ ++VEL+S+V  K+  
Sbjct  333  DGLDKAVMNMKKGEVALLTVAPEYAFGSSESKQDLAVVPPSSTVYYEVELVSFVKDKESW  392

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  393  -DMNTEEKIEAAGKKKE  408



>ref|XP_010905156.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Elaeis 
guineensis]
Length=574

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 207/233 (89%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            +DFD+P   EM   D +D  D++PV+KVGEEKEIG QGLKKKLVKEG GW+TPE GDEVE
Sbjct  3    DDFDLPAGDEMMNEDAMDFADESPVLKVGEEKEIGKQGLKKKLVKEGEGWDTPEVGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV VKYE
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICKDGGIIKKILKEGEKWENPKDLDEVLVKYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+++KS+ VEFTV++G FCPAL KAVKTMKK EKV LTVKPQY FGE
Sbjct  183  ARLEDGTVISKSEGVEFTVKDGFFCPALAKAVKTMKKSEKVLLTVKPQYAFGE  235


 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  154  DGGIIKKILKEGEKWENPKDLDEVLVKYEARLEDGTVI--SKSEGV--EFTVKDGFFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I 
Sbjct  210  LAKAVKTMKKSEKVLLTVKPQYAFGEKGRPASGDESAVPPNATLNVELELVSWKTVSEIG  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  I KKVL EGE +E P D   V+VK   +L+DGT+  K         EF  +E    
Sbjct  270  DDKKILKKVLKEGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEEQVI  329

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   +T+  +Y FG
Sbjct  330  EGLDRAVITMKKGEVAYITIPHEYAFG  356


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 82/140 (59%), Gaps = 6/140 (4%)
 Frame = +3

Query  156  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  329
            EIGD + + KK++KEG G+E P  G  V V   G L DGT F     D   PF+F   + 
Sbjct  267  EIGDDKKILKKVLKEGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEE  326

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
            QVI+G D+ + TMKKGE    TIP + A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  327  QVIEGLDRAVITMKKGEVAYITIPHEYAFGSAESKQDLAVVPPNSTVIYEVELVSFVKEK  386

Query  501  DICKDGGIFKKVLAEGEKWE  560
            +   D    +K+ A G+K E
Sbjct  387  ESW-DMNNAEKIEAAGKKKE  405



>ref|XP_009410619.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=549

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/230 (82%), Positives = 204/230 (89%), Gaps = 2/230 (1%)
 Frame = +3

Query  72   EDFDMPPAEMDD--LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  E +   +D PDD P +KVGEEKE+G QGLKKKLVKEG+GWETPE GDEVEVH
Sbjct  4    EDFDIPGGEEEAAMMDPPDDGPALKVGEEKEVGKQGLKKKLVKEGSGWETPEVGDEVEVH  63

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG+S
Sbjct  64   YTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYGQS  123

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV V YEAR
Sbjct  124  GSPPTIPPNATLQFDVELLSWCSVKDICKDGGIFKKILKEGEKWENPKDLDEVLVTYEAR  183

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            LEDGT+++KS+ VEFTV+ G FCPAL KAVKTMKK E+V LTVKPQY FG
Sbjct  184  LEDGTVISKSEGVEFTVKNGFFCPALAKAVKTMKKAERVLLTVKPQYAFG  233


 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 111/206 (54%), Gaps = 14/206 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGIFKKILKEGEKWENPKDLDEVLVTYEARLEDGTVISKSEG----VEFTVKNGFFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P  A+G  G P +     +PPNATL  ++EL+SW +V +I 
Sbjct  209  LAKAVKTMKKAERVLLTVKPQYAFGGKGRPASGDEGAVPPNATLCIELELISWKTVTEIG  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I KK L EGE ++ P +   V+VK   +L+DGT+  K      +  EF  +E    
Sbjct  269  DDRKIIKKTLKEGEGYQKPNEGAVVTVKLIGKLQDGTVFVKKGHDEQEPFEFKSDEEQVI  328

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGF  752
              L +AV +MKKGE   +T+ P+Y F
Sbjct  329  EGLDQAVMSMKKGEIALVTIPPEYAF  354


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 6/140 (4%)
 Frame = +3

Query  156  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  329
            EIGD + + KK +KEG G++ P  G  V V   G L DGT F     D   PF+F   + 
Sbjct  266  EIGDDRKIIKKTLKEGEGYQKPNEGAVVTVKLIGKLQDGTVFVKKGHDEQEPFEFKSDEE  325

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
            QVI+G DQ + +MKKGE  + TIPP+ A+  + S      +P N+T+ ++VEL+S+V  K
Sbjct  326  QVIEGLDQAVMSMKKGEIALVTIPPEYAFSFTESKQELAVVPANSTVIYEVELVSFVKEK  385

Query  501  DICKDGGIFKKVLAEGEKWE  560
            +   D    +K+ A G+K E
Sbjct  386  ESW-DMNTAEKIEAAGKKKE  404



>ref|XP_011024590.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=575

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 188/235 (80%), Positives = 208/235 (89%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA-EM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            EDF++P   EM     D LDLPD+ P++KVGEEKEIG+QGLKKKL+KEG GW+TP+ GDE
Sbjct  3    EDFELPTGDEMMMNNDDQLDLPDEGPMLKVGEEKEIGNQGLKKKLLKEGEGWDTPDNGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP DLA
Sbjct  63   VEVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPADLA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YG SGS PTIPPNATLQFDVELLSW S+KDICKDGGIFKK+L EGEK ENPKD DEV V+
Sbjct  123  YGSSGSAPTIPPNATLQFDVELLSWSSIKDICKDGGIFKKILVEGEKLENPKDLDEVLVR  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEARLEDG++VA+SD VEFTV+ GHFCPAL +AVKTMK+GEKV LTVKPQYGFGE
Sbjct  183  YEARLEDGSVVARSDGVEFTVKNGHFCPALARAVKTMKEGEKVLLTVKPQYGFGE  237


 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG   E P+  DEV V Y   L DG    S   R    +FT+  G     
Sbjct  156  DGGIFKKILVEGEKLENPKDLDEVLVRYEARLEDG----SVVARSDGVEFTVKNGHFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMK+GE  + T+ P   +GE G P +     +PPNA +Q  +EL++W +V ++ 
Sbjct  212  LARAVKTMKEGEKVLLTVKPQYGFGEKGKPASGDESAVPPNANIQITLELVAWKTVTEVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  + KK+L EG  +E P +   V VK   +L+DGT+  K     S++ EF  +E    
Sbjct  272  DDKKVIKKILKEGNGYERPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVI  331

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV TMKKGE   LT+ P+Y FG
Sbjct  332  DGLDKAVTTMKKGELALLTIAPEYAFG  358


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK++KEG G+E P  G  V+V   G L DGT F    +D    F+F   + QVI 
Sbjct  273  DKKVIKKILKEGNGYERPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVID  332

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ +++EL+S+
Sbjct  333  GLDKAVTTMKKGELALLTIAPEYAFGSSESQQELAVVPPNSTVFYEIELVSF  384



>gb|KJB37902.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=451

 Score =   379 bits (974),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  YEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKSDG----VEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCP  677
            KD  + KK++ EGE +E P D   V VK   +L DGT+  K        EF ++E     
Sbjct  272  KDKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAVKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKAVKTMKKGENALITIQPEYAFG  357


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>gb|KJB37904.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=559

 Score =   383 bits (984),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  YEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCP  677
            KD  + KK++ EGE +E P D   V VK   +L DGT+  K        EF ++E     
Sbjct  272  KDKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAVKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKAVKTMKKGENALITIQPEYAFG  357


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++ E  SW
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYE-EKESW  382



>gb|KJB37903.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=476

 Score =   380 bits (976),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  YEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 115/206 (56%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKSDG----VEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            KD  + KK++ EGE +E P D   V VK   +L DGT+  K     +  EF ++E     
Sbjct  272  KDKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAVKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKAVKTMKKGENALITIQPEYAFG  357


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 94/185 (51%), Gaps = 23/185 (12%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+   +
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE-SWE  391

Query  516  GGIFKKVLAEGEKWENPK-------------DPDEVSVKYEARLEDGTLVAKSDIVEFTV  656
                +K+ A G+K E                DPD   VK E R      V K  I E+  
Sbjct  392  MDTPQKIEAAGKKKEEGNALFKADIKKALEIDPDNRDVKLEYR------VLKEKIKEYNK  445

Query  657  EEGHF  671
             +  F
Sbjct  446  RDAQF  450



>ref|XP_009385667.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDD-----LDLPDDN-PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            E+FDMP  +M       +DLPDD+ PV+KVGEEKEIG QGLKKKLVKEG GW+TPE GDE
Sbjct  3    EEFDMPTEDMMGDPNGMMDLPDDDAPVLKVGEEKEIGKQGLKKKLVKEGDGWDTPEVGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNA LQFDVELLSW S+KDICKDGGI KK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNAILQFDVELLSWSSIKDICKDGGIIKKILKEGEKWENPKDLDEVLVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEARLEDGT+++KSD VEFTV++G FCPAL KAVKTMKK EKV LTV+PQY FGE
Sbjct  183  YEARLEDGTVISKSDGVEFTVKDGFFCPALAKAVKTMKKAEKVLLTVRPQYAFGE  237


 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 110/207 (53%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  156  DGGIIKKILKEGEKWENPKDLDEVLVKYEARLEDGTVISKS----DGVEFTVKDGFFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P  A+GE G   +     +PPNA+LQ ++EL SW +V +I 
Sbjct  212  LAKAVKTMKKAEKVLLTVRPQYAFGEKGRSASGDECAVPPNASLQVELELFSWKTVTEIG  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I KK+L EGE +E P D   V VK   +L+DGT+  K      +  EF  +E    
Sbjct  272  DDKKILKKILKEGEGYERPNDGAVVRVKLIGKLQDGTVFVKKGHDDQEPFEFKTDEEQVI  331

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L + V TMKKGE   +T+ P+Y F 
Sbjct  332  DGLDRTVTTMKKGEIALVTIPPEYAFS  358


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 4/107 (4%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G+E P  G  V V   G L DGT F     D   PF+F   + QVI G D+ + TMK
Sbjct  283  EGEGYERPNDGAVVRVKLIGKLQDGTVFVKKGHDDQEPFEFKTDEEQVIDGLDRTVTTMK  342

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            KGE  + TIPP+ A+  +GS      +PPNAT+ +++EL+S+V  K+
Sbjct  343  KGEIALVTIPPEYAFSSTGSKQDLAVVPPNATVVYEIELVSFVKEKE  389



>ref|XP_008458076.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
melo]
Length=553

 Score =   383 bits (983),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 204/231 (88%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMP--PAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P  P   DDLDLPD+   +KVGEEKEIG QGLKKKL+KEG GW TPE GDEVEVH
Sbjct  3    EDFDIPAAPDMADDLDLPDETVALKVGEEKEIGSQGLKKKLLKEGEGWVTPENGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKK E  +FTIPPDLAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKNEKALFTIPPDLAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPP+ATLQFDVELLSW SVKDICKDGGIFKK+L EG+KW+NPKD DEV V +EA+
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVKDICKDGGIFKKILTEGDKWDNPKDLDEVLVNFEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGTLVAK+D VEFTV +G+FCPAL KAVKTMK GEK  LTVKPQYGFGE
Sbjct  183  LEDGTLVAKADGVEFTVADGYFCPALAKAVKTMKLGEKALLTVKPQYGFGE  233


 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 107/208 (51%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V++   L DGT       +    +FT+  G     
Sbjct  152  DGGIFKKILTEGDKWDNPKDLDEVLVNFEAKLEDGTLVA----KADGVEFTVADGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMK GE  + T+ P   +GE G         +PPNA+L   +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKLGEKALLTVKPQYGFGEKGKSACGNEGAVPPNASLDITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P D   V VK   +L DG +  +       +  EF  +E   
Sbjct  268  PDKKVIKKILKEGEGYEKPNDGAIVKVKLIGKLGDGKIFLRKGHDDGEEPFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVVTMKKGEIALLTIAPEYAFG  355


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGT-PFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DG  F     D G  PF+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYEKPNDGAIVKVKLIGKLGDGKIFLRKGHDDGEEPFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+++
Sbjct  329  DGLDKAVVTMKKGEIALLTIAPEYAFGSSESQQDLAVVPPNSTVYYEVELVAF  381



>gb|KJB37905.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=568

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  YEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCP  677
            KD  + KK++ EGE +E P D   V VK   +L DGT+  K        EF ++E     
Sbjct  272  KDKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAVKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKAVKTMKKGENALITIQPEYAFG  357


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>gb|KJB37901.1| hypothetical protein B456_006G225400 [Gossypium raimondii]
Length=567

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKKLVKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKLVKEGEGWENPSSGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  YEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCP  677
            KD  + KK++ EGE +E P D   V VK   +L DGT+  K        EF ++E     
Sbjct  272  KDKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAVKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKAVKTMKKGENALITIQPEYAFG  357


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK+VKEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  273  DKKVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGTIFIKKGYDEEPFEFKIDEEQVIDG  332

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>ref|XP_010550903.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Tarenaya 
hassleriana]
Length=549

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 208/233 (89%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            +DF MPP      ++LD   DD P++KVGEEKEI +QGLKKKL KEG G+ETPE GDEVE
Sbjct  3    DDFQMPPVGGMNGEELDFGGDDVPILKVGEEKEI-EQGLKKKLAKEGEGYETPENGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTL+DGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYG
Sbjct  62   VHYTGTLMDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPPELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELLSWVSVKDICKDGG+FKK+LAEGEKWENPKDPDEV VKY+
Sbjct  122  ESGSPPTIPANATLQFDVELLSWVSVKDICKDGGVFKKILAEGEKWENPKDPDEVLVKYK  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+VAKSD VEFTV++GHFC A  KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  182  ARLEDGTVVAKSDGVEFTVKDGHFCLAFAKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAEGEKWENPKDPDEVLVKYKARLEDGTVVAKS----DGVEFTVKDGHFCLA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
            + + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ D+EL+SW +V +I 
Sbjct  209  FAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDDGAVPPNATLEIDLELVSWKTVSEIT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       +  EF  +E   
Sbjct  269  DDKKVMKKILKEGEGYERPNEGATVRVKLIGKLQDGTVFLKKGHGEDEEPFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +T++P+Y FG
Sbjct  329  IDGLDRAVMKMKKGEVALVTIEPEYAFG  356


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DKKVMKKILKEGEGYERPNEGATVRVKLIGKLQDGTVFLKKGHGEDEEPFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G S S      +PPN+T+ ++VELLS+
Sbjct  330  DGLDRAVMKMKKGEVALVTIEPEYAFGSSESKQELAVVPPNSTVYYEVELLSF  382



>gb|KHF97531.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=567

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 191/235 (81%), Positives = 207/235 (88%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DF+ P A   E D++D+P+D+PV   +KVGEEKEIG  GLKKK+VKEG GWE P  GDE
Sbjct  3    DDFEFPTASNMEEDEMDIPEDDPVSPILKVGEEKEIGKNGLKKKVVKEGEGWENPSSGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIP +LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPAELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  YEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 113/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P T     +PPNATL   +EL+SW SV DI 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEDGRPATGGECAVPPNATLHITLELVSWKSVSDIT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCP  677
            KD  + KK++ EGE +E P D   V VK   +L DG +  K        EF ++E     
Sbjct  272  KDKRVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGKIFTKKGYDEEPFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAVKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKAVKTMKKGENALITIQPEYAFG  357


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK+VKEG G+E P  G  V+V   G L DG  F        PF+F + + QVI G
Sbjct  273  DKRVLKKIVKEGEGYERPNDGTVVQVKLIGKLPDGKIFTKKGYDEEPFEFKIDEEQVIDG  332

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             D+ +KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+
Sbjct  333  LDKAVKTMKKGENALITIQPEYAFGSSESHQELAVVPANSTVYYEVEMVSFVKEKE  388



>emb|CDX86295.1| BnaA06g30120D [Brassica napus]
Length=573

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/238 (80%), Positives = 206/238 (87%), Gaps = 7/238 (3%)
 Frame = +3

Query  66   IMEDFDMP----PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            + +DFDM      AE  DLDL DD   +P +KVGEEKEIG  GLKKKLVKEG  W+TPE 
Sbjct  1    MADDFDMEIPAEEAEEMDLDLEDDAESDPSLKVGEEKEIGKSGLKKKLVKEGEKWDTPES  60

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP
Sbjct  61   GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDMGIKTMKKGENAVFTIPP  120

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGE+GSPPTIPPNATLQFDVELLSW SVKDIC DGG+FKKV+AEGEKWE PKD DEV
Sbjct  121  ELAYGETGSPPTIPPNATLQFDVELLSWRSVKDICGDGGLFKKVIAEGEKWEKPKDLDEV  180

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEARLEDGT+V +SD  EFTV++GHFCPA+ KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  181  YVKYEARLEDGTVVGRSDGAEFTVKDGHFCPAIAKAVKTMKRGEKVLLTVKPQYGFGE  238


 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 112/210 (53%), Gaps = 16/210 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+  G    
Sbjct  156  GDGGLFKKVIAEGEKWEKPKDLDEVYVKYEARLEDGTVVG----RSDGAEFTVKDGHFCP  211

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE+G   +      +PPNATLQ D+EL+SW +V +
Sbjct  212  AIAKAVKTMKRGEKVLLTVKPQYGFGETGRAASDGIQAAVPPNATLQMDLELVSWKTVVE  271

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEG  665
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K       +  EF  +E 
Sbjct  272  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEDEEPFEFKTDEE  331

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L KAV  MKKGE   +T+  +Y FG
Sbjct  332  QVIEGLEKAVMGMKKGEVALITISAEYAFG  361


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 89/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  278
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  260  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  314

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  449
                +   PF+F   + QVI+G ++ +  MKKGE  + TI  + A+G S S      IPP
Sbjct  315  KGHGEDEEPFEFKTDEEQVIEGLEKAVMGMKKGEVALITISAEYAFGSSESKQELAVIPP  374

Query  450  NATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
            ++T+ ++VEL+S++  K+   D    +K+ A G+K E
Sbjct  375  DSTVCYEVELVSFIKEKESW-DMNTQEKIEAAGKKKE  410



>emb|CDX85348.1| BnaC07g26590D [Brassica napus]
Length=570

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/235 (80%), Positives = 207/235 (88%), Gaps = 4/235 (2%)
 Frame = +3

Query  66   IMEDFDMP-PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            + +DFDM  PAE  DLDL DD   +P +KVGEEKEIG  GLKKKLVKEG  W+TPE GDE
Sbjct  1    MADDFDMEIPAEEMDLDLEDDAESDPSLKVGEEKEIGKSGLKKKLVKEGEKWDTPESGDE  60

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP+LA
Sbjct  61   VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDMGIKTMKKGENAVFTIPPELA  120

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGE+GSPPTIP NATLQFDVELLSW SVKDIC DGG+FKK++AEGEKWE PKD DEV VK
Sbjct  121  YGETGSPPTIPANATLQFDVELLSWRSVKDICGDGGLFKKIIAEGEKWEKPKDLDEVYVK  180

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEARLEDGT+V +S+ VEFTV++GHFCPA+ KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  181  YEARLEDGTVVGRSEGVEFTVKDGHFCPAIAKAVKTMKRGEKVLLTVKPQYGFGE  235


 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 112/210 (53%), Gaps = 16/210 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+  G    
Sbjct  153  GDGGLFKKIIAEGEKWEKPKDLDEVYVKYEARLEDGTVVG----RSEGVEFTVKDGHFCP  208

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP------PTIPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE+G P        IPPN TLQ D+EL+SW ++ +
Sbjct  209  AIAKAVKTMKRGEKVLLTVKPQYGFGETGRPVSDGVQAAIPPNVTLQIDLELVSWKTMVE  268

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEG  665
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K       +  EF  +E 
Sbjct  269  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEDEEPFEFKTDEE  328

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L KAV  MKKGE   +T+ P+Y FG
Sbjct  329  QVIEGLEKAVMGMKKGEVALITISPEYAFG  358


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F      +   PF+F   + QVI
Sbjct  272  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHGEDEEPFEFKTDEEQVI  331

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGS---PPTIPPNATLQFDVELLSWVSVKD  503
            +G ++ +  MKKGE  + TI P+ A+G S S   P  IPP +T+ ++ EL+S++  K+
Sbjct  332  EGLEKAVMGMKKGEVALITISPEYAFGSSESKQEPAVIPPGSTVCYEAELVSFIKEKE  389



>ref|XP_008794657.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=573

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/233 (82%), Positives = 204/233 (88%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPA-EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFD+    EM   D +D  D++PV+KVGEEKEIG QGLKKKLVKEG  W+TPE GDEVE
Sbjct  3    EDFDLRAGDEMMNEDAMDFADESPVLKVGEEKEIGKQGLKKKLVKEGEVWDTPEVGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV  KYE
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICKDGGIIKKILKEGEKWENPKDLDEVLAKYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+++KS+ VEFTV++G FCPAL KAVKTMKK EKV LTVKPQY FGE
Sbjct  183  ARLEDGTVISKSEGVEFTVKDGFFCPALAKAVKTMKKAEKVLLTVKPQYAFGE  235


 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV   Y   L DGT    S       +FT+  G     
Sbjct  154  DGGIIKKILKEGEKWENPKDLDEVLAKYEARLEDGTVISKSEG----VEFTVKDGFFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I 
Sbjct  210  LAKAVKTMKKAEKVLLTVKPQYAFGEKGRPASGDEGAVPPNATLNVELELVSWKTVTEIG  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  I KK+L EGE +E P +   V+VK   +L+DGT+  K         EF  +E    
Sbjct  270  DDKKILKKILKEGEGYERPNEGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEEQAI  329

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   +T+ P+Y F 
Sbjct  330  EGLDRAVITMKKGEVACITIPPEYAFS  356


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 70/126 (56%), Gaps = 5/126 (4%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G+E P  G  V V   G L DGT F     D   PF+F   + Q I+G D+ + TMK
Sbjct  281  EGEGYERPNEGAVVTVKLIGKLQDGTVFVKKGYDDEAPFEFKTDEEQAIEGLDRAVITMK  340

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLA  542
            KGE    TIPP+ A+  + S      IPPN+T+ ++VEL+S++  K+   D    +K+ A
Sbjct  341  KGEVACITIPPEYAFSSTESKQDLAVIPPNSTVIYEVELVSFLKEKESW-DMNNAEKIEA  399

Query  543  EGEKWE  560
             G+K E
Sbjct  400  AGKKKE  405



>ref|XP_010547132.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=573

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 207/237 (87%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAE-MDDLDLPDDN-------PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDFD+P AE M+D ++   +       P MKVGEEKEIG QGLKKKLVKEG GW+TP+ G
Sbjct  3    EDFDLPAAEEMNDEEMDFADDVDADVAPYMKVGEEKEIGKQGLKKKLVKEGEGWDTPDNG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKK E  +FTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKRENVVFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIPPNA LQFDVELLSWVSVKDIC+DGGIFKKV+ EGEKWENPKD DEV 
Sbjct  123  LAYGESGSPPTIPPNAMLQFDVELLSWVSVKDICRDGGIFKKVVVEGEKWENPKDLDEVL  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLEDGT+V KSD VEFT++EGHFC AL KAVKTMKKGEKV L+VKPQYGFGE
Sbjct  183  VKYEARLEDGTVVGKSDGVEFTLKEGHFCTALGKAVKTMKKGEKVLLSVKPQYGFGE  239


 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 113/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  WE P+  DEV V Y   L DGT    S       +FTL +G     
Sbjct  158  DGGIFKKVVVEGEKWENPKDLDEVLVKYEARLEDGTVVGKS----DGVEFTLKEGHFCTA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI-----PPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + ++ P   +GESG P  +     PPNATLQ D+EL+SW +V ++ 
Sbjct  214  LGKAVKTMKKGEKVLLSVKPQYGFGESGKPAAVGEAAVPPNATLQIDLELVSWKTVSEVT  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE ++ P D   V VK   +L+DGT+  K       +  EF  +E   
Sbjct  274  DDKKVIKKILKEGEGYDRPNDGAVVKVKLLGKLQDGTVFLKKGHGEGEEPFEFKTDEEQV  333

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   LT+ PQY FG
Sbjct  334  IEGLDRAVMNMKKGEVTLLTIAPQYAFG  361


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (57%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G++ P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  275  DKKVIKKILKEGEGYDRPNDGAVVKVKLLGKLQDGTVFLKKGHGEGEEPFEFKTDEEQVI  334

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ +  MKKGE  + TI P  A+G S S      +PPN+T+ F+VEL+S+V  K+  
Sbjct  335  EGLDRAVMNMKKGEVTLLTIAPQYAFGSSESQQELDVVPPNSTVYFEVELVSFVKEKESW  394

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G K E
Sbjct  395  -DMNTQEKIEAAGRKKE  410



>ref|XP_007140683.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 ref|XP_007140684.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12677.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
 gb|ESW12678.1| hypothetical protein PHAVU_008G133100g [Phaseolus vulgaris]
Length=544

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 203/229 (89%), Gaps = 6/229 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDF++P  E  ++DL +    +KVGEE+EIG  GLKKKL+KEG GWETPE GDEV+VHYT
Sbjct  3    EDFNIPGGE--EMDLGE----VKVGEEREIGSNGLKKKLLKEGQGWETPEVGDEVKVHYT  56

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDS+RDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGTKFDSNRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKDPDEV VKYEA LE
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILTEGEKWENPKDPDEVLVKYEAHLE  176

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DG LV KSD VEFTV EGH+CPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  177  DGKLVGKSDGVEFTVREGHYCPALSKAVKTMKKGEKVVLTVKPQYGFGE  225


 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  144  DGGIFKKILTEGEKWENPKDPDEVLVKYEAHLEDGKLVGKS----DGVEFTVREGHYCPA  199

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNA+L+  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVVLTVKPQYGFGEKGKPAQGEEGAVPPNASLEITLELVSWKTVSEVT  259

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV------AKSDIVEFTVEEGHF  671
             D  + KK++ EGE +E P +   V VK   +L+DGT         +  + EF  +E   
Sbjct  260  DDKKVIKKIVKEGEGYERPNEGASVKVKLIGKLQDGTAFLSKGHDGEEKLFEFKTDEEQV  319

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT++P+Y FG
Sbjct  320  VDGLDRAVLTMKKGEVALLTIEPEYAFG  347


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP--FKFTLGQGQVIKGWDQGIKTM  368
            EG G+E P  G  V+V   G L DGT F S    G    F+F   + QV+ G D+ + TM
Sbjct  271  EGEGYERPNEGASVKVKLIGKLQDGTAFLSKGHDGEEKLFEFKTDEEQVVDGLDRAVLTM  330

Query  369  KKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            KKGE  + TI P+ A+G S S      +P N+T+ F+VEL+S+
Sbjct  331  KKGEVALLTIEPEYAFGSSESQQDLAVVPSNSTVYFEVELVSF  373



>ref|XP_009372201.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 206/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMP AE   +D DLP + P +KVGEEKEIG+QGLKKKL+KEG GW+ P+ GDEVEVH
Sbjct  3    EDFDMPAAEEMNEDFDLPGEGPALKVGEEKEIGNQGLKKKLLKEGEGWDNPKNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPP+ATLQFDVELLSW S+ DICKDGGI KK+L EGEKWENPKD DEV + +EA+
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSINDICKDGGIIKKILKEGEKWENPKDLDEVIINFEAQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LED TLVAK   VEFTV++G+FCPA++KAVKTMKKGEKV LTVKPQYG+G+
Sbjct  183  LEDKTLVAKYQAVEFTVKDGYFCPAISKAVKTMKKGEKVLLTVKPQYGYGD  233


 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV +++   L D T     +      +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIINFEAQLEDKTLVAKYQ----AVEFTVKDGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   YG+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGYGDKGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DG    K       D+ EF  +E   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVKVKLTGKLQDGKEFLKKGHVEGEDLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV+TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDRAVRTMKKGEVALLTIAPEYAFG  355


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V  TG L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKVKLTGKLQDGKEFLKKGHVEGEDLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ ++TMKKGE  + TI P+ A+G   S      +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVRTMKKGEVALLTIAPEYAFGSLESQQELAVVPPNSTVNYEVELVSF  381



>ref|XP_004492269.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Cicer arietinum]
 ref|XP_004492270.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Cicer arietinum]
Length=545

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 206/233 (88%), Gaps = 6/233 (3%)
 Frame = +3

Query  66   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            + EDFD+P AE   +D DLP+D    KVGEE+EIGD+GLKKKL+KEG GW+TPE GDEV+
Sbjct  1    MNEDFDIPQAEEFNNDFDLPED----KVGEEREIGDRGLKKKLLKEGEGWDTPEIGDEVQ  56

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  57   VHYTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDKGIKTMKKGENALFTIPPELAYG  116

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFK++L+EG+KWENPKD DEV VKYE
Sbjct  117  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKRILSEGDKWENPKDLDEVLVKYE  176

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
              LEDG +VAKSD VEFTV EGH+CPAL+K VKTMKKGEKV L VKPQYGFGE
Sbjct  177  VCLEDGKVVAKSDGVEFTVSEGHYCPALSKTVKTMKKGEKVNLLVKPQYGFGE  229


 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K+++ EG  WE P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILSEGDKWENPKDLDEVLVKYEVCLEDGKVVAKS----DGVEFTVSEGHYCPA  203

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE     + P   +GE G P       +PPNATLQ  +EL+SW +V D+ 
Sbjct  204  LSKTVKTMKKGEKVNLLVKPQYGFGEKGKPADSDEGAVPPNATLQITLELVSWKTVSDVT  263

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV------AKSDIVEFTVEEGHF  671
             D  + KK+L EGE +E+P +   V +K   +L+D T+        +  + EF  +E   
Sbjct  264  SDKKVIKKILKEGEGYEHPNEGAIVKLKLVGKLQDSTVFFEKGRDEEEKLFEFKTDEEQV  323

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  324  IDGLDKAVMTMKKGEVALLTIAPEYAFG  351


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQV  335
             D+ + KK++KEG G+E P  G  V++   G L D T F +  RD     F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYEHPNEGAIVKLKLVGKLQDSTVFFEKGRDEEEKLFEFKTDEEQV  323

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            I G D+ + TMKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S+
Sbjct  324  IDGLDKAVMTMKKGEVALLTIAPEYAFGSSESQQELAVIPPNSTVYYEVELVSF  377



>gb|EMT25795.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=587

 Score =   379 bits (974),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 187/225 (83%), Positives = 203/225 (90%), Gaps = 5/225 (2%)
 Frame = +3

Query  99   MDDLDLPD----DNPV-MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            MD LD+ +    D+P  MKVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVHYTGTLL
Sbjct  28   MDGLDVDEEEEADSPATMKVGEEKEIGKQGLKKKLVKEGEGWERPETGDEVEVHYTGTLL  87

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  443
            DGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  + TIPPDLAYGE+GSPPTI
Sbjct  88   DGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAVLTIPPDLAYGEAGSPPTI  147

Query  444  PPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTL  623
            PPNATLQFDVELLSW SVKDICKDGGIFKKVL EG+KWENPKD DEV+VKYEARLEDG++
Sbjct  148  PPNATLQFDVELLSWASVKDICKDGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSV  207

Query  624  VAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V+KS+ +EF V++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  208  VSKSEGIEFAVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  252


 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 106/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F +  G     
Sbjct  171  DGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSEG----IEFAVKDGYFCPA  226

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPN+TL  D+EL+SW ++  I 
Sbjct  227  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRPASEVEAAVPPNSTLHIDLELVSWKTITLIG  286

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KKVL EGE +E P D   V V+   +L+DGT+  K      +  EF  +E    
Sbjct  287  DDKRILKKVLKEGEGYERPNDGAVVRVRLIGKLDDGTVFTKKGHEGDEPFEFKTDEEQVI  346

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V TMKKGE     + P++ FG
Sbjct  347  EGLDTTVLTMKKGEVASARIPPEHAFG  373


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     +  +G++K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  273  DLELVSWKTITLIGDDKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLDDGTVFTK  327

Query  285  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
                G  PF+F   + QVI+G D  + TMKKGE     IPP+ A+G + +      +PPN
Sbjct  328  KGHEGDEPFEFKTDEEQVIEGLDTTVLTMKKGEVASARIPPEHAFGSTETKLDIAMVPPN  387

Query  453  ATLQFDVELLSW  488
            +T+ ++V+L+S+
Sbjct  388  STVFYEVDLVSF  399



>gb|KHN10949.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=544

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 203/229 (89%), Gaps = 6/229 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDFD+P  E  ++DL +D    KVGEE+EIG +GLKKKL+KEG GWETPE GDEV+VHY 
Sbjct  3    EDFDIPGGE--EMDLGED----KVGEEREIGSRGLKKKLLKEGQGWETPEVGDEVQVHYM  56

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDSSRDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGTKFDSSRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EG+KWENPKDPDEV VKYE  LE
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIVTEGDKWENPKDPDEVLVKYEVHLE  176

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +G LVAKSD VEFTV EGH+CPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  177  NGKLVAKSDGVEFTVREGHYCPALSKAVKTMKKGEKVLLTVKPQYGFGE  225


 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  WE P+  DEV V Y   L +G K  +  D     +FT+ +G     
Sbjct  144  DGGIFKKIVTEGDKWENPKDPDEVLVKYEVHLENG-KLVAKSD---GVEFTVREGHYCPA  199

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPEQGDEGAVPPNATLQITLELVSWKTVSEVT  259

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DG    K        + EF  +E   
Sbjct  260  DDKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGAAFLKKGHDEEEKLFEFKTDEEQV  319

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P+Y FG
Sbjct  320  VDGLDRAVLTMKKGEVALLTIAPEYAFG  347


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DG  F      +    F+F   + QV+
Sbjct  261  DKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGAAFLKKGHDEEEKLFEFKTDEEQVV  320

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ F+VEL+S+
Sbjct  321  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESQQELAVVPPNSTVYFEVELVSF  373



>ref|XP_010532918.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Tarenaya 
hassleriana]
Length=566

 Score =   378 bits (971),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 191/234 (82%), Positives = 208/234 (89%), Gaps = 6/234 (3%)
 Frame = +3

Query  72   EDFDMPPAE-MDDLDLP----DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            +DF+MPP   M+D ++     DD P +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEV
Sbjct  3    DDFEMPPVGGMNDEEMDFGGDDDAPFLKVGEEKEI-KQGLKKKLVKEGEGYETPENGDEV  61

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTL+DGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE   FTIPP+LAY
Sbjct  62   EVHYTGTLMDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAAFTIPPELAY  121

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GESGSPPTIP NATLQFDVELLSWVSVKDICKDGG+FKK+LAEGEKWENPKDPDEV VKY
Sbjct  122  GESGSPPTIPANATLQFDVELLSWVSVKDICKDGGVFKKILAEGEKWENPKDPDEVLVKY  181

Query  597  EARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             ARLEDGT+V KSD +EFTV++ HFCPA++KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  182  VARLEDGTVVGKSDGIEFTVKDDHFCPAISKAVKTMKKGEKVLLTVKPQYGFGE  235


 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+        
Sbjct  154  DGGVFKKILAEGEKWENPKDPDEVLVKYVARLEDGTVVGKS----DGIEFTVKDDHFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V +I 
Sbjct  210  ISKAVKTMKKGEKVLLTVKPQYGFGEKGKPASGDDSAVPPNATLEINLELVSWKTVSEIT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI------VEFTVEEGHF  671
             D  + KK L EGE +E P +   V VK   +L+DGT+  K  +       EF  +E   
Sbjct  270  DDKKVMKKTLKEGEGYERPNEGAVVRVKLIGKLQDGTVFLKIGLGEDEEPFEFKTDEEQV  329

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +T++P+Y FG
Sbjct  330  VDGLDRAVMKMKKGEVALVTIEPEYAFG  357


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK +KEG G+E P  G  V V   G L DGT F      +   PF+F   + QV+
Sbjct  271  DKKVMKKTLKEGEGYERPNEGAVVRVKLIGKLQDGTVFLKIGLGEDEEPFEFKTDEEQVV  330

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++VELLS+
Sbjct  331  DGLDRAVMKMKKGEVALVTIEPEYAFGSAESKQELAVVPPNSTVCYEVELLSF  383



>ref|XP_002883594.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59853.1| peptidylprolyl isomerase [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/229 (83%), Positives = 204/229 (89%), Gaps = 2/229 (1%)
 Frame = +3

Query  75   DFDMPPAEMDD-LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            DF+MPP   DD +D  D    +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVEVHYT
Sbjct  4    DFEMPPVGDDDEMDFGDAASFLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVEVHYT  62

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE+GS
Sbjct  63   GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYGETGS  122

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIP NATLQFDVELL+WVSVKDICKDGG+FKK+LA GEKWENPKD DEV VK+EA+LE
Sbjct  123  PPTIPANATLQFDVELLTWVSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEAKLE  182

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DGT+V KSD VEFTV++GHFCPALTKAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  DGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGE  231


 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  150  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLEDGTVVGKS----DGVEFTVKDGHFCPA  205

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  206  LTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGDGAVPPNATLEINLELVSWKTVSEVT  265

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       +  EF  +E   
Sbjct  266  DDNKVMKKILKEGEGYERPNEGAAVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQV  325

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +T+ P+Y FG
Sbjct  326  VDGLDRAVMKMKKGEVALVTIDPEYAFG  353


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 71/131 (54%), Gaps = 19/131 (15%)
 Frame = +3

Query  111  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  284
            ++ DDN VMK              K++KEG G+E P  G  V+V   G L DGT F    
Sbjct  263  EVTDDNKVMK--------------KILKEGEGYERPNEGAAVKVKLIGKLQDGTVFLKKG  308

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
              +   PF+F   + QV+ G D+ +  MKKGE  + TI P+ A+G + S      +PPN+
Sbjct  309  HGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNS  368

Query  456  TLQFDVELLSW  488
            T+ ++V+LL++
Sbjct  369  TVTYEVDLLTF  379



>ref|XP_008372538.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=572

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 205/231 (89%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMP AE   +D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP  GDEVEVH
Sbjct  3    EDFDMPGAEEMNEDFDLPDEGPVLKVGEEKEIGHQGLKKKLLKEGEGWDTPNNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRD GTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDGGTPFKFTLGQGQVIKGWDEGIRTMKKGENALFTIPPALAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPP+ATLQFDVELLSW SV DI KDGG+ KK+L EGEKWENPKD DEV V +EA+
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVNDISKDGGVIKKILKEGEKWENPKDLDEVIVNFEAQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LED TLVAKS  VEFT+++G+FCPA++KAVKTMKKGEKV LTVKPQYGFG+
Sbjct  183  LEDKTLVAKSQDVEFTIKDGYFCPAISKAVKTMKKGEKVLLTVKPQYGFGD  233


 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V++   L D T    S+D     +FT+  G     
Sbjct  152  DGGVIKKILKEGEKWENPKDLDEVIVNFEAQLEDKTLVAKSQD----VEFTIKDGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +G+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DG    K       D+ EF  +E   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGKEFLKKGHAEGEDLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDRAVLTMKKGEVALLTIAPEYAFG  355


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGKEFLKKGHAEGEDLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL S+
Sbjct  329  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESQQELAVVPPNSTVNYEVELASF  381



>ref|XP_009151655.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Brassica 
rapa]
Length=573

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 205/238 (86%), Gaps = 7/238 (3%)
 Frame = +3

Query  66   IMEDFDMP----PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            + +DFDM      AE  DLDL DD   +P +KVGEEKEIG  GLKKKLVKEG  W+TPE 
Sbjct  1    MADDFDMEIPAEEAEEMDLDLEDDAESDPSLKVGEEKEIGKSGLKKKLVKEGEKWDTPES  60

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIPP
Sbjct  61   GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDMGIKTMKKGENAVFTIPP  120

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGE+GSPPTIPPNATLQFDVELLSW SVKDIC DGG+FKKV+AEGEKWE PKD DEV
Sbjct  121  ELAYGETGSPPTIPPNATLQFDVELLSWRSVKDICGDGGLFKKVIAEGEKWEKPKDLDEV  180

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEARLEDGT+V +SD  +FTV +GHFCPA+ KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  181  YVKYEARLEDGTVVGRSDGAKFTVMDGHFCPAIAKAVKTMKRGEKVLLTVKPQYGFGE  238


 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 113/210 (54%), Gaps = 16/210 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    KFT+  G    
Sbjct  156  GDGGLFKKVIAEGEKWEKPKDLDEVYVKYEARLEDGTVVG----RSDGAKFTVMDGHFCP  211

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE+G   +      +PPNATLQ D+EL+SW +V +
Sbjct  212  AIAKAVKTMKRGEKVLLTVKPQYGFGETGRAASDCIQAAVPPNATLQMDLELVSWKTVVE  271

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEG  665
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K       +  EF  +E 
Sbjct  272  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFFKKGHGEDEEPFEFKTDEE  331

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L KAV  MKKGE   +T+ P+Y FG
Sbjct  332  QVIEGLEKAVMGMKKGEVALITISPEYAFG  361


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 90/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  278
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  260  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFFK  314

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  449
                +   PF+F   + QVI+G ++ +  MKKGE  + TI P+ A+G S S      IPP
Sbjct  315  KGHGEDEEPFEFKTDEEQVIEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPP  374

Query  450  NATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
            ++T+ ++VEL+S++  K+   D    +K+ A G+K E
Sbjct  375  DSTVCYEVELVSFIKEKESW-DMNTQEKIEAAGKKKE  410



>ref|XP_008792944.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Phoenix dactylifera]
Length=574

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 203/233 (87%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFD+P  E     D +D  D++P++KVGEEKEIG QGLKKK+VK+G G +TPE GDEVE
Sbjct  3    EDFDLPAGEEMMNEDAMDFADESPIIKVGEEKEIGKQGLKKKIVKDGEGRDTPEVGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRG PFKF LGQG VIKGWDQGIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGAPFKFKLGQGHVIKGWDQGIKTMKKGENAVFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGGI KK+L EGEKWENPKD DEV VKYE
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWSSVKDICKDGGIMKKILKEGEKWENPKDLDEVLVKYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGTLV+K++ VEFTV++G FCPAL KAVKTMKK E+V LTVKPQY FGE
Sbjct  183  ARLEDGTLVSKAEGVEFTVKDGFFCPALAKAVKTMKKAERVLLTVKPQYAFGE  235


 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 114/206 (55%), Gaps = 14/206 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  154  DGGIMKKILKEGEKWENPKDLDEVLVKYEARLEDGTLV--SKAEGV--EFTVKDGFFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P  A+GE G P +     +PPNATL  ++EL+SW +V +I 
Sbjct  210  LAKAVKTMKKAERVLLTVKPQYAFGEKGRPASGDEGAVPPNATLSVELELVSWKTVTEIG  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  I KK+L EGE +E P D   V+VK   +L+DGT+  K         EF  +E    
Sbjct  270  DDKKILKKILKEGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEVPFEFKTDEEQVI  329

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGF  752
              L +AV TMKKGE   +T+ P+Y F
Sbjct  330  DGLDQAVITMKKGEVALITIPPEYAF  355


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 71/126 (56%), Gaps = 5/126 (4%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G+E P  G  V V   G L DGT F     D   PF+F   + QVI G DQ + TMK
Sbjct  281  EGEGYERPNDGAVVTVKLIGKLQDGTVFVKKGYDDEVPFEFKTDEEQVIDGLDQAVITMK  340

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLA  542
            KGE  + TIPP+ A+  + S      +PPN+T+ ++VEL+S+V  K+   D    +K+ A
Sbjct  341  KGEVALITIPPEYAFCSTESKQDLAVVPPNSTVTYEVELVSFVKEKESW-DMNNAEKIEA  399

Query  543  EGEKWE  560
             G+K E
Sbjct  400  AGKKKE  405



>ref|XP_004975324.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=594

 Score =   377 bits (967),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 201/230 (87%), Gaps = 3/230 (1%)
 Frame = +3

Query  69   MEDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  248
            M+D D    E +D D P     MKVGEEKEIG QGLKKKLVKEG GW+ PE GDEVEVHY
Sbjct  28   MKDLDAGEGEDEDFDFPG---TMKVGEEKEIGKQGLKKKLVKEGEGWDRPETGDEVEVHY  84

Query  249  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  428
            TG+LLDGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE+G
Sbjct  85   TGSLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGETG  144

Query  429  SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
            SPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKWENPKD DEV VKYEARL
Sbjct  145  SPPTIPPNATLQFDVELLSWASVKDICKDGGIFKKIVKEGEKWENPKDLDEVFVKYEARL  204

Query  609  EDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EDGT+V+KSD VEF V++G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  205  EDGTVVSKSDGVEFAVKDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  254


 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 105/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+VKEG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  173  DGGIFKKIVKEGEKWENPKDLDEVFVKYEARLEDGTVVSKS----DGVEFAVKDGYFCPA  228

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  D+EL+SW +V  I 
Sbjct  229  LAKAVKTMKKGEKVLLTVKPQYGFGEQGRPASGDESAVPPNATLHIDLELVSWKTVTLIG  288

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
                I KKVL EGE +E P D   V V+   +LEDGT+  K      +  EF  +E    
Sbjct  289  DRKRILKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVKKGHDGEEPFEFKTDEEQVI  348

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V  MKKGE     + P++ FG
Sbjct  349  EGLDITVVNMKKGEVALARIPPEHAFG  375


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 73/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  275  DLELVSWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVK  329

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   PF+F   + QVI+G D  +  MKKGE  +  IPP+ A+G + +      +PPN
Sbjct  330  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALARIPPEHAFGSAETKQDLAVVPPN  389

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  390  STVFYEVELVSF  401



>ref|XP_002321107.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|EEE99422.2| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=577

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 205/237 (86%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGIPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKW+NPKD DEV 
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIIVEGEKWDNPKDLDEVF  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLE+GT+V+KSD VEFTV EG+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  VKYEARLENGTVVSKSDGVEFTVGEGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  239


 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 115/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE+G         +PPNATL+  +ELLSW +V D+ 
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGENGRTAAGDEGAVPPNATLEIMLELLSWKTVSDVM  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
            KD  + KK+L EGE +E P D   V VK   +LEDGT+  K         EF ++E    
Sbjct  274  KDKKVMKKILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVI  333

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L + VKTMKKGE   +T++P+Y FG
Sbjct  334  DGLDRTVKTMKKGEVALVTIQPEYAFG  360


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +3

Query  186  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  362
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F + + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVIDGLDRTVK  341

Query  363  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKK  533
            TMKKGE  + TI P+ A+G S S     T+P NAT+ ++VE++S+   K+   D    +K
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATVYYEVEMISFTKEKE-SWDMNTQEK  400

Query  534  VLAEGEKWE  560
            + A G+K E
Sbjct  401  IEAAGKKKE  409



>ref|XP_010482107.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=578

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 205/242 (85%), Gaps = 13/242 (5%)
 Frame = +3

Query  72   EDFDM-------PPAEMD-DLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWE  212
            +DFDM        P EMD D+DLP+D+     P +K+GEEKEIG  GLKKKLVKEG  W+
Sbjct  3    DDFDMHQFPAEEQPEEMDMDMDLPEDDEADSAPYLKIGEEKEIGKSGLKKKLVKEGEKWD  62

Query  213  TPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIF  392
            TPE GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  +F
Sbjct  63   TPENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGENAVF  122

Query  393  TIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKD  572
            TIPP+LAYGE+GSPPTIPPNATLQFDVEL+SW SVKDIC DGG+FKKV+ EGEKWE PKD
Sbjct  123  TIPPELAYGETGSPPTIPPNATLQFDVELISWRSVKDICGDGGVFKKVIVEGEKWEKPKD  182

Query  573  PDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGF  752
             D V VKYEARLEDGT+V KSD VEFTV+EGH CPAL KAVKTMK+GEKV LTVKPQYGF
Sbjct  183  LDAVYVKYEARLEDGTIVGKSDGVEFTVKEGHLCPALAKAVKTMKRGEKVLLTVKPQYGF  242

Query  753  GE  758
            GE
Sbjct  243  GE  244


 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 110/209 (53%), Gaps = 15/209 (7%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  WE P+  D V V Y   L DGT    S       +FT+ +G +  
Sbjct  162  GDGGVFKKVIVEGEKWEKPKDLDAVYVKYEARLEDGTIVGKS----DGVEFTVKEGHLCP  217

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPP------TIPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE G P        IPPNATLQ D+EL+SW  V +
Sbjct  218  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRPAFDGFQAAIPPNATLQIDLELVSWKIVVE  277

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGH  668
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K      +  EF  +E  
Sbjct  278  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHDEEEPFEFKTDEEQ  337

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                  KAV  MKKGE   + + P+Y FG
Sbjct  338  VIEGFEKAVMGMKKGEVAFIMISPEYAFG  366


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK++KEG G+E P  G  V++   G L DGT F     D   PF+F   + QVI+
Sbjct  281  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHDEEEPFEFKTDEEQVIE  340

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            G+++ +  MKKGE     I P+ A+G S S      IPPN+T+ ++VEL+S++  K+
Sbjct  341  GFEKAVMGMKKGEVAFIMISPEYAFGSSESKQELAVIPPNSTVSYEVELVSFIKEKE  397



>ref|XP_003552100.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=544

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 202/229 (88%), Gaps = 6/229 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDFD+P  E  ++DL +D    +VGEE+EIG  GLKKKL+KEG GWETPE GDEV+VHYT
Sbjct  3    EDFDIPGGE--EMDLGED----EVGEEREIGSGGLKKKLLKEGQGWETPEVGDEVQVHYT  56

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDSSRDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGTKFDSSRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKWENPKDPDEV VKYE  LE
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIITEGEKWENPKDPDEVLVKYEVHLE  176

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +G L+AKSD  EFTV EGH+CPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  177  NGKLLAKSDGEEFTVREGHYCPALSKAVKTMKKGEKVLLTVKPQYGFGE  225


 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L +G     S       +FT+ +G     
Sbjct  144  DGGIFKKIITEGEKWENPKDPDEVLVKYEVHLENGKLLAKSDGE----EFTVREGHYCPA  199

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPEQGDEGAVPPNATLQITLELVSWKTVSEVT  259

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT   K        + EF  +E   
Sbjct  260  DDKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGTAFLKKGHDEEEKLFEFKTDEEQV  319

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P Y FG
Sbjct  320  VDGLDRAVLTMKKGEVALLTIAPDYAFG  347


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QV+
Sbjct  261  DKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGTAFLKKGHDEEEKLFEFKTDEEQVV  320

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI PD A+G S S      +PPN+T+ F+VEL+S+
Sbjct  321  DGLDRAVLTMKKGEVALLTIAPDYAFGTSESQQELAVVPPNSTVYFEVELVSF  373



>dbj|BAK01956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +3

Query  102  DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFD  281
            DD +  D    MKVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVHYTGTLLDGTKFD
Sbjct  35   DDEEEADSPATMKVGEEKEIGKQGLKKKLVKEGEGWEQPETGDEVEVHYTGTLLDGTKFD  94

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATL  461
            SSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  + TIPP+LAYGE+GSPPTIPPNATL
Sbjct  95   SSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAVLTIPPELAYGEAGSPPTIPPNATL  154

Query  462  QFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI  641
            +FDVELLSW SVKDICKDGGIFKKVL EG+KWENPKD DEV VKYEARLEDG++V+KSD 
Sbjct  155  RFDVELLSWASVKDICKDGGIFKKVLVEGQKWENPKDLDEVLVKYEARLEDGSVVSKSDG  214

Query  642  VEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +EF V++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  215  IEFAVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  253


 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 106/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F +  G     
Sbjct  172  DGGIFKKVLVEGQKWENPKDLDEVLVKYEARLEDGSVVSKS----DGIEFAVKDGYFCPA  227

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPN+TL  D+EL+SW +V  I 
Sbjct  228  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRPASEVEGAVPPNSTLHIDLELVSWKTVTLIG  287

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KKVL EGE +E P D   V V+   +L++GT+  K      +  EF  +E    
Sbjct  288  DDKRILKKVLKEGEGYERPNDGAVVRVRLIGKLDNGTVFTKKGHEGDEPFEFKTDEEQVI  347

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V TMKKGE     + P++ FG
Sbjct  348  EGLDTTVVTMKKGEVALARIPPEHAFG  374


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V  +G++K I      KK++KEG G+E P  G  V V   G L +GT F  
Sbjct  274  DLELVSWKTVTLIGDDKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLDNGTVFTK  328

Query  285  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
                G  PF+F   + QVI+G D  + TMKKGE  +  IPP+ A+G + +      +PPN
Sbjct  329  KGHEGDEPFEFKTDEEQVIEGLDTTVVTMKKGEVALARIPPEHAFGSTETKLDLAVVPPN  388

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  389  STVFYEVELVSF  400



>ref|XP_009349114.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Pyrus 
x bretschneideri]
Length=572

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 203/231 (88%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMP  E   +D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP  GDEVEVH
Sbjct  3    EDFDMPGVEEMNEDFDLPDEGPVLKVGEEKEIGHQGLKKKLLKEGEGWDTPNNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRD GTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP LAYGES
Sbjct  63   YTGTLLDGTQFDSSRDSGTPFKFTLGQGQVIKGWDEGIRTMKKGENALFTIPPALAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPP+ATLQFDVELLSW SV DI KDGG+ KK+L EGEKWENPKD DEV V +E +
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVNDISKDGGVIKKILKEGEKWENPKDLDEVIVNFEVQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LED TLVAKS  VEFTV++G+FCPA++KAVKTMKKGEKV LTVKPQYGFG+
Sbjct  183  LEDKTLVAKSQDVEFTVKDGYFCPAISKAVKTMKKGEKVLLTVKPQYGFGD  233


 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V++   L D T    S+D     +FT+  G     
Sbjct  152  DGGVIKKILKEGEKWENPKDLDEVIVNFEVQLEDKTLVAKSQD----VEFTVKDGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +G+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGFGDQGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DG    K       D+ EF  +E   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGKEFLKKGHAEGEDLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDRAVLTMKKGEVALLTIAPEYAFG  355


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGKEFLKKGHAEGEDLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+ A+G   S      +PPN+T+ ++VEL S+
Sbjct  329  DGLDRAVLTMKKGEVALLTIAPEYAFGSLESHQELAVVPPNSTVNYEVELASF  381



>ref|XP_011000006.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=577

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 205/237 (86%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGVPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKW+NPKD DEV 
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIIVEGEKWDNPKDLDEVF  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLE+GT+V+KSD VEFTV EG+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  VKYEARLENGTVVSKSDGVEFTVGEGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  239


 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G         +PPNATL+  +ELLSW +V D+ 
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGEYGRTAAGDEGAVPPNATLEIMLELLSWKTVSDVM  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
            KD  + KK+L EGE +E P D   V VK   +L DGT+  K         EF ++E    
Sbjct  274  KDKKVMKKILKEGEGYERPDDGTVVQVKLIGKLGDGTIFVKKGHEEEPPFEFKLDEEQVI  333

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVKTMKKGE   +T++P+Y FG
Sbjct  334  DGLDRAVKTMKKGEVALVTIQPEYAFG  360


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 80/148 (54%), Gaps = 11/148 (7%)
 Frame = +3

Query  186  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  362
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F L + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLGDGTIFVKKGHEEEPPFEFKLDEEQVIDGLDRAVK  341

Query  363  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKK  533
            TMKKGE  + TI P+ A+G S S     T+P NAT  ++VE++S+   K+   D    +K
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATAYYEVEMISFTKEKE-SWDMNTQEK  400

Query  534  VLA------EGEKWENPKDPDEVSVKYE  599
            + A      EG  W      +  S +YE
Sbjct  401  IEAAGKKKEEGNAWFKAGKYERASRRYE  428



>ref|XP_004296967.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Fragaria 
vesca subsp. vesca]
Length=566

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 187/238 (79%), Positives = 207/238 (87%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPD--DNPV----MKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DFD P     E  D+D+P+  D+ +    +KVG+EKE+G  GLKKKL+K+G GWETP  
Sbjct  3    DDFDFPTGPNPEDVDMDIPEEEDDAISPGPIKVGDEKELGKNGLKKKLIKQGEGWETPGS  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEV+VHYTGTLLDGTKFDSSRDRGTPFKF+LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVQVHYTGTLLDGTKFDSSRDRGTPFKFSLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+ KK+L EGEKWENPKD DEV
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGVIKKILTEGEKWENPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEARLEDGTLV+KSD VEFTVE+G+ CPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  FVKYEARLEDGTLVSKSDGVEFTVEDGYLCPALAKAVKTMKKGEKVHLTVKPQYGFGE  240


 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  159  DGGVIKKILTEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----DGVEFTVEDGYLCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE    T+ P   +GE+G P       +PPNATL   +EL+SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVHLTVKPQYGFGEAGRPAAGDEGAVPPNATLSISLELISWKTVSDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK----SDIVEFTVEEGHFCP  677
            KD  + KK L EGE +E P D   V VK   +L DGT+  K    ++  EF ++E     
Sbjct  275  KDKKVLKKALKEGEGYERPNDGAVVQVKMVGKLHDGTIFTKKGHDNEPFEFKIDEDQVID  334

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AVK+MKKGE   +T++P+Y FG
Sbjct  335  GLDRAVKSMKKGEVALVTIQPEYAFG  360


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (59%), Gaps = 4/135 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  276  DKKVLKKALKEGEGYERPNDGAVVQVKMVGKLHDGTIFTKKGHDNEPFEFKIDEDQVIDG  335

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +K+MKKGE  + TI P+ A+G S S      +P N+T+ ++VEL+S+V  K+   D
Sbjct  336  LDRAVKSMKKGEVALVTIQPEYAFGSSESTQELAIVPANSTVYYEVELVSFVKEKESW-D  394

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  395  MNTQEKIEAAGKKKE  409



>ref|XP_006375512.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
 gb|ERP53309.1| hypothetical protein POPTR_0014s14690g [Populus trichocarpa]
Length=608

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 205/237 (86%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGIPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKW+NPKD DEV 
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIIVEGEKWDNPKDLDEVF  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLE+GT+V+KSD VEFTV EG+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  VKYEARLENGTVVSKSDGVEFTVGEGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  239


 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 115/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE+G         +PPNATL+  +ELLSW +V D+ 
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGENGRTAAGDEGAVPPNATLEIMLELLSWKTVSDVM  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
            KD  + KK+L EGE +E P D   V VK   +LEDGT+  K         EF ++E    
Sbjct  274  KDKKVMKKILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVI  333

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L + VKTMKKGE   +T++P+Y FG
Sbjct  334  DGLDRTVKTMKKGEVALVTIQPEYAFG  360


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 81/148 (55%), Gaps = 11/148 (7%)
 Frame = +3

Query  186  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  362
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F + + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVIDGLDRTVK  341

Query  363  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKK  533
            TMKKGE  + TI P+ A+G S S     T+P NAT+ ++VE++S+   K+   D    +K
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATVYYEVEMISFTKEKE-SWDMNTQEK  400

Query  534  VLA------EGEKWENPKDPDEVSVKYE  599
            + A      EG  W      +  S +YE
Sbjct  401  IEAAGKKKEEGNAWFKAGKYERASRRYE  428



>ref|XP_011000005.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Populus euphratica]
Length=608

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 205/237 (86%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGVPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKW+NPKD DEV 
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIIVEGEKWDNPKDLDEVF  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLE+GT+V+KSD VEFTV EG+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  VKYEARLENGTVVSKSDGVEFTVGEGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  239


 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G         +PPNATL+  +ELLSW +V D+ 
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGEYGRTAAGDEGAVPPNATLEIMLELLSWKTVSDVM  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
            KD  + KK+L EGE +E P D   V VK   +L DGT+  K         EF ++E    
Sbjct  274  KDKKVMKKILKEGEGYERPDDGTVVQVKLIGKLGDGTIFVKKGHEEEPPFEFKLDEEQVI  333

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVKTMKKGE   +T++P+Y FG
Sbjct  334  DGLDRAVKTMKKGEVALVTIQPEYAFG  360


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 80/148 (54%), Gaps = 11/148 (7%)
 Frame = +3

Query  186  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  362
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F L + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLGDGTIFVKKGHEEEPPFEFKLDEEQVIDGLDRAVK  341

Query  363  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKK  533
            TMKKGE  + TI P+ A+G S S     T+P NAT  ++VE++S+   K+   D    +K
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATAYYEVEMISFTKEKE-SWDMNTQEK  400

Query  534  VLA------EGEKWENPKDPDEVSVKYE  599
            + A      EG  W      +  S +YE
Sbjct  401  IEAAGKKKEEGNAWFKAGKYERASRRYE  428



>gb|KHN21278.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=418

 Score =   368 bits (945),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 201/229 (88%), Gaps = 6/229 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDFD+P  E  ++DL +D    +VGEE+EIG  GLKKKL+KEG GWETPE GDEV+VHYT
Sbjct  3    EDFDIPGGE--EMDLGED----EVGEEREIGSGGLKKKLLKEGQGWETPEVGDEVQVHYT  56

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDG KFDSSRDR +PF FTLGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGS
Sbjct  57   GTLLDGIKFDSSRDRDSPFSFTLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGS  116

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKWENPKDPDEV VKYE  LE
Sbjct  117  PPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIITEGEKWENPKDPDEVLVKYEVHLE  176

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +G L+AKSD  EFTV EGH+CPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  177  NGKLLAKSDGEEFTVREGHYCPALSKAVKTMKKGEKVLLTVKPQYGFGE  225


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L +G     S       +FT+ +G     
Sbjct  144  DGGIFKKIITEGEKWENPKDPDEVLVKYEVHLENGKLLAKSDGE----EFTVREGHYCPA  199

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  200  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPEQGDEGAVPPNATLQITLELVSWKTVSEVT  259

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT   K        + EF  +E   
Sbjct  260  DDKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGTAFLKKGHDEEEKLFEFKTDEEQV  319

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P Y FG
Sbjct  320  VDGLDRAVLTMKKGEVALLTIAPDYAFG  347


 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DGT F      +    F+F   + QV+
Sbjct  261  DKKVIKKILKEGEGYERPNEGAIVKVKLIGKLQDGTAFLKKGHDEEEKLFEFKTDEEQVV  320

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI PD A+G S S      +PPN+T+ F+VEL+S+
Sbjct  321  DGLDRAVLTMKKGEVALLTIAPDYAFGTSESQQELAVVPPNSTVYFEVELVSF  373



>ref|XP_008222791.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Prunus mume]
Length=578

 Score =   373 bits (958),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 203/238 (85%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPAEMD----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DF+ P A  +    D+DLPD      +P  KVGEEKEIG  GLKKKLVKEG GW+TP  
Sbjct  3    DDFEFPAATNNLNDADMDLPDVEDDAISPSPKVGEEKEIGKNGLKKKLVKEGEGWDTPGS  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTL+DGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVEVHYTGTLVDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIPPNATLQFDVELLSW SV+DI KDGG+ KK+L EGEKWENPKD DEV
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELLSWTSVRDILKDGGVIKKILTEGEKWENPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEARLEDGTLV+KSD VEFTV++G FCPAL KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  FVKYEARLEDGTLVSKSDGVEFTVQDGFFCPALAKAVKTMKKGEKVLLNVKPQYGFGE  240


 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 111/208 (53%), Gaps = 13/208 (6%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  157  LKDGGVIKKILTEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----DGVEFTVQDGFFC  212

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKD  503
                + +KTMKKGE  +  + P   +GE G         +PPNA+L+  +EL+SW +V D
Sbjct  213  PALAKAVKTMKKGEKVLLNVKPQYGFGEVGRQAVGDEVAVPPNASLEITLELVSWKTVSD  272

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHF  671
            + KD  + KK L EGE +E P D   V VK   +L DGT+  K     +  EF ++E   
Sbjct  273  VTKDKKVLKKTLKEGEGYERPNDGSVVQVKLVGKLHDGTIFTKKGHDDEPYEFRIDEEQV  332

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AVK MKKGE   +T++P+Y FG
Sbjct  333  IDGLDRAVKNMKKGEVALVTIQPEYAFG  360


 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 78/135 (58%), Gaps = 4/135 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        P++F + + QVI G
Sbjct  276  DKKVLKKTLKEGEGYERPNDGSVVQVKLVGKLHDGTIFTKKGHDDEPYEFRIDEEQVIDG  335

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +K MKKGE  + TI P+ A+G S S      +P N+T+ ++VELLS+V  K+   D
Sbjct  336  LDRAVKNMKKGEVALVTIQPEYAFGSSESAQDLAVVPANSTVYYEVELLSFVKEKESW-D  394

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  395  LNTQEKIEAAGKKKE  409



>gb|ABK95085.1| unknown [Populus trichocarpa]
Length=608

 Score =   374 bits (961),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 205/237 (86%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAEMD-------DLDLPD-DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+ P    +       D+ +PD D  V+KVGEEKEIG  GLKKKLVKEG GW+TP  G
Sbjct  3    EDFEFPTGSNNMELEDEMDMGIPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPSAG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTL+DGT+FDSSR+RGTPFKF LGQGQVIKGWD+GIKTMK+GE  +FTIPP+
Sbjct  63   DEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKRGENAVFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKW+NPKD DEV 
Sbjct  123  LAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIIVEGEKWDNPKDLDEVF  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLE+GT+V+KSD VEFTV EG+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  VKYEARLENGTVVSKSDGVEFTVGEGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  239


 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 115/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y   L +GT    S       +FT+G+G     
Sbjct  158  DGGIFKKIIVEGEKWDNPKDLDEVFVKYEARLENGTVVSKS----DGVEFTVGEGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE+G         +PPNATL+  +ELLSW +V D+ 
Sbjct  214  LAKAVKTMKKGEKVLLTVKPQYGFGENGRTAAGDEGAVPPNATLEIMLELLSWKTVSDVM  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
            KD  + KK+L EGE +E P D   V VK   +LEDGT+  K         EF ++E    
Sbjct  274  KDKKVMKKILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVI  333

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L + VKTMKKGE   +T++P+Y FG
Sbjct  334  DGLDRTVKTMKKGEVALVTIQPEYAFG  360


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 81/148 (55%), Gaps = 11/148 (7%)
 Frame = +3

Query  186  LVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIK  362
            ++KEG G+E P+ G  V+V   G L DGT F     +   PF+F + + QVI G D+ +K
Sbjct  282  ILKEGEGYERPDDGTVVQVKLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVIDGLDRTVK  341

Query  363  TMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKK  533
            TMKKGE  + TI P+ A+G S S     T+P NAT+ ++VE++S+   K+   D    +K
Sbjct  342  TMKKGEVALVTIQPEYAFGRSESQQDLATVPVNATVYYEVEMISFTKEKE-SWDMNTQEK  400

Query  534  VLA------EGEKWENPKDPDEVSVKYE  599
            + A      EG  W      +  S +YE
Sbjct  401  IEAAGKKKEEGNAWFKAGKYERASRRYE  428



>ref|XP_010442282.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Camelina 
sativa]
Length=576

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/240 (78%), Positives = 203/240 (85%), Gaps = 13/240 (5%)
 Frame = +3

Query  75   DFDMP-------PAEMDDLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWETP  218
            DFDM        P EMD +DLP+D+     P +K+GEEKEIG  GLKKKLVKEG  W+TP
Sbjct  4    DFDMQQFPAEEQPEEMD-MDLPEDDEADSAPYLKIGEEKEIGKSGLKKKLVKEGEKWDTP  62

Query  219  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  398
            E GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  +FTI
Sbjct  63   ENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGENAVFTI  122

Query  399  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPD  578
            PP+LAYGE+GSPPTIPPNATLQFDVEL+SW SVKDIC DGG+FKK++ EGEKWE PKD D
Sbjct  123  PPELAYGETGSPPTIPPNATLQFDVELISWRSVKDICGDGGVFKKIIVEGEKWEKPKDLD  182

Query  579  EVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EV VKYEARLEDGT+V KSD  EFTV+EGH CPAL KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  183  EVYVKYEARLEDGTIVGKSDGAEFTVKEGHLCPALAKAVKTMKRGEKVLLTVKPQYGFGE  242


 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 112/209 (54%), Gaps = 15/209 (7%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G +  
Sbjct  160  GDGGVFKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGA----EFTVKEGHLCP  215

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGE------SGSPPTIPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE       G    IPPNATLQ D+EL+SW +V +
Sbjct  216  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRISFDGCQAAIPPNATLQIDLELVSWKTVVE  275

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGH  668
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K      +  EF  +E  
Sbjct  276  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHDEDEPFEFKTDEEQ  335

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L KAV  MKKGE   + V P+Y FG
Sbjct  336  VIEGLEKAVMGMKKGEVAFIMVSPEYAFG  364


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  264  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  318

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   PF+F   + QVI+G ++ +  MKKGE     + P+ A+G S S      IPPN
Sbjct  319  KGHDEDEPFEFKTDEEQVIEGLEKAVMGMKKGEVAFIMVSPEYAFGSSESKQELAVIPPN  378

Query  453  ATLQFDVELLSWVSVKD  503
            +T+ ++VEL+S++  K+
Sbjct  379  STVSYEVELVSFIKEKE  395



>gb|EMS57053.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=582

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +3

Query  99   MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF  278
            MDD +       MKVGEEKEIG QGLKKKLVKEG GWE PE GDEVEVHYTGTLLDG KF
Sbjct  28   MDDEEEAHSPATMKVGEEKEIGKQGLKKKLVKEGEGWERPETGDEVEVHYTGTLLDGAKF  87

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNAT  458
            DSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  + TIPPDLAYGE+GSPP IPPNAT
Sbjct  88   DSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAVLTIPPDLAYGEAGSPPPIPPNAT  147

Query  459  LQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSD  638
            L+FDVELLSW SVKDICKDGGIFKKVL EG+KWENPKD DEV+VKYEARLEDG++V+KS+
Sbjct  148  LRFDVELLSWASVKDICKDGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSE  207

Query  639  IVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             +EF V++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  208  GIEFAVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  247


 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 106/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F +  G     
Sbjct  166  DGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSEG----IEFAVKDGYFCPA  221

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPN+TL  D+EL+SW +V  I 
Sbjct  222  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRPASEVEGAVPPNSTLHIDLELVSWKTVTLIG  281

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
            +D  I KKVL EG  +E P D   V V+   +L+DGT+  K      +  EF  +E    
Sbjct  282  EDKRILKKVLKEGAGYERPNDGAVVRVRLIGKLDDGTVFTKKGHEGDEPFEFRTDEEQVI  341

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V TMKKGE     + P++ FG
Sbjct  342  EGLDTTVLTMKKGEVASARIPPEHAFG  368


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V  +GE+K I      KK++KEGAG+E P  G  V V   G L DGT F  
Sbjct  268  DLELVSWKTVTLIGEDKRI-----LKKVLKEGAGYERPNDGAVVRVRLIGKLDDGTVFTK  322

Query  285  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
                G  PF+F   + QVI+G D  + TMKKGE     IPP+ A+G + +      +PPN
Sbjct  323  KGHEGDEPFEFRTDEEQVIEGLDTTVLTMKKGEVASARIPPEHAFGSTETKLDLAVVPPN  382

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  383  STVFYEVELVSF  394



>ref|XP_007222365.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
 gb|EMJ23564.1| hypothetical protein PRUPE_ppa003399mg [Prunus persica]
Length=578

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 203/238 (85%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPAEMD----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DF+ P A  +    D+DLPD      +P  KVGEEKEIG  GLKKKLVKEG GW+TP  
Sbjct  3    DDFEFPAATNNLNDADMDLPDVEDDAISPSPKVGEEKEIGKNGLKKKLVKEGEGWDTPGS  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTL+DGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVEVHYTGTLVDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIPPNATLQFDVELLSW SV+DI KDGG+ KK+L EGEKWENPKD DEV
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELLSWTSVRDILKDGGVIKKILTEGEKWENPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEARLEDGTLV+KSD VEFTV++G FCPAL KAVKTMKKGEKV L VKPQYGFGE
Sbjct  183  FVKYEARLEDGTLVSKSDGVEFTVQDGFFCPALAKAVKTMKKGEKVLLNVKPQYGFGE  240


 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 112/208 (54%), Gaps = 13/208 (6%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  157  LKDGGVIKKILTEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----DGVEFTVQDGFFC  212

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKD  503
                + +KTMKKGE  +  + P   +GE G P       +PPNA+L+  +EL+SW +V D
Sbjct  213  PALAKAVKTMKKGEKVLLNVKPQYGFGEVGRPSVGDEGAVPPNASLEITLELVSWKTVSD  272

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHF  671
            + KD  + KK L EGE +E P D   V VK   +L DGT+  K     +  EF ++E   
Sbjct  273  VTKDKKVLKKTLKEGEGYERPNDGSVVQVKLVGKLHDGTIFTKKGHDDEPFEFRIDEEQV  332

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AVK MKKGE   +T++P+Y FG
Sbjct  333  IDGLDRAVKNMKKGEVALVTIQPEYAFG  360


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 4/135 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F + + QVI G
Sbjct  276  DKKVLKKTLKEGEGYERPNDGSVVQVKLVGKLHDGTIFTKKGHDDEPFEFRIDEEQVIDG  335

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +K MKKGE  + TI P+ A+G S S      +P N+T+ ++VELLS+V  K+   D
Sbjct  336  LDRAVKNMKKGEVALVTIQPEYAFGSSESAQDLAVVPANSTVYYEVELLSFVKEKESW-D  394

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  395  LNTQEKIEAAGKKKE  409



>emb|CDP15134.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 201/237 (85%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPA-----EM---DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            +DFD P A     EM   ++LDLP+ NPV+KVGEEKEIG  GLKKKL+ EG GWE P  G
Sbjct  3    DDFDFPSASNAADEMGMDEELDLPETNPVIKVGEEKEIGKNGLKKKLINEGEGWENPSSG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHY GTLLDGT+FDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  63   DEVEVHYVGTLLDGTQFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGEKALFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIPPNATLQF+VELLSW SVKDICKDGGIFKKVL EGE W+NPKD DEV 
Sbjct  123  LAYGESGSPPTIPPNATLQFEVELLSWTSVKDICKDGGIFKKVLVEGEGWQNPKDLDEVF  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEA LEDGTL++KSD VEFTV++G FCPAL KAVKTMKKGEK  LTV  QY FGE
Sbjct  183  VKYEALLEDGTLISKSDGVEFTVKDGFFCPALAKAVKTMKKGEKALLTVNSQYAFGE  239


 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 115/206 (56%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKVLVEGEGWQNPKDLDEVFVKYEALLEDGTLISKS----DGVEFTVKDGFFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+    A+GE G P      ++PPNA+LQ ++EL+SW +V D+ 
Sbjct  214  LAKAVKTMKKGEKALLTVNSQYAFGEKGRPQVGDEISVPPNASLQINLELVSWKTVSDVT  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  + KK+L EGE +E P D   V VK   +L+DGT+  K     +  EF V+E     
Sbjct  274  NDKKVLKKILKEGEGYERPNDGTVVKVKLTGKLQDGTVFVKKGHDGEEFEFKVDEEQVTE  333

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AVKTMK GE   + V+P+Y FG
Sbjct  334  GLDRAVKTMKNGEMALVIVQPEYAFG  359


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 79/136 (58%), Gaps = 4/136 (3%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
             D+ + KK++KEG G+E P  G  V+V  TG L DGT F      G  F+F + + QV +
Sbjct  274  NDKKVLKKILKEGEGYERPNDGTVVKVKLTGKLQDGTVFVKKGHDGEEFEFKVDEEQVTE  333

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ +KTMK GE  +  + P+ A+G S S      +P ++TL +++E++S+V  K+   
Sbjct  334  GLDRAVKTMKNGEMALVIVQPEYAFGPSESQQELAVVPADSTLYYEIEMVSFVKEKESW-  392

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G+K E
Sbjct  393  DMNAQEKIEAAGKKKE  408



>ref|XP_012078436.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Jatropha curcas]
 gb|KDP32575.1| hypothetical protein JCGZ_13125 [Jatropha curcas]
Length=579

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/238 (79%), Positives = 208/238 (87%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPA--EMDD---LDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DF+ P A  +M+D   +D+P++     PV+KVGEEKEIG  GLKKKL+KEG GWETP  
Sbjct  3    DDFEFPTANNKMEDDDVMDVPEEEDPVAPVVKVGEEKEIGKNGLKKKLIKEGEGWETPGI  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGT+FDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP
Sbjct  63   GDEVEVHYTGTLLDGTQFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPP  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIP NATLQF+VELLSW SVKDICKDGGIFKK+L EGEKW+NPKD DEV
Sbjct  123  ELAYGESGSPPTIPANATLQFNVELLSWTSVKDICKDGGIFKKILVEGEKWDNPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEARLE GT+++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  LVKYEARLEHGTVISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  240


 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 115/208 (55%), Gaps = 14/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y   L  GT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWDNPKDLDEVLVKYEARLEHGTVISKS----DGVEFTVGDGYFCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE+G P       +PPNATL+  +EL+SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYGFGENGRPALGSEGAVPPNATLEIMLELVSWKTVTDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
            KD  + KK+L EGE +E P D   V VK   +L DGT+  K        +EF ++E    
Sbjct  275  KDKKVLKKILKEGEGYERPNDGTIVQVKLIGKLHDGTIFVKKGHDEEPPLEFKIDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFGE  758
              L KAVK+MKKGE   + ++P+Y FG+
Sbjct  335  DGLDKAVKSMKKGEVALVIIQPEYAFGQ  362


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     D   P +F + + QVI 
Sbjct  276  DKKVLKKILKEGEGYERPNDGTIVQVKLIGKLHDGTIFVKKGHDEEPPLEFKIDEEQVID  335

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            G D+ +K+MKKGE  +  I P+ A+G+  S     +IP N+TL ++VE++S+   K+
Sbjct  336  GLDKAVKSMKKGEVALVIIQPEYAFGQFESRQELASIPANSTLYYEVEMISFTKEKE  392



>ref|XP_006297572.1| hypothetical protein CARUB_v10013595mg [Capsella rubella]
 gb|EOA30470.1| hypothetical protein CARUB_v10013595mg [Capsella rubella]
Length=478

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 205/233 (88%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPA----EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+MPP     + +D+D  D    +KVGEEKEI  QGLKKKL+KEG G+ETP+ GDEVE
Sbjct  3    EDFEMPPVGGMNDDEDMDFGDAASFLKVGEEKEI-QQGLKKKLLKEGDGYETPDNGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELL+WVSVKDICKDGG+FKK+LA GEKWENPKD DEV VK+E
Sbjct  122  ESGSPPTIPANATLQFDVELLTWVSVKDICKDGGVFKKILAVGEKWENPKDLDEVFVKFE  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+L++GT+V KSD VEFTV++GHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  182  AKLDNGTVVGKSDGVEFTVKDGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++  G  WE P+  DEV V +   L +GT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVFVKFEAKLDNGTVVGKS----DGVEFTVKDGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWNTVSEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +LEDGT+  K       ++ EF  +E   
Sbjct  269  DDNKVMKKILKEGEGYERPNEGATVKVKLIGKLEDGTVFLKKGHGEDGELFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +TV P+Y FG
Sbjct  329  VDGLDRAVMKMKKGEVALVTVAPEYAFG  356


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 79/140 (56%), Gaps = 11/140 (8%)
 Frame = +3

Query  87   PPAEMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            P A ++ +L+L   N V +V +     D  + KK++KEG G+E P  G  V+V   G L 
Sbjct  248  PNATLEINLELVSWNTVSEVTD-----DNKVMKKILKEGEGYERPNEGATVKVKLIGKLE  302

Query  264  DGTKF--DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP-  434
            DGT F      + G  F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S  
Sbjct  303  DGTVFLKKGHGEDGELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVAPEYAFGSNESQQ  362

Query  435  --PTIPPNATLQFDVELLSW  488
                +PPN+T+ ++V+L+++
Sbjct  363  ELAVVPPNSTVYYEVDLVTF  382



>gb|AGT17361.1| peptidylprolyl isomerase [Saccharum hybrid cultivar R570]
Length=590

 Score =   372 bits (954),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 199/230 (87%), Gaps = 3/230 (1%)
 Frame = +3

Query  69   MEDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  248
            MED D    + D+   P   P MKVGEEKEIG +GLKKKLVKEG GW+ PE GDEVEVHY
Sbjct  26   MEDLDDAGVDADEDYFP---PTMKVGEEKEIGKEGLKKKLVKEGEGWDRPETGDEVEVHY  82

Query  249  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  428
            TGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  IFTIPP LAYGE+ 
Sbjct  83   TGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAIFTIPPGLAYGETS  142

Query  429  SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
            SPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VKYEARL
Sbjct  143  SPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILVEGEKWENPKDLDEVFVKYEARL  202

Query  609  EDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            E GT+V+KSD VEF V++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  203  EGGTVVSKSDGVEFAVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  252


 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 103/207 (50%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L  GT    S       +F +  G     
Sbjct  171  DGGIFKKILVEGEKWENPKDLDEVFVKYEARLEGGTVVSKS----DGVEFAVKDGYFCPA  226

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNA L  D+EL+SW +V  I 
Sbjct  227  LSKAVKTMKKGEKVLLTVKPQYGFGEQGKPASGDEHAVPPNAVLHIDLELVSWKTVTLIG  286

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
                I KKVL EGE +E P D   V V+   +LEDGT+  K      +  EF  +E    
Sbjct  287  DRKRILKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVKKGHDGEEPFEFKTDEEQVI  346

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V  MKKGE   + V P++ FG
Sbjct  347  EGLDITVVNMKKGEVALVRVPPEHAFG  373


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 72/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  273  DLELVSWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVK  327

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   PF+F   + QVI+G D  +  MKKGE  +  +PP+ A+G   +      +PPN
Sbjct  328  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALVRVPPEHAFGSVETKQDLAIVPPN  387

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  388  STVFYEVELVSF  399



>ref|XP_004975323.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
Length=709

 Score =   375 bits (963),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 201/230 (87%), Gaps = 3/230 (1%)
 Frame = +3

Query  69   MEDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHY  248
            M+D D    E +D D P     MKVGEEKEIG QGLKKKLVKEG GW+ PE GDEVEVHY
Sbjct  28   MKDLDAGEGEDEDFDFPG---TMKVGEEKEIGKQGLKKKLVKEGEGWDRPETGDEVEVHY  84

Query  249  TGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESG  428
            TG+LLDGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE+G
Sbjct  85   TGSLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGETG  144

Query  429  SPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
            SPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK++ EGEKWENPKD DEV VKYEARL
Sbjct  145  SPPTIPPNATLQFDVELLSWASVKDICKDGGIFKKIVKEGEKWENPKDLDEVFVKYEARL  204

Query  609  EDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EDGT+V+KSD VEF V++G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  205  EDGTVVSKSDGVEFAVKDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  254


 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 105/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+VKEG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  173  DGGIFKKIVKEGEKWENPKDLDEVFVKYEARLEDGTVVSKS----DGVEFAVKDGYFCPA  228

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  D+EL+SW +V  I 
Sbjct  229  LAKAVKTMKKGEKVLLTVKPQYGFGEQGRPASGDESAVPPNATLHIDLELVSWKTVTLIG  288

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
                I KKVL EGE +E P D   V V+   +LEDGT+  K      +  EF  +E    
Sbjct  289  DRKRILKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVKKGHDGEEPFEFKTDEEQVI  348

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V  MKKGE     + P++ FG
Sbjct  349  EGLDITVVNMKKGEVALARIPPEHAFG  375


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 73/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G L DGT F  
Sbjct  275  DLELVSWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVRVRLIGKLEDGTVFVK  329

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   PF+F   + QVI+G D  +  MKKGE  +  IPP+ A+G + +      +PPN
Sbjct  330  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALARIPPEHAFGSAETKQDLAVVPPN  389

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  390  STVFYEVELVSF  401



>ref|XP_008382577.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Malus 
domestica]
Length=567

 Score =   370 bits (951),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 202/231 (87%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMP AE   +D DLP + P +KVGEEK IG QGLKKKL+KEG GW+ P+ GDEVEVH
Sbjct  3    EDFDMPAAEEMNEDFDLPGEGPALKVGEEKGIGTQGLKKKLLKEGEGWDNPKNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPP IPP+ATLQFDVELLSW S+ DI KDGGI KK+L EGEKWENPKD DEV V +EA+
Sbjct  123  GSPPKIPPSATLQFDVELLSWTSINDISKDGGIIKKILKEGEKWENPKDLDEVIVNFEAQ  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LED TLVAK   VEFTV++G+FCPA++KAVKTMKKGEKV LTVKPQYGFG+
Sbjct  183  LEDKTLVAKYQAVEFTVKDGYFCPAISKAVKTMKKGEKVLLTVKPQYGFGD  233


 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V++   L D T     +      +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIVNFEAQLEDKTLVAKYQ----AVEFTVKDGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +G+ G P +     +PPN TL   +EL+SW +V ++ 
Sbjct  208  ISKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGSEGAVPPNTTLHITLELVSWRTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DG    K       D+ EF  +E   
Sbjct  268  DDKKVIKKILKEGEGYERPNEGAVVKLKLTGKLQDGKEFLKKGHVEGEDLFEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV+TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDRAVQTMKKGEVALLTIAPEYAFG  355


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++  TG L DG +F      +    F+F   + QVI
Sbjct  269  DKKVIKKILKEGEGYERPNEGAVVKLKLTGKLQDGKEFLKKGHVEGEDLFEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGE---SGSPPTIPPNATLQFDVELLSW  488
             G D+ ++TMKKGE  + TI P+ A+G          +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVQTMKKGEVALLTIAPEYAFGSVEFQQELAVVPPNSTVNYEVELVSF  381



>ref|XP_010100792.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
 gb|EXB84490.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis]
Length=547

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 214/233 (92%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDM---PPAEMDD-LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            ED ++   PP  MD+  DL D++P++KVGEEKEIG QGLKKKL+K+G GW+TPE GDEVE
Sbjct  3    EDINLNAPPPEGMDEGFDLLDESPMLKVGEEKEIGKQGLKKKLLKQGEGWDTPETGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L EGEKWENPKDPDEV VK+E
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGVFKKILTEGEKWENPKDPDEVLVKFE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+VAKSD VEFTV+EG+FCPAL+KAVKTMKKGEKV LTVKPQYGFG+
Sbjct  183  ARLEDGTVVAKSDGVEFTVKEGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGD  235


 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 109/200 (55%), Gaps = 16/200 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V +   L DGT    S       +FT+ +G     
Sbjct  154  DGGVFKKILTEGEKWENPKDPDEVLVKFEARLEDGTVVAKSDG----VEFTVKEGYFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +G++G P T     +PPNATL+  +ELLSW +V ++ 
Sbjct  210  LSKAVKTMKKGEKVLLTVKPQYGFGDTGKPATAGEGAVPPNATLEITLELLSWKTVTEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT+  K       ++ EF  EE   
Sbjct  270  -DDKVVKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHEEGEELFEFKTEEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLT  731
               L  AV TMKKGE++ + 
Sbjct  329  IDGLDTAVLTMKKGEELAVV  348


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 18/118 (15%)
 Frame = +3

Query  156  EIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQG  329
            E+ D  + KK++KEG G+E P  G  V++   G L DGT F     + G   F+F   + 
Sbjct  267  EVTDDKVVKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHEEGEELFEFKTEEE  326

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKD  503
            QVI G D  + TMKKGE        +LA         +PPN+T+ +++EL S+V  K+
Sbjct  327  QVIDGLDTAVLTMKKGE--------ELA--------VVPPNSTVYYEIELESFVKEKE  368



>ref|XP_002865651.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41910.1| hypothetical protein ARALYDRAFT_494919 [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +3

Query  99   MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF  278
            + D D  D  P +K+GEEKEIG  GLKKKLVKEG  W+TPE GDEVEVHYTGTLLDGTKF
Sbjct  22   LADDDEADSAPNLKIGEEKEIGKSGLKKKLVKEGEKWDTPENGDEVEVHYTGTLLDGTKF  81

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNAT  458
            DSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNAT
Sbjct  82   DSSRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNAT  141

Query  459  LQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSD  638
            LQFDVEL+SW SVKDIC DGG+FKK++ EGEKWE PKD DEV VKYEARLEDGT+V +SD
Sbjct  142  LQFDVELISWRSVKDICGDGGVFKKIIVEGEKWEKPKDLDEVFVKYEARLEDGTIVGRSD  201

Query  639  IVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
              EFTV+EGHFCPAL KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  202  GAEFTVKEGHFCPALAKAVKTMKRGEKVLLTVKPQYGFGE  241


 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 114/210 (54%), Gaps = 16/210 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+ +G    
Sbjct  159  GDGGVFKKIIVEGEKWEKPKDLDEVFVKYEARLEDGTIVG----RSDGAEFTVKEGHFCP  214

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE+G P +      IPPNATLQ D+EL+SW +V +
Sbjct  215  ALAKAVKTMKRGEKVLLTVKPQYGFGETGIPASDGLQAAIPPNATLQIDLELVSWKTVVE  274

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI------VEFTVEEG  665
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K          EF  +E 
Sbjct  275  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFMKKGYEEDEEPFEFKTDEE  334

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L KAV  MKKGE   +T+ P+Y FG
Sbjct  335  QVIEGLEKAVMGMKKGEVALITISPEYAFG  364


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 90/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  278
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  263  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFMK  317

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  449
                +   PF+F   + QVI+G ++ +  MKKGE  + TI P+ A+G S S      IPP
Sbjct  318  KGYEEDEEPFEFKTDEEQVIEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPP  377

Query  450  NATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
            N+T+ ++VE++S++  K+   D    +K+ A G+K E
Sbjct  378  NSTVFYEVEMVSFIKEKESW-DMNTQEKIEAAGKKKE  413



>emb|CDY15104.1| BnaC03g44650D [Brassica napus]
Length=277

 Score =   358 bits (920),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 201/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGEGFETPENGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELLSW SVKDICKDGG+FKK++A GEKWE PKD DEV VKY 
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICKDGGVFKKIVAAGEKWETPKDLDEVLVKYV  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+V KSD VEFTV++G+FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  AKLEDGTVVGKSDGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  234


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V  G  WETP+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWETPKDLDEVLVKYVAKLEDGTVVGKSDG----VEFTVKDGYFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSV  497
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW  V
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASAGEAAVPPNATLEIELELVSWKGV  264



>ref|XP_006280236.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
 gb|EOA13134.1| hypothetical protein CARUB_v10026151mg [Capsella rubella]
Length=575

 Score =   369 bits (947),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 202/239 (85%), Gaps = 11/239 (5%)
 Frame = +3

Query  72   EDFDMP------PAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  221
            +DFDM       P EMD +DLP+D     P +K+GEEKEIG  GLKKKLVKEG  W+TPE
Sbjct  3    DDFDMQQFPADEPEEMD-MDLPEDEADSAPYLKIGEEKEIGGLGLKKKLVKEGEKWDTPE  61

Query  222  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  401
             GDEVEVHY GTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  +FTIP
Sbjct  62   NGDEVEVHYIGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGEHAVFTIP  121

Query  402  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDE  581
             +LAYGE+GSPPTIPPNATLQFDVEL+SW SVKDIC DGG++KK++ EGEKWE PKD DE
Sbjct  122  SELAYGETGSPPTIPPNATLQFDVELISWRSVKDICGDGGVYKKIIVEGEKWEKPKDLDE  181

Query  582  VSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V VKYEARLEDGT+V KSD  EFTV+EGHFCPAL KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  182  VCVKYEARLEDGTIVGKSDGAEFTVKEGHFCPALAKAVKTMKRGEKVILTVKPQYGFGE  240


 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 113/210 (54%), Gaps = 16/210 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G    
Sbjct  158  GDGGVYKKIIVEGEKWEKPKDLDEVCVKYEARLEDGTIVGKSDGA----EFTVKEGHFCP  213

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  I T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  214  ALAKAVKTMKRGEKVILTVKPQYGFGEIGRPASDGFQAAIPPNATLQIDLELVSWKTVVE  273

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEG  665
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K       +  EF  +E 
Sbjct  274  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHEEEEEPFEFKTDEE  333

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L KAV  MKKGE   + + P+Y FG
Sbjct  334  QVIEGLEKAVMGMKKGEVAFIMISPEYAFG  363


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 88/157 (56%), Gaps = 11/157 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  278
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  262  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  316

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  449
                +   PF+F   + QVI+G ++ +  MKKGE     I P+ A+G S S      IPP
Sbjct  317  KGHEEEEEPFEFKTDEEQVIEGLEKAVMGMKKGEVAFIMISPEYAFGSSESKQELAVIPP  376

Query  450  NATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
            N+T+ ++VEL+S++  K+   D    +K+ A G+K E
Sbjct  377  NSTVSYEVELVSFIKEKE-SWDMNTQEKIEAAGKKKE  412



>ref|XP_009406340.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   369 bits (946),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 206/233 (88%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPAE----MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            +DFD+P  E     D +DL DDNP +KVGEEKEIG QGL+KKLVKEG GW+ PE GDEVE
Sbjct  3    DDFDLPVGEETMDEDPMDLDDDNPTLKVGEEKEIGKQGLRKKLVKEGEGWDHPEAGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDG+KFDSSRDRGTPF+F LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYG
Sbjct  63   VHYTGTLLDGSKFDSSRDRGTPFRFNLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
             SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L +G+KW+NPKD DEV V+YE
Sbjct  123  ASGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILTDGDKWDNPKDRDEVLVRYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+V+KS+ VEFT+ +G+FCPAL+KAVKTMKKGEKV LTV PQY FGE
Sbjct  183  ARLEDGTVVSKSEGVEFTLRDGYFCPALSKAVKTMKKGEKVLLTVMPQYAFGE  235


 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ +G  W+ P+  DEV V Y   L DGT    S       +FTL  G     
Sbjct  154  DGGIFKKILTDGDKWDNPKDRDEVLVRYEARLEDGTVVSKSEG----VEFTLRDGYFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE     SG    +PP+ATL  D+EL+SW +V +I 
Sbjct  210  LSKAVKTMKKGEKVLLTVMPQYAFGEDGRQASGDEGAVPPSATLHIDLELVSWKTVTEIG  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE +E P D   V VK   +L+DGT+  K      +  EF  +E    
Sbjct  270  NDKKIIKKILKEGEGYERPNDGAVVKVKLIGKLDDGTVFVKKGHDGDEPFEFKTDEEQVI  329

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV +MKKGE   +T+ P++ F 
Sbjct  330  EGLDQAVMSMKKGEIAYVTIPPEHAFN  356


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 71/126 (56%), Gaps = 5/126 (4%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G+E P  G  V+V   G L DGT F     D   PF+F   + QVI+G DQ + +MK
Sbjct  281  EGEGYERPNDGAVVKVKLIGKLDDGTVFVKKGHDGDEPFEFKTDEEQVIEGLDQAVMSMK  340

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLA  542
            KGE    TIPP+ A+    S      +PPN+T+ +++EL+S+V  K+   D    +K+ A
Sbjct  341  KGEIAYVTIPPEHAFNRVESKQDLAVVPPNSTVHYEIELVSFVKEKESW-DLNTAEKIEA  399

Query  543  EGEKWE  560
             G+K E
Sbjct  400  AGKKKE  405



>ref|NP_001052535.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|AAD29708.2|AF140495_1 FK506-binding protein [Oryza sativa Japonica Group]
 emb|CAE05842.2| OSJNBa0091C07.4 [Oryza sativa Japonica Group]
 dbj|BAF14449.1| Os04g0352400 [Oryza sativa Japonica Group]
 gb|EAZ30344.1| hypothetical protein OsJ_14391 [Oryza sativa Japonica Group]
 dbj|BAG94794.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77072.1| hypothetical protein OsI_15470 [Oryza sativa Indica Group]
Length=585

 Score =   369 bits (946),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 202/222 (91%), Gaps = 3/222 (1%)
 Frame = +3

Query  102  DDLDLPDDN--PV-MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGT  272
            D+LD   D+  PV MKVGEEKEIG QGL+K+L+KEG GW+ PE GDEV+VHYTGTLLDGT
Sbjct  24   DELDEEGDSSSPVAMKVGEEKEIGKQGLRKRLLKEGEGWDRPESGDEVQVHYTGTLLDGT  83

Query  273  KFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPN  452
            KFDSSRDRGTPFKF+LGQG+VIKGWD+GIKTMKKGE  +FT+PP+LAYGE+GSPP IPPN
Sbjct  84   KFDSSRDRGTPFKFSLGQGEVIKGWDEGIKTMKKGEQAVFTVPPELAYGEAGSPPAIPPN  143

Query  453  ATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK  632
            ATL+FDVELLSW SVKDICKDGGIFKKVLAEG KWENPKD DEV VKYEARLEDGT+V+K
Sbjct  144  ATLRFDVELLSWASVKDICKDGGIFKKVLAEGHKWENPKDLDEVLVKYEARLEDGTVVSK  203

Query  633  SDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            SD VEF V++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  204  SDGVEFAVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  245


 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 121/234 (52%), Gaps = 15/234 (6%)
 Frame = +3

Query  87   PPAEMDDLDLPDDNPVMKVGEEKEI-GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            PPA   +  L  D  ++     K+I  D G+ KK++ EG  WE P+  DEV V Y   L 
Sbjct  137  PPAIPPNATLRFDVELLSWASVKDICKDGGIFKKVLAEGHKWENPKDLDEVLVKYEARLE  196

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-  440
            DGT    S       +F +  G       + +KTMKKGE  + T+ P   +GE G P + 
Sbjct  197  DGTVVSKS----DGVEFAVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGEQGKPASG  252

Query  441  ----IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
                +PPNATL  D+ELLSW +V  I  D  I KKVL EGE +E P D   V V++  +L
Sbjct  253  AEAAVPPNATLYVDLELLSWKTVTLIGDDKRILKKVLKEGEGYERPNDGAVVRVRFIGKL  312

Query  609  EDGTLVAKS-----DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            EDGT+ +K      +  EF  +E      L + V TMKKGE   + + PQ+ FG
Sbjct  313  EDGTVFSKKGHDGDEPFEFRTDEEQVIEGLDRTVVTMKKGEVALVRLPPQHAFG  366


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V  +G++K I      KK++KEG G+E P  G  V V + G L DGT F  
Sbjct  266  DLELLSWKTVTLIGDDKRI-----LKKVLKEGEGYERPNDGAVVRVRFIGKLEDGTVFSK  320

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   PF+F   + QVI+G D+ + TMKKGE  +  +PP  A+G + +      +P N
Sbjct  321  KGHDGDEPFEFRTDEEQVIEGLDRTVVTMKKGEVALVRLPPQHAFGSTETKQDLAVVPAN  380

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  381  STVWYEVELVSF  392



>ref|NP_001062292.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAD11570.1| putative 70 kDa peptidylprolyl isomerase [Oryza sativa Japonica 
Group]
 dbj|BAF24206.1| Os08g0525600 [Oryza sativa Japonica Group]
 dbj|BAG95934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=580

 Score =   369 bits (946),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 187/240 (78%), Positives = 202/240 (84%), Gaps = 12/240 (5%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLP-----------DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETP  218
            +DF+MPP   DD DL             D P +KVGEEKEIG QGL+KKL+KEG GWETP
Sbjct  3    DDFEMPPPGADD-DLMMGEDGMGDFGGADGPPLKVGEEKEIGKQGLRKKLLKEGEGWETP  61

Query  219  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  398
            E GDEVEVHYTGTLLDG KFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTI
Sbjct  62   EVGDEVEVHYTGTLLDGKKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTI  121

Query  399  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPD  578
            PPDLAYGESGSPPTIP +ATLQFDVELLSW SVKDIC+DGGIFKK+L EGEKWENPKD D
Sbjct  122  PPDLAYGESGSPPTIPASATLQFDVELLSWTSVKDICQDGGIFKKILKEGEKWENPKDLD  181

Query  579  EVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EV VKYEARLEDGT+++KS+  EFTV++G FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  EVFVKYEARLEDGTVISKSEGAEFTVKDGFFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  241


 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  160  DGGIFKKILKEGEKWENPKDLDEVFVKYEARLEDGTVI--SKSEGA--EFTVKDGFFCPA  215

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE+G P       +PPNATL  ++EL+SW +V +I 
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGENGRPAAGEEGAVPPNATLLVNLELVSWKTVTEIG  275

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KKVL EG  +E P +   V VK   +L+DGT+  K      +  EF  +E    
Sbjct  276  DDKKILKKVLTEGTGYERPNEGAVVKVKITGKLQDGTIFTKKGHDEPEPFEFKTDEEEVI  335

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              + +AV  MK GE   +T+ P+Y FG
Sbjct  336  DGIDRAVLNMKNGEVALVTIPPEYAFG  362


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = +3

Query  156  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQG  329
            EIGD + + KK++ EG G+E P  G  V+V  TG L DGT F     D   PF+F   + 
Sbjct  273  EIGDDKKILKKVLTEGTGYERPNEGAVVKVKITGKLQDGTIFTKKGHDEPEPFEFKTDEE  332

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
            +VI G D+ +  MK GE  + TIPP+ A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  333  EVIDGIDRAVLNMKNGEVALVTIPPEYAFGSTESKQDLAVVPPNSTVIYEVELVSFVKDK  392

Query  501  D  503
            +
Sbjct  393  E  393



>ref|XP_006659596.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=579

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 204/239 (85%), Gaps = 10/239 (4%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDN----------PVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  221
            +DFDMP    +D+ + +D           PV+KVGEEKEIG QGL+KKL+KEG GWETPE
Sbjct  3    DDFDMPLPGAEDMMMGEDGMGDFGGGDDGPVLKVGEEKEIGKQGLRKKLLKEGEGWETPE  62

Query  222  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  401
             GDEVEVHYTGTL+DGTKFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTIP
Sbjct  63   VGDEVEVHYTGTLVDGTKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENALFTIP  122

Query  402  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDE  581
             DLAYGE+GSPPTIPP+ATLQFDVELLSW SVKDICKDGG+FKK+L EGEKWENPKD DE
Sbjct  123  ADLAYGETGSPPTIPPSATLQFDVELLSWTSVKDICKDGGLFKKILKEGEKWENPKDLDE  182

Query  582  VSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V VKYEARLEDGT+V+KS+  EFTV++G FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  183  VFVKYEARLEDGTVVSKSEGAEFTVKDGLFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  241


 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  160  DGGLFKKILKEGEKWENPKDLDEVFVKYEARLEDGTVV--SKSEGA--EFTVKDGLFCPA  215

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GESG P       +PPNATL  D+EL+SW +V +I 
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGESGRPAAGEEGAVPPNATLLVDLELVSWKTVTEIG  275

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KKVL EGE +E P +   V VK   +L+DGT+ +K      +  EF  +E    
Sbjct  276  DDKKILKKVLKEGEGYERPNEGAVVKVKITGKLQDGTVFSKKGHDELEPFEFKTDEEEVI  335

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV  MKKGE   +T+ P+Y FG
Sbjct  336  DGLDRAVLNMKKGEVALVTIPPEYAFG  362


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (60%), Gaps = 9/137 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V ++G++K+I      KK++KEG G+E P  G  V+V  TG L DGT F  
Sbjct  262  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVKVKITGKLQDGTVFSK  316

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   PF+F   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN
Sbjct  317  KGHDELEPFEFKTDEEEVIDGLDRAVLNMKKGEVALVTIPPEYAFGSAESKQDIAVVPPN  376

Query  453  ATLQFDVELLSWVSVKD  503
            +T+ ++VEL+S+V  K+
Sbjct  377  STVIYEVELVSFVKDKE  393



>ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis 
sativus]
 gb|KGN44652.1| hypothetical protein Csa_7G363060 [Cucumis sativus]
Length=553

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 200/231 (87%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPV--MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFD+P A     DL   +    +KVGEEKEIG+QGLKKKL+KEG GW TPE GDEVEVH
Sbjct  3    EDFDIPAAPDMPDDLDLPDQTVPLKVGEEKEIGNQGLKKKLLKEGEGWVTPESGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKK E  +FTIPPDLAYGES
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKNEKALFTIPPDLAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPP+ATLQFDVELLSW SVKDICKDGGIFKK+L EG+KWENPKD DEV V +EA+
Sbjct  123  GSPPTIPPSATLQFDVELLSWTSVKDICKDGGIFKKILTEGDKWENPKDLDEVLVNFEAK  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGTL+AK+D VEFTV +G+FCPAL KAVKTMK GEK  LTVKPQYGFGE
Sbjct  183  LEDGTLIAKADGVEFTVADGYFCPALAKAVKTMKLGEKALLTVKPQYGFGE  233


 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 107/208 (51%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V++   L DGT       +    +FT+  G     
Sbjct  152  DGGIFKKILTEGDKWENPKDLDEVLVNFEAKLEDGTLIA----KADGVEFTVADGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMK GE  + T+ P   +GE G         +PPNA+L   +EL+SW +V ++ 
Sbjct  208  LAKAVKTMKLGEKALLTVKPQYGFGEKGKSARGNEGAVPPNASLDITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P D   V VK   +L DG +  +       +  EF  +E   
Sbjct  268  PDKKVIKKILKEGEGYEKPNDGAIVKVKLIGKLGDGKIFLRKGHEDGEEPYEFKTDEEQV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDKAVVTMKKGEIALLTIAPEYAFG  355


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V+V   G L DG  F      D   P++F   + QVI
Sbjct  269  DKKVIKKILKEGEGYEKPNDGAIVKVKLIGKLGDGKIFLRKGHEDGEEPYEFKTDEEQVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ ++VEL+++
Sbjct  329  DGLDKAVVTMKKGEIALLTIAPEYAFGSSESQQDLAVVPPNSTVYYEVELVAF  381



>gb|EEC83911.1| hypothetical protein OsI_29964 [Oryza sativa Indica Group]
 gb|EEE69029.1| hypothetical protein OsJ_28006 [Oryza sativa Japonica Group]
Length=583

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/240 (78%), Positives = 202/240 (84%), Gaps = 12/240 (5%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLP-----------DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETP  218
            +DF+MPP   DD DL             D P +KVGEEKEIG QGL+KKL+KEG GWETP
Sbjct  3    DDFEMPPPGADD-DLMMGEDGMGDFGGADGPPLKVGEEKEIGKQGLRKKLLKEGEGWETP  61

Query  219  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  398
            E GDEVEVHYTGTLLDG KFDSSRDRGTPFKF LGQGQVIKGWD GIKTMKKGE  +FTI
Sbjct  62   EVGDEVEVHYTGTLLDGKKFDSSRDRGTPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTI  121

Query  399  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPD  578
            PPDLAYGESGSPPTIP +ATLQFDVELLSW SVKDIC+DGGIFKK+L EGEKWENPKD D
Sbjct  122  PPDLAYGESGSPPTIPASATLQFDVELLSWTSVKDICQDGGIFKKILKEGEKWENPKDLD  181

Query  579  EVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EV VKYEARLEDGT+++KS+  EFTV++G FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  EVFVKYEARLEDGTVISKSEGAEFTVKDGFFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  241


 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  160  DGGIFKKILKEGEKWENPKDLDEVFVKYEARLEDGTVI--SKSEGA--EFTVKDGFFCPA  215

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE+G P       +PPNATL  ++EL+SW +V +I 
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGENGRPAAGEEGAVPPNATLLVNLELVSWKTVTEIG  275

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KKVL EG  +E P +   V VK   +L+DGT+  K      +  EF  +E    
Sbjct  276  DDKKILKKVLTEGTGYERPNEGAVVKVKITGKLQDGTIFTKKGHDEPEPFEFKTDEEEVI  335

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              + +AV  MK GE   +T+ P+Y FG
Sbjct  336  DGIDRAVLNMKNGEVALVTIPPEYAFG  362


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = +3

Query  156  EIGD-QGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQG  329
            EIGD + + KK++ EG G+E P  G  V+V  TG L DGT F     D   PF+F   + 
Sbjct  273  EIGDDKKILKKVLTEGTGYERPNEGAVVKVKITGKLQDGTIFTKKGHDEPEPFEFKTDEE  332

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
            +VI G D+ +  MK GE  + TIPP+ A+G + S      +PPN+T+ ++VEL+S+V  K
Sbjct  333  EVIDGIDRAVLNMKNGEVALVTIPPEYAFGSTESKQDLAVVPPNSTVIYEVELVSFVKDK  392

Query  501  D  503
            +
Sbjct  393  E  393



>emb|CDY15103.1| BnaC03g44640D [Brassica napus]
Length=558

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 201/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGEGFETPENGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELLSW SVKDICKDGG+FKK++A GEKWE PKD DEV VKY 
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICKDGGVFKKIVAAGEKWETPKDLDEVLVKYV  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+V KSD VEFTV++G+FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  AKLEDGTVVGKSDGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  234


 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V  G  WETP+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWETPKDLDEVLVKYVAKLEDGTVVGKS----DGVEFTVKDGYFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASAGEAAVPPNATLEIELELVSWKTVSEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L DGT+  K       +  EF  +E   
Sbjct  269  DDNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGEGEEPFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KA+  MKKGE   +T+ P Y FG
Sbjct  329  IDGLDKALLKMKKGEVALVTIDPVYAFG  356


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P  A+G + S      +PPN+T+ ++V+L+S+
Sbjct  330  DGLDKALLKMKKGEVALVTIDPVYAFGSTESKQELAVVPPNSTVYYEVDLVSF  382



>ref|XP_008439052.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis melo]
Length=575

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 205/234 (88%), Gaps = 5/234 (2%)
 Frame = +3

Query  72   EDFDMPPAEM--DDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            +DF+ P A    +++ LP+D   +PV+KVGEEKEIG  GLKKKLVKEG GWETP+ GDEV
Sbjct  3    DDFEFPSASNVDEEMGLPEDEAESPVLKVGEEKEIGKNGLKKKLVKEGEGWETPDTGDEV  62

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTL+DGT+FDSSRDRGTPFKF LG+GQVIKGWD+GI+TMKKGE  IFTIPP+LAY
Sbjct  63   EVHYTGTLIDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIRTMKKGENAIFTIPPELAY  122

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GESGSPPTIPPNATLQFDVELLSW SVKDIC+DGGI KK+L +G+ WE PKD DEV V+Y
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWHSVKDICQDGGILKKILVKGDGWEKPKDLDEVWVRY  182

Query  597  EARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EARLE+GTL++KSD VEFTVE+G+FCPAL  AVKTMKKGEK  LTV+PQYGFGE
Sbjct  183  EARLENGTLISKSDGVEFTVEKGYFCPALATAVKTMKKGEKALLTVRPQYGFGE  236


 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 108/206 (52%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ +G GWE P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  155  DGGILKKILVKGDGWEKPKDLDEVWVRYEARLENGTLISKS----DGVEFTVEKGYFCPA  210

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
                +KTMKKGE  + T+ P   +GESG P       +PPN TLQ  ++L SW +V +I 
Sbjct  211  LATAVKTMKKGEKALLTVRPQYGFGESGRPVDGEEGAVPPNGTLQITLQLDSWKTVTEIT  270

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            KD  + KK   EGE +E P +   V VK   +L DGT+  K        EF ++E     
Sbjct  271  KDKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLADGTIFTKKGDDEKPFEFKIDEEQVVE  330

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L  AV+ MKKGE   +T+ PQY FG
Sbjct  331  GLDLAVRKMKKGEIASVTIHPQYAFG  356


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 75/135 (56%), Gaps = 3/135 (2%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK  KEG G+E P  G  V+V  TG L DGT F    D   PF+F + + QV++G
Sbjct  272  DKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLADGTIFTKKGDDEKPFEFKIDEEQVVEG  331

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D  ++ MKKGE    TI P  A+G S S      +P N+ + ++VEL+S+V  K+    
Sbjct  332  LDLAVRKMKKGEIASVTIHPQYAFGSSDSSQDLAVVPANSIVHYEVELVSFVKEKESWDL  391

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  392  NKAEEKIEAAGKKKE  406



>ref|XP_011651108.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis sativus]
 gb|KGN57238.1| hypothetical protein Csa_3G172920 [Cucumis sativus]
Length=575

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 203/234 (87%), Gaps = 5/234 (2%)
 Frame = +3

Query  72   EDFDMPPAEMDD--LDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            +DF+ P A   D  + LP+D   +PV+ VG+EKEIG  GLKKKLVKEG GWETP+ GDEV
Sbjct  3    DDFEFPSASNVDEEMGLPEDEAESPVLNVGQEKEIGKNGLKKKLVKEGEGWETPDTGDEV  62

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTLLDGT+FDSSRDRGTPFKF LG+GQVIKGWD+GI+TMKKGE  +FTIPP+LAY
Sbjct  63   EVHYTGTLLDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIRTMKKGENAVFTIPPELAY  122

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GESGSPPTIPPNATLQFDVELLSW SVKDIC+DGGI KK+L +G+ WE PKD DEV V+Y
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWHSVKDICQDGGILKKILVKGDGWEKPKDLDEVLVRY  182

Query  597  EARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EARLE+GTL++KSD VEFTVE+G+FCPAL  AVKTMKKGEK  LTV+PQYGFGE
Sbjct  183  EARLENGTLISKSDGVEFTVEKGYFCPALATAVKTMKKGEKALLTVRPQYGFGE  236


 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 108/206 (52%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ +G GWE P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  155  DGGILKKILVKGDGWEKPKDLDEVLVRYEARLENGTLISKS----DGVEFTVEKGYFCPA  210

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
                +KTMKKGE  + T+ P   +GESG P +     +PPN TLQ  ++L S  +V +I 
Sbjct  211  LATAVKTMKKGEKALLTVRPQYGFGESGRPVSGEEGAVPPNGTLQITLQLDSLKTVTEIT  270

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            KD  + KK   EGE +E P +   V VK   +L DGT+  K        EF ++E     
Sbjct  271  KDKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLGDGTIFTKKGDDERTFEFKIDEEQVIE  330

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L  AV+ MKKGE   +T+ PQY FG
Sbjct  331  GLDLAVRKMKKGEIALVTIHPQYAFG  356


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK  KEG G+E P  G  V+V  TG L DGT F    D    F+F + + QVI+G
Sbjct  272  DKKVLKKTQKEGEGYEQPNEGAVVQVKLTGKLGDGTIFTKKGDDERTFEFKIDEEQVIEG  331

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D  ++ MKKGE  + TI P  A+G S S      +P N+T+ ++VEL+S+V  K+    
Sbjct  332  LDLAVRKMKKGEIALVTIHPQYAFGSSDSSQDLAVVPANSTVYYEVELVSFVKEKESWDL  391

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  392  NKAEEKIEAAGKKKE  406



>emb|CDY52281.1| BnaA03g57740D [Brassica napus]
Length=558

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 201/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGEGFETPENGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELLSW SVKDICKDGG+FKK++A GEKWE PKD DEV VKY 
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICKDGGVFKKIVAAGEKWEMPKDLDEVLVKYV  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+V KSD VEFTV++G+FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  AKLEDGTVVGKSDGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  234


 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V  G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWEMPKDLDEVLVKYVAKLEDGTVVGKS----DGVEFTVKDGYFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASGGEAAVPPNATLEIELELVSWKTVSEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L DGT+  K       +  EF  +E   
Sbjct  269  DDNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGEGEEPFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV  MKKGE   +T+ P+Y FG
Sbjct  329  IDGLDKAVLKMKKGEVALVTIDPEYAFG  356


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+TL ++V+L+S+
Sbjct  330  DGLDKAVLKMKKGEVALVTIDPEYAFGSTESKQELAVVPPNSTLYYEVDLVSF  382



>gb|AFK48238.1| unknown [Lotus japonicus]
Length=547

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 198/230 (86%), Gaps = 6/230 (3%)
 Frame = +3

Query  72   EDFDMPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            E  D+PP E   +D DLP+D    +VGEE+EIG+ GL+KKL+KEG GWETPE GDEV+VH
Sbjct  3    EVMDIPPMEAMNEDFDLPED----EVGEEREIGNSGLRKKLLKEGQGWETPEVGDEVQVH  58

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDG+KFDSSRDR  PF FTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  59   YTGTLLDGSKFDSSRDRDAPFSFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  118

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW S+KDI KDGGI+KK+L EGEKWENPKD DEV VKYE  
Sbjct  119  GSPPTIPPNATLQFDVELLSWTSLKDISKDGGIYKKILTEGEKWENPKDLDEVLVKYEVH  178

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            LEDG LVAKSD VEFTV EGH+CPAL+KAVKTMKKGEKV L VK QYGFG
Sbjct  179  LEDGKLVAKSDGVEFTVREGHYCPALSKAVKTMKKGEKVILKVKAQYGFG  228


 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 110/207 (53%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG K  +  D     +FT+ +G     
Sbjct  148  DGGIYKKILTEGEKWENPKDLDEVLVKYEVHLEDG-KLVAKSD---GVEFTVREGHYCPA  203

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I  +     +G  G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  204  LSKAVKTMKKGEKVILKVKAQYGFGVKGQPAHGDEGAVPPNATLQITLELVSWKTVSEVT  263

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L +GE +E P +   V +K   +L+DGT+  K      ++ EF  +E    
Sbjct  264  GDKKIIKKILKDGEGFERPNEGAIVKLKLIGKLQDGTVFLKKGHDEEELFEFKTDEEQVI  323

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKK E   LT+ P+Y FG
Sbjct  324  DGLDRAVMTMKKSEVALLTIAPEYAFG  350


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  338
            GD+ + KK++K+G G+E P  G  V++   G L DGT F     D    F+F   + QVI
Sbjct  264  GDKKIIKKILKDGEGFERPNEGAIVKLKLIGKLQDGTVFLKKGHDEEELFEFKTDEEQVI  323

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKK E  + TI P+ A+G S S      IPPN+T+ ++VEL+S+
Sbjct  324  DGLDRAVMTMKKSEVALLTIAPEYAFGISESQQELAVIPPNSTVYYEVELVSF  376


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 4/86 (5%)
 Frame = +3

Query  513  DGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCPA  680
            + G+ KK+L EG+ WE P+  DEV V Y   L DG+    S        FT+ +G     
Sbjct  32   NSGLRKKLLKEGQGWETPEVGDEVQVHYTGTLLDGSKFDSSRDRDAPFSFTLGQGQVIKG  91

Query  681  LTKAVKTMKKGEKVQLTVKPQYGFGE  758
              + +KTMKKGE    T+ P+  +GE
Sbjct  92   WDEGIKTMKKGENALFTIPPELAYGE  117



>ref|XP_006418643.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
 gb|ESQ37079.1| hypothetical protein EUTSA_v10002468mg [Eutrema salsugineum]
Length=550

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/233 (81%), Positives = 200/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+MPP    + D   D       +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNDDDDMDFGDAASFLKVGEEKEI-QQGLKKKLVKEGEGFETPENGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELLSW SVKDICKDGG+FKK+L+ GEKWE PKD DEV VKYE
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICKDGGVFKKILSVGEKWETPKDLDEVLVKYE  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+V KSD VEFTV++GHFCPALTKAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  ARLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKAEKVLLTVKPQYGFGE  234


 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 111/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++  G  WETP+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILSVGEKWETPKDLDEVLVKYEARLEDGTVVGKS----DGVEFTVKDGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+  +EL+SW +V ++ 
Sbjct  209  LTKAVKTMKKAEKVLLTVKPQYGFGEKGKPASGGEGAVPPNATLEITLELVSWKTVSEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       +  EF  +E   
Sbjct  269  DDNKVIKKILKEGEGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGEGEEPFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +T++P+Y FG
Sbjct  329  IDGLDRAVMKMKKGEVALVTIEPEYAFG  356


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+TL ++++L+++
Sbjct  330  DGLDRAVMKMKKGEVALVTIEPEYAFGSTESKQELAVVPPNSTLYYEIDLVAF  382



>gb|ABK24451.1| unknown [Picea sitchensis]
Length=578

 Score =   366 bits (940),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 201/231 (87%), Gaps = 5/231 (2%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            +DF++P     M++ DL  +  V KVGEEKEIG QGLKK LVKEG GWETPE GDEVEVH
Sbjct  3    DDFELPEGAGLMENEDL--NETVFKVGEEKEIGKQGLKKLLVKEGEGWETPETGDEVEVH  60

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLD TKFDSSRDRGTPFKF LGQGQVIKGWDQGI TMKKGE  +FTIPP++AYGES
Sbjct  61   YTGTLLDSTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIATMKKGETAVFTIPPEMAYGES  120

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATL+FDVELLSW SVKDICKDGGIFKK++ EGEKWENPK+ DEV VKYEAR
Sbjct  121  GSPPTIPPNATLKFDVELLSWASVKDICKDGGIFKKIIKEGEKWENPKEADEVLVKYEAR  180

Query  606  LEDGTLVAKSDI-VEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            LEDGT+V+KS+  VEF V++G+FCPA  KAVKTMKKGEKV LTVKPQYGFG
Sbjct  181  LEDGTVVSKSEEGVEFYVKDGYFCPAFAKAVKTMKKGEKVLLTVKPQYGFG  231


 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 108/205 (53%), Gaps = 12/205 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S +     +F +  G     
Sbjct  150  DGGIFKKIIKEGEKWENPKEADEVLVKYEARLEDGTVVSKSEE---GVEFYVKDGYFCPA  206

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
            + + +KTMKKGE  + T+ P   +G  G         +PPNATL  D+EL+SW  V ++ 
Sbjct  207  FAKAVKTMKKGEKVLLTVKPQYGFGHKGRQAIGNDVAVPPNATLMVDLELVSWKVVDEVT  266

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  + KK+L +GE +E P D     VKY  +LEDGT+  K     +  EF   E     
Sbjct  267  DDKKVLKKILKQGEGYERPNDGAVAKVKYTGKLEDGTVFEKKGSDEEPFEFMTGEEQVVD  326

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGF  752
             L +AV TMKKGE   +TV  +YG+
Sbjct  327  GLDRAVMTMKKGEVALVTVAAEYGY  351


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 91/169 (54%), Gaps = 10/169 (6%)
 Frame = +3

Query  66   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            I  D  +PP    M DL+L     V +V ++K++      KK++K+G G+E P  G   +
Sbjct  238  IGNDVAVPPNATLMVDLELVSWKVVDEVTDDKKV-----LKKILKQGEGYERPNDGAVAK  292

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            V YTG L DGT F+       PF+F  G+ QV+ G D+ + TMKKGE  + T+  +  Y 
Sbjct  293  VKYTGKLEDGTVFEKKGSDEEPFEFMTGEEQVVDGLDRAVMTMKKGEVALVTVAAEYGYE  352

Query  420  E--SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
                     +PP +TL +DVEL+S+V  K+   D    +K+ A G+K E
Sbjct  353  TEIKTDLAVVPPKSTLIYDVELVSFVKEKESW-DMSTAEKIEAAGKKKE  400



>ref|XP_010493687.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65 [Camelina 
sativa]
Length=575

 Score =   365 bits (938),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 201/240 (84%), Gaps = 12/240 (5%)
 Frame = +3

Query  72   EDFDMP------PAEMDDLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWETP  218
            +DFDM       P EMD +DLPD +     P +K+GEEKEIG  GLKKKLVKEG  W+TP
Sbjct  3    DDFDMQQFPAEEPEEMD-MDLPDGDEADSAPYLKIGEEKEIGKSGLKKKLVKEGEKWDTP  61

Query  219  EPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTI  398
            E GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLG G VIKGWD GIKTMKKGE  +FTI
Sbjct  62   ENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGHGHVIKGWDIGIKTMKKGENAVFTI  121

Query  399  PPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPD  578
            PP+LAYGE+GSPPTIPPNATLQFDVEL+SW SVKD+C DGG+FKK + EGEKWE PKD D
Sbjct  122  PPELAYGETGSPPTIPPNATLQFDVELISWRSVKDVCGDGGVFKKTILEGEKWEKPKDLD  181

Query  579  EVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EV VKYEARLEDGT+V KSD  EFTV+EG+ CPAL KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  182  EVYVKYEARLEDGTIVGKSDGAEFTVKEGYLCPALAKAVKTMKRGEKVLLTVKPQYGFGE  241


 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 113/209 (54%), Gaps = 15/209 (7%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK + EG  WE P+  DEV V Y   L DGT    S       +FT+ +G +  
Sbjct  159  GDGGVFKKTILEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGA----EFTVKEGYLCP  214

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATL+ D+EL+SW +V +
Sbjct  215  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRPASDGCQAAIPPNATLEIDLELVSWKTVVE  274

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGH  668
            +  D  + KK+L EGE +E P +   V +K   +L+DGT+  K      +  EF  +E  
Sbjct  275  VTDDKKVIKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLKKGHEEEEPFEFKTDEEQ  334

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L KAV  MKKGE   + + P+Y FG
Sbjct  335  VIEGLEKAVMGMKKGEVAFIMIPPEYAFG  363


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 88/156 (56%), Gaps = 10/156 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V++V ++K++      KK++KEG G+E P  G  V++   G L DGT F  
Sbjct  263  DLELVSWKTVVEVTDDKKV-----IKKILKEGEGYERPNEGAVVKLKLIGKLQDGTVFLK  317

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               +   PF+F   + QVI+G ++ +  MKKGE     IPP+ A+G S S      IPPN
Sbjct  318  KGHEEEEPFEFKTDEEQVIEGLEKAVMGMKKGEVAFIMIPPEYAFGSSESKQELAVIPPN  377

Query  453  ATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
            +T+ ++VEL+ ++  K+   D    +K+ A G+K E
Sbjct  378  STVSYEVELVFFIKEKESW-DMNTQEKIEAAGKKKE  412



>ref|XP_006358774.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum 
tuberosum]
Length=580

 Score =   365 bits (938),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 199/228 (87%), Gaps = 3/228 (1%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTG  254
            D DM    MDD   PD  P+MKV EEKEIG  G+KKKL+KEG GWE P  GDEVEVHY G
Sbjct  21   DIDMGMG-MDDFSEPD--PIMKVDEEKEIGKTGIKKKLLKEGEGWEHPSKGDEVEVHYVG  77

Query  255  TLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  434
            TLLDGT+FDSSRDRGTPFKF LG+GQVIKGWD+GIKTMKKGE  + TIPPD+AYGESGSP
Sbjct  78   TLLDGTQFDSSRDRGTPFKFKLGEGQVIKGWDEGIKTMKKGEKALLTIPPDMAYGESGSP  137

Query  435  PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLED  614
            PTIPPNATLQF+VELLSW+SVKDICKDGGIFKK+L EGE W+NPK+ DEV VKYEARLED
Sbjct  138  PTIPPNATLQFEVELLSWISVKDICKDGGIFKKILVEGEGWQNPKNLDEVFVKYEARLED  197

Query  615  GTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GT+V+KSD VEFTV++G+FCPAL+KAVKTMKKGEKV LTV+PQY FGE
Sbjct  198  GTVVSKSDGVEFTVQDGYFCPALSKAVKTMKKGEKVLLTVQPQYAFGE  245


 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  164  DGGIFKKILVEGEGWQNPKNLDEVFVKYEARLEDGTVVSKS----DGVEFTVQDGYFCPA  219

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE+G   +     +PPNATLQ ++EL+SW  V ++ 
Sbjct  220  LSKAVKTMKKGEKVLLTVQPQYAFGETGKVASRDEGGVPPNATLQINLELISWKIVSEVT  279

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  + K++L EGE +E+P D   V VK   +L+DGT+  K      +  EF ++E    
Sbjct  280  NDKKVLKRILKEGEGYEHPNDGALVKVKLIGKLQDGTVFVKKGHDEEEPFEFKIDEEKVV  339

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAVK MKKGE   +T++P+Y FG
Sbjct  340  DGLDKAVKKMKKGEIALITMQPEYAFG  366


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (58%), Gaps = 5/137 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  338
             D+ + K+++KEG G+E P  G  V+V   G L DGT F     D   PF+F + + +V+
Sbjct  280  NDKKVLKRILKEGEGYEHPNDGALVKVKLIGKLQDGTVFVKKGHDEEEPFEFKIDEEKVV  339

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ +K MKKGE  + T+ P+ A+G   SP     +P N+ + ++VEL+S+V  K+  
Sbjct  340  DGLDKAVKKMKKGEIALITMQPEYAFGAFDSPQELAVVPGNSIVYYEVELVSFVKEKE-S  398

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  399  WDMNTQEKIEAAGKKKE  415



>ref|XP_004504385.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Cicer 
arietinum]
Length=571

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 201/233 (86%), Gaps = 6/233 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+ P +   D+++P+++    P+ KVGEEKEIG+ GLKKKLVKEG GWETP  GD+VE
Sbjct  3    EDFEFPTS--GDVEMPEEDEIVSPIHKVGEEKEIGNNGLKKKLVKEGEGWETPNTGDQVE  60

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR T FKF LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYG
Sbjct  61   VHYTGTLLDGTKFDSSRDRDTTFKFKLGEGQVIKGWDEGIKTMKKGENAIFTIPPELAYG  120

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDI KDGGI K ++ EGEKW+NPKD DEV VKYE
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDISKDGGILKNIITEGEKWDNPKDLDEVFVKYE  180

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDG +++KSD VEFTVEEG+FCPAL KAVKTMKKGEKV L VKP+Y FGE
Sbjct  181  ARLEDGAIISKSDGVEFTVEEGYFCPALAKAVKTMKKGEKVLLNVKPEYAFGE  233


 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGAIISKS----DGVEFTVEEGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P+ A+GE+G P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPEYAFGENGKPSSGDDGVVPPNASLQIDLELVSWKTVSDIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
            KD  + KK L EGE +E P D   V VK   +L+DGT+  K         EF ++E    
Sbjct  268  KDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFLKKGHDDDQPFEFKIDEEQVI  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVK MKKGE   + ++P+Y FG
Sbjct  328  DGLDRAVKNMKKGETALVIIQPEYAFG  354


 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFLKKGHDDDQPFEFKIDEEQVID  328

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ +K MKKGE  +  I P+ A+G SGSP    T+P N+TL ++VEL+S+V  K+   
Sbjct  329  GLDRAVKNMKKGETALVIIQPEYAFGPSGSPQELATVPHNSTLYYEVELISFVKEKE-SW  387

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G+K E
Sbjct  388  DLNTQEKIEAAGKKKE  403



>ref|XP_004504386.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Cicer 
arietinum]
Length=570

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 201/233 (86%), Gaps = 6/233 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+ P +   D+++P+++    P+ KVGEEKEIG+ GLKKKLVKEG GWETP  GD+VE
Sbjct  3    EDFEFPTS--GDVEMPEEDEIVSPIHKVGEEKEIGNNGLKKKLVKEGEGWETPNTGDQVE  60

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR T FKF LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYG
Sbjct  61   VHYTGTLLDGTKFDSSRDRDTTFKFKLGEGQVIKGWDEGIKTMKKGENAIFTIPPELAYG  120

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDI KDGGI K ++ EGEKW+NPKD DEV VKYE
Sbjct  121  ESGSPPTIPPNATLQFDVELLSWTSVKDISKDGGILKNIITEGEKWDNPKDLDEVFVKYE  180

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDG +++KSD VEFTVEEG+FCPAL KAVKTMKKGEKV L VKP+Y FGE
Sbjct  181  ARLEDGAIISKSDGVEFTVEEGYFCPALAKAVKTMKKGEKVLLNVKPEYAFGE  233


 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 114/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGAIISKS----DGVEFTVEEGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P+ A+GE+G P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPEYAFGENGKPSSGDDGVVPPNASLQIDLELVSWKTVSDIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
            KD  + KK L EGE +E P D   V VK   +L+DGT+  K         EF ++E    
Sbjct  268  KDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFLKKGHDDDQPFEFKIDEEQVI  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVK MKKGE   + ++P+Y FG
Sbjct  328  DGLDRAVKNMKKGETALVIIQPEYAFG  354


 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFLKKGHDDDQPFEFKIDEEQVID  328

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ +K MKKGE  +  I P+ A+G SGSP    T+P N+TL ++VEL+S+V  K+   
Sbjct  329  GLDRAVKNMKKGETALVIIQPEYAFGPSGSPQELATVPHNSTLYYEVELISFVKEKESW-  387

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G+K E
Sbjct  388  DLNTQEKIEAAGKKKE  403



>ref|XP_007034164.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY05090.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Theobroma cacao]
Length=574

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 206/238 (87%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICKDGGIFKK+L EGEKWENPKD DEV
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICKDGGIFKKILVEGEKWENPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQY FGE
Sbjct  183  FVKYEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYAFGE  240


 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            KD  + KK+L EGE ++ P D   V VK   +L+DG +  K     +  EF ++E     
Sbjct  275  KDRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVID  334

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AVK MKKGE   +T++P+Y FG
Sbjct  335  GLDRAVKMMKKGEHALITIQPEYAFG  360


 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 4/135 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+   D
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE-SWD  394

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  395  MNTQEKIEAAGKKKE  409



>ref|XP_008669632.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Zea mays]
 tpg|DAA38461.1| TPA: hypothetical protein ZEAMMB73_460939 [Zea mays]
Length=588

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 206/252 (82%), Gaps = 6/252 (2%)
 Frame = +3

Query  12   SDDAN*NPQFSDSSLCFWIMEDFDMPPAE--MDDLD-LPDDNPVMKVGEEKEIGDQGLKK  182
            +DD+   P  S+  +   + ED  M   E  MDD D LP   P MKVGEEKEIG++GLKK
Sbjct  2    ADDSFDLPSASEEDVMGGLDEDEAMKDLETGMDDEDYLP---PTMKVGEEKEIGNEGLKK  58

Query  183  KLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIK  362
            KLVKEG GW+ PE GDEVEVHYTGTLLDGTKFDSSRDRGTPF+F LGQGQVIKGWD  IK
Sbjct  59   KLVKEGEGWDRPEFGDEVEVHYTGTLLDGTKFDSSRDRGTPFRFKLGQGQVIKGWDLAIK  118

Query  363  TMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLA  542
            TMKKGE  IFTIPP LAYGE GSPPTIPPNATLQF VELLSW SVKDICKDGGIFKK++ 
Sbjct  119  TMKKGENAIFTIPPGLAYGEMGSPPTIPPNATLQFHVELLSWASVKDICKDGGIFKKIIV  178

Query  543  EGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKV  722
            EGEKWENPKD DEV VKYE RLEDGT+V+KSD VEF V +G+FCPAL+KAVKTMKKGEKV
Sbjct  179  EGEKWENPKDLDEVFVKYEVRLEDGTVVSKSDGVEFAVRDGYFCPALSKAVKTMKKGEKV  238

Query  723  QLTVKPQYGFGE  758
             L VKPQYGF E
Sbjct  239  LLNVKPQYGFRE  250


 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 100/207 (48%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  169  DGGIFKKIIVEGEKWENPKDLDEVFVKYEVRLEDGTVVSKS----DGVEFAVRDGYFCPA  224

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   + E G P +     +PPNA L  D+EL+SW +V  I 
Sbjct  225  LSKAVKTMKKGEKVLLNVKPQYGFREEGKPASRDEAAVPPNAVLHIDLELVSWKTVMLIG  284

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
                I KKVL E E +E P D   V V++  +LEDGT+  K      +  EF  +E    
Sbjct  285  DHKRILKKVLKESEGYEGPNDGAVVKVRFIGKLEDGTVFVKKGHDGEEPFEFKTDEEQVI  344

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V  MKKGE     V P+  FG
Sbjct  345  EGLDITVVNMKKGEVALARVPPEQAFG  371


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     VM +G+ K I      KK++KE  G+E P  G  V+V + G L DGT F  
Sbjct  271  DLELVSWKTVMLIGDHKRI-----LKKVLKESEGYEGPNDGAVVKVRFIGKLEDGTVFVK  325

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE---SGSPPTIPPN  452
               D   PF+F   + QVI+G D  +  MKKGE  +  +PP+ A+G    +    T+PPN
Sbjct  326  KGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALARVPPEQAFGSVETNQDLATVPPN  385

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  386  STVLYEVELVSF  397



>ref|XP_007034165.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
 gb|EOY05091.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 4 [Theobroma cacao]
Length=533

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 206/238 (87%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICKDGGIFKK+L EGEKWENPKD DEV
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICKDGGIFKKILVEGEKWENPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQY FGE
Sbjct  183  FVKYEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYAFGE  240


 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            KD  + KK+L EGE ++ P D   V VK   +L+DG +  K     +  EF ++E     
Sbjct  275  KDRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVID  334

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AVK MKKGE   +T++P+Y FG
Sbjct  335  GLDRAVKMMKKGEHALITIQPEYAFG  360


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 4/135 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+   D
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE-SWD  394

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  395  MNTQEKIEAAGKKKE  409



>ref|XP_002436973.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
 gb|EER88340.1| hypothetical protein SORBIDRAFT_10g012970 [Sorghum bicolor]
Length=592

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P MK GEE+EIG +GLKKKLVKEG GW+ PE GDEVEVHYTGTLLDGTKFDSSRDRGTPF
Sbjct  45   PTMKAGEEREIGKEGLKKKLVKEGQGWDRPETGDEVEVHYTGTLLDGTKFDSSRDRGTPF  104

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
            KF LGQGQVIKGWD GIKTMKKGE  IFTIPP LAYGE+GS  TIPPNATLQFDVELLSW
Sbjct  105  KFKLGQGQVIKGWDLGIKTMKKGENAIFTIPPGLAYGETGSSCTIPPNATLQFDVELLSW  164

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGH  668
             SVKDICKDGGIFKK+L EGEKWENPKD DEV VKYEARLEDGT+V+KSD VEF V++G+
Sbjct  165  ASVKDICKDGGIFKKILVEGEKWENPKDLDEVFVKYEARLEDGTVVSKSDGVEFAVKDGY  224

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  225  FCPALAKAVKTMKKGEKVLLTVKPQYGFGE  254


 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 103/207 (50%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +F +  G     
Sbjct  173  DGGIFKKILVEGEKWENPKDLDEVFVKYEARLEDGTVVSKS----DGVEFAVKDGYFCPA  228

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE     SG    +PPNA L  D+EL++W +V  I 
Sbjct  229  LAKAVKTMKKGEKVLLTVKPQYGFGEQGKQASGDEAAVPPNAMLHIDLELVTWKTVTLIG  288

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
                I KKVL EGE +E P D   V V+   +LEDGT+  +      +  EF  +E    
Sbjct  289  DRKRILKKVLKEGEGYERPNDGAVVGVRLIGKLEDGTVFVRKGHDGEEPFEFKTDEEQVI  348

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V  MKKGE   + V P++ FG
Sbjct  349  EGLDITVVNMKKGEVALVRVPPEHAFG  375


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 76/141 (54%), Gaps = 11/141 (8%)
 Frame = +3

Query  84   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  257
            +PP  M   DL+L     V  +G+ K I      KK++KEG G+E P  G  V V   G 
Sbjct  266  VPPNAMLHIDLELVTWKTVTLIGDRKRI-----LKKVLKEGEGYERPNDGAVVGVRLIGK  320

Query  258  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  434
            L DGT F     D   PF+F   + QVI+G D  +  MKKGE  +  +PP+ A+G   + 
Sbjct  321  LEDGTVFVRKGHDGEEPFEFKTDEEQVIEGLDITVVNMKKGEVALVRVPPEHAFGSVETK  380

Query  435  ---PTIPPNATLQFDVELLSW  488
                 +PPN+T+ ++VEL+S+
Sbjct  381  QDLAIVPPNSTVFYEVELVSF  401



>dbj|BAH19789.1| AT5G48570 [Arabidopsis thaliana]
Length=453

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +3

Query  99   MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF  278
            + D D  D  P +K+GEE EIG  GLKKKLVKE   W+TPE GDEVEVHYTGTLLDGTKF
Sbjct  23   LPDNDEADSAPYLKIGEEMEIGKSGLKKKLVKECEKWDTPENGDEVEVHYTGTLLDGTKF  82

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNAT  458
            DSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNAT
Sbjct  83   DSSRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNAT  142

Query  459  LQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSD  638
            LQFDVEL++W SVKDIC DGG+ KK++ EGEKWE PKD DEV VKYEARLEDGT+V KSD
Sbjct  143  LQFDVELIAWRSVKDICGDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSD  202

Query  639  IVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VEFTV+EGHFCPAL+KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  203  GVEFTVKEGHFCPALSKAVKTMKRGEKVLLTVKPQYGFGE  242


 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 114/211 (54%), Gaps = 17/211 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G    
Sbjct  160  GDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDG----VEFTVKEGHFCP  215

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  216  ALSKAVKTMKRGEKVLLTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVE  275

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV-------AKSDIVEFTVEE  662
            +  D  + KK+L EGE +E P +   V +K   +L+DGT V          +  EF ++E
Sbjct  276  VTDDRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDE  335

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                  L KAV  MKKGE   +T+ P+Y FG
Sbjct  336  EQVIEGLEKAVMGMKKGEVALITISPEYAFG  366


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 71/119 (60%), Gaps = 6/119 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  335
            D+ + KK++KEG G+E P  G  V++   G L DGT         +   PF+F + + QV
Sbjct  279  DRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDEEQV  338

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            I+G ++ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S++  K+
Sbjct  339  IEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELVSFIKEKE  397



>ref|XP_004973965.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Setaria 
italica]
 ref|XP_004973966.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Setaria 
italica]
Length=553

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 196/238 (82%), Positives = 209/238 (88%), Gaps = 10/238 (4%)
 Frame = +3

Query  72   EDFDMPPA---------EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            EDF+MPPA         EMDD    D+ PVMKVGEEKE+G QGLKKKL+KEG GWETPE 
Sbjct  3    EDFEMPPAGAEGMMGDDEMDDFG-GDEGPVMKVGEEKEVGKQGLKKKLLKEGEGWETPEV  61

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP
Sbjct  62   GDEVEVHYTGTLLDGTKFDSSRDRGDPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPP  121

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPP IPPNATLQFDVELLSW SV+DICKDGGIFKK+L EGEKWENPKDPDEV
Sbjct  122  ELAYGESGSPPKIPPNATLQFDVELLSWTSVRDICKDGGIFKKILKEGEKWENPKDPDEV  181

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEARLEDGT+V+KS+ VEFTV++G+FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  LVKYEARLEDGTVVSKSEGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  239


 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 109/206 (53%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P       +PPNATL  D+EL+SW +V +I 
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQYGFGEKGRPAAGEEGAVPPNATLLVDLELVSWKTVTEIG  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  I KKVL EGE +E P +   V VK   +L DGT+  K     +  EF  +E     
Sbjct  274  DDKKILKKVLKEGEGYERPNESAVVKVKITGKLLDGTVFTKKGHDEEPFEFKTDEEEVID  333

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AV  MKKGE   +T+ P+Y FG
Sbjct  334  GLDRAVLNMKKGEVALVTIPPEYAFG  359


 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 81/136 (60%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V ++G++K+I      KK++KEG G+E P     V+V  TG LLDGT F  
Sbjct  260  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNESAVVKVKITGKLLDGTVFTK  314

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
                  PF+F   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  315  KGHDEEPFEFKTDEEEVIDGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  374

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  375  TVVYEVELVSFVKDKE  390



>gb|KHG01160.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=606

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 201/235 (86%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DFD P A   E D++ +  D+PV   ++VGEEKEIG  GLKKKLVK+G GWETP  GDE
Sbjct  3    DDFDFPTANNVEEDEMGILGDDPVNSLLEVGEEKEIGKNGLKKKLVKQGEGWETPSNGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGTKFDSSRDRGTPFKF LG GQVIKGWD+GIKTMKKGE  IFTIPP+LA
Sbjct  63   VEVHYTGTLLDGTKFDSSRDRGTPFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPPELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW S KDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSFKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTL+++S  +EFTV +G+FCPAL KAVKTMKKGEKV L VKPQY FGE
Sbjct  183  YEACLEDGTLISQSGGLEFTVGDGYFCPALAKAVKTMKKGEKVLLIVKPQYAFGE  237


 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 116/206 (56%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISQS----GGLEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GE G P       +PPNATL   +EL+SW SV D+ 
Sbjct  212  LAKAVKTMKKGEKVLLIVKPQYAFGEDGRPALGSEGAVPPNATLHVTLELVSWKSVSDVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            K+  + KK+L EGE ++ P D   V VK+  +LEDG +  K     ++ EF ++E     
Sbjct  272  KNKKVLKKILKEGEGYKRPDDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AVKTMKKGE   +T++P+Y FG
Sbjct  332  GLDQAVKTMKKGELALITIQPEYAFG  357


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 4/130 (3%)
 Frame = +3

Query  180  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGI  359
            KK++KEG G++ P+ G  V+V + G L DG  F         F+F + + QVI G DQ +
Sbjct  278  KKILKEGEGYKRPDDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVIDGLDQAV  337

Query  360  KTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFK  530
            KTMKKGE  + TI P+ A+G S S      +P N+T+ +++E++S+V  K+   D    +
Sbjct  338  KTMKKGELALITIQPEYAFGSSESQQELAVVPANSTVYYELEMVSFVKEKE-SWDMNAQE  396

Query  531  KVLAEGEKWE  560
            K+ A G+K E
Sbjct  397  KIEAAGKKKE  406



>ref|XP_007034163.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY05089.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Theobroma cacao]
Length=609

 Score =   365 bits (936),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 206/238 (87%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICKDGGIFKK+L EGEKWENPKD DEV
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICKDGGIFKKILVEGEKWENPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQY FGE
Sbjct  183  FVKYEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYAFGE  240


 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            KD  + KK+L EGE ++ P D   V VK   +L+DG +  K     +  EF ++E     
Sbjct  275  KDRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVID  334

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AVK MKKGE   +T++P+Y FG
Sbjct  335  GLDRAVKMMKKGEHALITIQPEYAFG  360


 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 4/135 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+   D
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE-SWD  394

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  395  MNTQEKIEAAGKKKE  409



>gb|EYU40640.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
 gb|EYU40641.1| hypothetical protein MIMGU_mgv1a003616mg [Erythranthe guttata]
Length=574

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 211/242 (87%), Gaps = 2/242 (1%)
 Frame = +3

Query  39   FSDSSLCFWIMEDFDMPPAE-MDD-LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWE  212
            F    L   + +DFD+P AE MDD +DLP +   MKVGEEK+IG  GLKKKL+KEG  W+
Sbjct  16   FLSPFLQLLMEDDFDIPAAEGMDDFMDLPGEGGYMKVGEEKDIGKLGLKKKLLKEGEAWD  75

Query  213  TPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIF  392
            TP+ GDEVEVHYTGTLLDGTKFDSSRDRG  FKFTLGQGQVIKGWD+GIKTMKKGE  IF
Sbjct  76   TPDNGDEVEVHYTGTLLDGTKFDSSRDRGETFKFTLGQGQVIKGWDEGIKTMKKGENAIF  135

Query  393  TIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKD  572
            TIPP LAYGESGSPPTIPPNATLQFDVELLSWVS+KDICKDGGIFKK+L +GEKWENPKD
Sbjct  136  TIPPVLAYGESGSPPTIPPNATLQFDVELLSWVSIKDICKDGGIFKKILKDGEKWENPKD  195

Query  573  PDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGF  752
            PDEV VKYEARLEDGT+VAKSD VEF V+EG+FCPAL+KAVKTMKKGEKV LTVKPQYGF
Sbjct  196  PDEVLVKYEARLEDGTVVAKSDGVEFNVQEGYFCPALSKAVKTMKKGEKVLLTVKPQYGF  255

Query  753  GE  758
             E
Sbjct  256  SE  257


 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 113/210 (54%), Gaps = 17/210 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++K+G  WE P+  DEV V Y   L DGT    S       +F + +G     
Sbjct  176  DGGIFKKILKDGEKWENPKDPDEVLVKYEARLEDGTVVAKS----DGVEFNVQEGYFCPA  231

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   + E G P +     IPPNA+L   ++L+SW +V ++ 
Sbjct  232  LSKAVKTMKKGEKVLLTVKPQYGFSEKGKPASGDEKAIPPNASLDIVLDLVSWKTVSNVT  291

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK--------SDIVEFTVEEG  665
             D  + KK+L +GE +E P D   V +K   +L+DGT+  K        +D+ EF  +E 
Sbjct  292  DDKKVVKKILKDGEGYERPNDGTVVKLKLIGKLQDGTVFVKKGHGGDDENDLFEFKTDED  351

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L KAV TMKKGE   LT+ PQY FG
Sbjct  352  QVIEGLDKAVATMKKGEVAVLTIDPQYAFG  381


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 90/166 (54%), Gaps = 14/166 (8%)
 Frame = +3

Query  87   PPAEMDD-LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            P A +D  LDL     V  V ++K++      KK++K+G G+E P  G  V++   G L 
Sbjct  271  PNASLDIVLDLVSWKTVSNVTDDKKV-----VKKILKDGEGYERPNDGTVVKLKLIGKLQ  325

Query  264  DGTKF----DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            DGT F        D    F+F   + QVI+G D+ + TMKKGE  + TI P  A+G S S
Sbjct  326  DGTVFVKKGHGGDDENDLFEFKTDEDQVIEGLDKAVATMKKGEVAVLTIDPQYAFGSSES  385

Query  432  P---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
                  +PPN+T+ +DVEL+S+V  K+   D    +K+ A G+K E
Sbjct  386  KQDLAVVPPNSTVYYDVELVSFVKEKE-SWDMNTEEKIEAAGKKKE  430



>ref|XP_009136108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Brassica 
rapa]
Length=550

 Score =   362 bits (930),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 200/233 (86%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDF+MPP       D++D  DD   +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVE
Sbjct  3    EDFEMPPVGGMNGDDEMDFGDDASFLKVGEEKEI-QQGLKKKLLKEGQGFETPENGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSS DRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSLDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPSELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELLSW SVKDICKDGG+FKK++A GEKWE PKD DEV VKY 
Sbjct  122  ESGSPPTIPANATLQFDVELLSWSSVKDICKDGGVFKKIVAAGEKWEMPKDLDEVLVKYV  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+LEDGT+V KSD VEFTV++G+FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  AKLEDGTVVGKSDGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  234


 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 109/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V  G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKIVAAGEKWEMPKDLDEVLVKYVAKLEDGTVVGKS----DGVEFTVKDGYFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LAKAVKTMKKAEKVLLTVKPQYGFGEKGKPASGGEAAVPPNATLEIELELVSWKTVSEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L DGT+  K       +  EF  +E   
Sbjct  269  DDNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGDGEEPFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KA+  MKKGE   +T+ P+Y FG
Sbjct  329  IDGLDKALLKMKKGEVALVTIDPEYAFG  356


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      D   PF+F   + QVI
Sbjct  270  DNKVIKKILKEGEGYERPNEGAVVKVKLIGKLGDGTVFLKKGHGDGEEPFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+TL ++V+L+S+
Sbjct  330  DGLDKALLKMKKGEVALVTIDPEYAFGSTESKQELAVVPPNSTLYYEVDLVSF  382



>ref|XP_007034162.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY05088.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Theobroma cacao]
Length=609

 Score =   364 bits (935),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 206/238 (87%), Gaps = 9/238 (4%)
 Frame = +3

Query  72   EDFDMPPA------EMDDL-DLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEP  224
            +DF++P A      EM++L + P D  +P++KVGEEKEIG  GLKKKLVKEG GWETP+ 
Sbjct  3    DDFEVPTASDMEEDEMNNLENEPVDPIDPILKVGEEKEIGKNGLKKKLVKEGEGWETPDN  62

Query  225  GDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPP  404
            GDEVEVHYTGTLLDGTKFDSSRD+G+ FKF LG GQVIKGWD+GIKTMKKGE  IFTIP 
Sbjct  63   GDEVEVHYTGTLLDGTKFDSSRDKGSTFKFKLGLGQVIKGWDEGIKTMKKGENAIFTIPS  122

Query  405  DLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            +LAYGESGSPPTIPPNATLQFDVEL+SW SVKDICKDGGIFKK+L EGEKWENPKD DEV
Sbjct  123  ELAYGESGSPPTIPPNATLQFDVELVSWNSVKDICKDGGIFKKILVEGEKWENPKDLDEV  182

Query  585  SVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             VKYEA LEDGTL++KSD VEFTV +G+FCPAL KAVKTMKKGEKV LTVKPQY FGE
Sbjct  183  FVKYEACLEDGTLISKSDGVEFTVGDGYFCPALAKAVKTMKKGEKVLLTVKPQYAFGE  240


 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 114/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  159  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLISKS----DGVEFTVGDGYFCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE G P       +PPNATL   +E++SW +V D+ 
Sbjct  215  LAKAVKTMKKGEKVLLTVKPQYAFGEDGRPAVANEGAVPPNATLHITLEVVSWKNVSDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            KD  + KK+L EGE ++ P D   V VK   +L+DG +  K     +  EF ++E     
Sbjct  275  KDRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVID  334

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AVK MKKGE   +T++P+Y FG
Sbjct  335  GLDRAVKMMKKGEHALITIQPEYAFG  360


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 4/135 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK++KEG G++ P  G  V V   G L DG  F        PF+F + + QVI G
Sbjct  276  DRKVMKKILKEGEGYDQPNDGTVVHVKLIGKLQDGKIFVKKGHDEEPFEFKIDEEQVIDG  335

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKD  515
             D+ +K MKKGE  + TI P+ A+G S S      +P NAT+ ++VE++S+V  K+   D
Sbjct  336  LDRAVKMMKKGEHALITIQPEYAFGSSESQQELAVVPANATVYYEVEMVSFVKEKE-SWD  394

Query  516  GGIFKKVLAEGEKWE  560
                +K+ A G+K E
Sbjct  395  MNTQEKIEAAGKKKE  409



>tpg|DAA48149.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=420

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 209/237 (88%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKDPDEV 
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILKEGEKWENPKDPDEVL  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLEDGT+V+KS+ VEFTV++G+FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  183  VKYEARLEDGTVVSKSEGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  239


 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 109/206 (53%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P       +PPNA+L  D+EL+SW +V +I 
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQYGFGEKGRPAAGEEGAVPPNASLLIDLELISWKTVTEIG  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  I KKVL EGE +E P +   V VK   +L+DG +  K     +  +F  +E     
Sbjct  274  DDKKILKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTKKGHDEEPFKFKTDEEEVIA  333

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AV  MKKGE   +T+ P+Y FG
Sbjct  334  GLDRAVLNMKKGEVALVTIPPEYAFG  359


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  260  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  314

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  315  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  374

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  375  TVIYEVELISFVKDKE  390



>ref|NP_199668.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
 sp|Q9FJL3.1|FKB65_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP65; Short=PPIase 
FKBP65; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 65; Short=AtFKBP65; 
AltName: Full=Immunophilin FKBP65; AltName: Full=Peptidyl-prolyl 
isomerase ROF2; AltName: Full=Protein ROTAMASE FKBP 2; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 dbj|BAB10690.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AED95689.1| peptidyl-prolyl cis-trans isomerase FKBP65 [Arabidopsis thaliana]
Length=578

 Score =   363 bits (932),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 191/218 (88%), Gaps = 0/218 (0%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D D  D  P +K+GEE EIG  GLKKKLVKE   W+TPE GDEVEVHYTGTLLDGTKFDS
Sbjct  25   DNDEADSAPYLKIGEEMEIGKSGLKKKLVKECEKWDTPENGDEVEVHYTGTLLDGTKFDS  84

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            SRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNATLQ
Sbjct  85   SRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNATLQ  144

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIV  644
            FDVEL++W SVKDIC DGG+ KK++ EGEKWE PKD DEV VKYEARLEDGT+V KSD V
Sbjct  145  FDVELIAWRSVKDICGDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGV  204

Query  645  EFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            EFTV+EGHFCPAL+KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  205  EFTVKEGHFCPALSKAVKTMKRGEKVLLTVKPQYGFGE  242


 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 114/211 (54%), Gaps = 17/211 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G    
Sbjct  160  GDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKS----DGVEFTVKEGHFCP  215

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  216  ALSKAVKTMKRGEKVLLTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVE  275

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV-------AKSDIVEFTVEE  662
            +  D  + KK+L EGE +E P +   V +K   +L+DGT V          +  EF ++E
Sbjct  276  VTDDRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDE  335

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                  L KAV  MKKGE   +T+ P+Y FG
Sbjct  336  EQVIEGLEKAVMGMKKGEVALITISPEYAFG  366


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 71/119 (60%), Gaps = 6/119 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  335
            D+ + KK++KEG G+E P  G  V++   G L DGT         +   PF+F + + QV
Sbjct  279  DRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDEEQV  338

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            I+G ++ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S++  K+
Sbjct  339  IEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELVSFIKEKE  397



>ref|NP_001149790.1| LOC100283417 [Zea mays]
 gb|ACG36811.1| peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48150.1| TPA: peptidyl-prolyl isomerase [Zea mays]
 tpg|DAA48151.1| TPA: peptidyl-prolyl isomerase [Zea mays]
Length=553

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 209/237 (88%), Gaps = 8/237 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKDPDEV 
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILKEGEKWENPKDPDEVL  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLEDGT+V+KS+ VEFTV++G+FCPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  183  VKYEARLEDGTVVSKSEGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQYGFGE  239


 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 109/206 (53%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P       +PPNA+L  D+EL+SW +V +I 
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQYGFGEKGRPAAGEEGAVPPNASLLIDLELISWKTVTEIG  273

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  I KKVL EGE +E P +   V VK   +L+DG +  K     +  +F  +E     
Sbjct  274  DDKKILKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTKKGHDEEPFKFKTDEEEVIA  333

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AV  MKKGE   +T+ P+Y FG
Sbjct  334  GLDRAVLNMKKGEVALVTIPPEYAFG  359


 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  260  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  314

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  315  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  374

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  375  TVIYEVELISFVKDKE  390



>ref|XP_003547780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine 
max]
Length=574

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/233 (83%), Positives = 205/233 (88%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPAE--MDDLDLPDD--NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFDM  AE   +D D      NPV+KVGEEKEIG +GLKKKL+KEG GW+TPE GDEV+
Sbjct  3    EDFDMAAAEPMGEDFDFAGSGSNPVLKVGEEKEIGKEGLKKKLLKEGEGWDTPEAGDEVQ  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTPFSFTLGQGQVIKGWDQGIITMKKGENALFTIPAELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L EGEKWENPKDPDEV VKYE
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTEGEKWENPKDPDEVLVKYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A LEDGTLVAKSD VEFTV +GHFCPA +KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  AHLEDGTLVAKSDGVEFTVNDGHFCPAFSKAVKTMKKGEKVLLTVKPQYGFGE  235


 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 113/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  154  DGGLFKKILTEGEKWENPKDPDEVLVKYEAHLEDGTLVAKSDG----VEFTVNDGHFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
            + + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  210  FSKAVKTMKKGEKVLLTVKPQYGFGEKGKPAHGDEGAVPPNATLQITLELVSWKTVSEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E+P +   V +K   +L+DGTL  K        + EF  +E   
Sbjct  270  DDKKVIKKILKEGEGYEHPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGGLFEFKTDEEQV  329

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P+Y FG
Sbjct  330  IDGLDRAVLTMKKGEVALLTIAPEYAFG  357


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT F      D G  F+F   + QVI
Sbjct  271  DKKVIKKILKEGEGYEHPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGGLFEFKTDEEQVI  330

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+ A+G S S      +PPN+TL +++EL+S+
Sbjct  331  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESQQELAVVPPNSTLYYEIELVSF  383



>gb|KEH20636.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=570

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 194/231 (84%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDF+ P A       +    +P  KVGEEKEIG  GLKKKLVKEG GWETP+ GD+VEVH
Sbjct  3    EDFEFPTAGNMEMPEEEEVMSPTQKVGEEKEIGKNGLKKKLVKEGEGWETPDNGDQVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTG LLDGTKFDSSRDRGT FKF LGQGQVIKGWD+GIKTMKKGE  IFTIPP+LAYGES
Sbjct  63   YTGILLDGTKFDSSRDRGTTFKFKLGQGQVIKGWDEGIKTMKKGENAIFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNA LQFDVELLSW SVKDI KDGGI K ++ EGEKW+NPKDPDEV VKYEAR
Sbjct  123  GSPPTIPPNAALQFDVELLSWTSVKDITKDGGILKNIITEGEKWDNPKDPDEVFVKYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LE+GT+V+KSD VEFTVEEG FCPAL KAVKTMKKGEKV L VKP+Y FGE
Sbjct  183  LEEGTIVSKSDGVEFTVEEGFFCPALAKAVKTMKKGEKVLLNVKPEYAFGE  233


 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 115/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K ++ EG  W+ P+  DEV V Y   L +GT    S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDPDEVFVKYEARLEEGTIVSKS----DGVEFTVEEGFFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P+ A+GESG P +     IPPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPEYAFGESGKPSSGNNGAIPPNASLQIDLELVSWKTVSDIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
            KD  + KK L EGE +E P D   V VK   +L+DGT+  K         EF ++E    
Sbjct  268  KDRKVLKKTLKEGEGYERPNDGAVVQVKLTGKLQDGTVFFKKGHDGDQPFEFRIDEEQVI  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVK MKKGE   + ++P+Y FG
Sbjct  328  DGLDRAVKNMKKGEIALVIIQPEYAFG  354


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 84/136 (62%), Gaps = 5/136 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK +KEG G+E P  G  V+V  TG L DGT F     D   PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLTGKLQDGTVFFKKGHDGDQPFEFRIDEEQVID  328

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ +K MKKGE  +  I P+ A+G SGSP    T+PPN+T+ ++VELLS+V+ K+   
Sbjct  329  GLDRAVKNMKKGEIALVIIQPEYAFGSSGSPQELTTVPPNSTVYYEVELLSFVNEKESW-  387

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G+K E
Sbjct  388  DLNTQEKIEAAGKKKE  403



>gb|KJB71963.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=607

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 201/235 (86%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DFD P A   E D++ +P+D+PV   ++VGEEKEIG  GLKKKLVK+G GW+TP  GDE
Sbjct  3    DDFDFPTANNVEEDEMGIPEDDPVNSLLEVGEEKEIGKNGLKKKLVKQGEGWDTPSNGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTL DGTKFDSSRDRGTPFKF LG GQVIKGWD+GIKTMKKGE   FTIPP+LA
Sbjct  63   VEVHYTGTLHDGTKFDSSRDRGTPFKFKLGLGQVIKGWDEGIKTMKKGENAFFTIPPELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW S KDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSFKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTLV++S  +EFTV +G+FCPAL KAVKTMKKGEKV L VKPQY FGE
Sbjct  183  YEACLEDGTLVSQSGGLEFTVGDGYFCPALAKAVKTMKKGEKVLLIVKPQYAFGE  237


 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 115/206 (56%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLVSQS----GGLEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GE G P       +PPNATL   +EL+SW SV D+ 
Sbjct  212  LAKAVKTMKKGEKVLLIVKPQYAFGEDGRPALGSEGAVPPNATLHVTLELVSWKSVSDVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            K+  + KK+L EGE +E P D   V VK+  +LEDG +  K     ++ EF ++E     
Sbjct  272  KNKKVLKKILKEGEGYERPHDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L K VKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKTVKTMKKGELALITIQPEYAFG  357


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = +3

Query  180  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGI  359
            KK++KEG G+E P  G  V+V + G L DG  F         F+F + + QVI G D+ +
Sbjct  278  KKILKEGEGYERPHDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVIDGLDKTV  337

Query  360  KTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFK  530
            KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+   D    +
Sbjct  338  KTMKKGELALITIQPEYAFGSSESQQELAVVPANSTVYYEVEMVSFVKEKE-SWDMNAQE  396

Query  531  KVLAEGEKWE  560
            K+ A G+K E
Sbjct  397  KIEAAGKKKE  406



>gb|KJB71964.1| hypothetical protein B456_011G150600 [Gossypium raimondii]
Length=606

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 201/235 (86%), Gaps = 6/235 (3%)
 Frame = +3

Query  72   EDFDMPPA---EMDDLDLPDDNPV---MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            +DFD P A   E D++ +P+D+PV   ++VGEEKEIG  GLKKKLVK+G GW+TP  GDE
Sbjct  3    DDFDFPTANNVEEDEMGIPEDDPVNSLLEVGEEKEIGKNGLKKKLVKQGEGWDTPSNGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTL DGTKFDSSRDRGTPFKF LG GQVIKGWD+GIKTMKKGE   FTIPP+LA
Sbjct  63   VEVHYTGTLHDGTKFDSSRDRGTPFKFKLGLGQVIKGWDEGIKTMKKGENAFFTIPPELA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YGESGSPPTIPPNATLQFDVELLSW S KDICKDGGIFKK+L EGEKWENPKD DEV VK
Sbjct  123  YGESGSPPTIPPNATLQFDVELLSWTSFKDICKDGGIFKKILVEGEKWENPKDLDEVFVK  182

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            YEA LEDGTLV++S  +EFTV +G+FCPAL KAVKTMKKGEKV L VKPQY FGE
Sbjct  183  YEACLEDGTLVSQSGGLEFTVGDGYFCPALAKAVKTMKKGEKVLLIVKPQYAFGE  237


 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 115/206 (56%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  156  DGGIFKKILVEGEKWENPKDLDEVFVKYEACLEDGTLVSQS----GGLEFTVGDGYFCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GE G P       +PPNATL   +EL+SW SV D+ 
Sbjct  212  LAKAVKTMKKGEKVLLIVKPQYAFGEDGRPALGSEGAVPPNATLHVTLELVSWKSVSDVT  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            K+  + KK+L EGE +E P D   V VK+  +LEDG +  K     ++ EF ++E     
Sbjct  272  KNKKVLKKILKEGEGYERPHDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVID  331

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L K VKTMKKGE   +T++P+Y FG
Sbjct  332  GLDKTVKTMKKGELALITIQPEYAFG  357


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = +3

Query  180  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGI  359
            KK++KEG G+E P  G  V+V + G L DG  F         F+F + + QVI G D+ +
Sbjct  278  KKILKEGEGYERPHDGTIVQVKFIGKLEDGKIFVKKGHDDELFEFKIDEEQVIDGLDKTV  337

Query  360  KTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFK  530
            KTMKKGE  + TI P+ A+G S S      +P N+T+ ++VE++S+V  K+   D    +
Sbjct  338  KTMKKGELALITIQPEYAFGSSESQQELAVVPANSTVYYEVEMVSFVKEKE-SWDMNAQE  396

Query  531  KVLAEGEKWE  560
            K+ A G+K E
Sbjct  397  KIEAAGKKKE  406



>ref|XP_003579568.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Brachypodium 
distachyon]
Length=596

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = +3

Query  132  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  311
             MKVGEEKEIG QGLKKKLVKEG GW+ PE GDEVEVHYTGTLL+G KFDSSRDRGTPFK
Sbjct  50   AMKVGEEKEIGKQGLKKKLVKEGEGWDRPETGDEVEVHYTGTLLNGEKFDSSRDRGTPFK  109

Query  312  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            F LGQG+VIKGWDQGIKTMKKGE  I TIPP+LAYGE+GSPP IPPNATLQFDVELLSW 
Sbjct  110  FKLGQGEVIKGWDQGIKTMKKGENAILTIPPELAYGETGSPPKIPPNATLQFDVELLSWA  169

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHF  671
            SV DICKDGGIFKKVL EG+KWENPKD D V VKYEARLEDGT+++KSD  EF V++GHF
Sbjct  170  SVNDICKDGGIFKKVLVEGQKWENPKDLDLVLVKYEARLEDGTVISKSDGAEFAVKDGHF  229

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            CPAL++AVKTMKKGEKV LTVKPQYGFGE
Sbjct  230  CPALSRAVKTMKKGEKVLLTVKPQYGFGE  258


 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 105/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  D V V Y   L DGT    S+  G   +F +  G     
Sbjct  177  DGGIFKKVLVEGQKWENPKDLDLVLVKYEARLEDGTVI--SKSDGA--EFAVKDGHFCPA  232

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL  D+EL+SW +V  I 
Sbjct  233  LSRAVKTMKKGEKVLLTVKPQYGFGEQGRPASGVEGAVPPNATLHIDLELVSWKTVTLIG  292

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I K VL EGE +E P D   V V+   +LEDGT+  K      +  EF  +E    
Sbjct  293  DDKKILKTVLKEGEGYERPNDGAVVRVRLVGKLEDGTVFTKKGHEGDEPFEFKTDEEQVI  352

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V TMKKGE     + P+  FG
Sbjct  353  EGLDITVVTMKKGEVALARIPPERAFG  379


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V  +G++K+I      K ++KEG G+E P  G  V V   G L DGT F  
Sbjct  279  DLELVSWKTVTLIGDDKKI-----LKTVLKEGEGYERPNDGAVVRVRLVGKLEDGTVFTK  333

Query  285  SRDRG-TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
                G  PF+F   + QVI+G D  + TMKKGE  +  IPP+ A+G + +      +P N
Sbjct  334  KGHEGDEPFEFKTDEEQVIEGLDITVVTMKKGEVALARIPPERAFGSTETKLDLAVVPAN  393

Query  453  ATLQFDVELLSW  488
            + + ++VEL+S+
Sbjct  394  SRVYYEVELVSF  405



>ref|XP_010488634.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Camelina 
sativa]
Length=561

 Score =   361 bits (927),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 201/232 (87%), Gaps = 5/232 (2%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLPDDNP----VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            DF+MPP    + D   D       +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVEV
Sbjct  4    DFEMPPVGGMNDDDDMDFGDAAAYLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLL+GTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLNGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIP NATLQFDVELL+WVSVKDICKDGG+FKK+LA GEKWENPKD DEV VK+EA
Sbjct  123  SGSPPTIPANATLQFDVELLTWVSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +L+DGT+V KS+ VEFTV++GHFCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  KLDDGTIVGKSNGVEFTVKDGHFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 113/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  153  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLDDGTIVGKS----NGVEFTVKDGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  269  DDNKVMKKILKEGEGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEELFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +TV+P+Y FG
Sbjct  329  VDGLDRAVMKMKKGEVALVTVEPEYAFG  356


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = +3

Query  111  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  284
            ++ DDN VMK              K++KEG G+E P  G  V+V   G L DGT F    
Sbjct  266  EVTDDNKVMK--------------KILKEGEGYERPNEGAVVKVKLIGKLQDGTVFLKKG  311

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
              +    F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S      +PP +
Sbjct  312  HGENEELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVEPEYAFGSNESKQELAVVPPKS  371

Query  456  TLQFDVELLSW  488
            T+ ++V+L+++
Sbjct  372  TVYYEVDLVTF  382



>ref|XP_010023594.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW59903.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=587

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +3

Query  132  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  311
            V+KVGEE+EIG  G KKKLVKEG GWETP  GDEVEVHYTGTLLDGTKFDSSRDRGTPFK
Sbjct  42   VLKVGEEREIGKAGFKKKLVKEGEGWETPSSGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  101

Query  312  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            F LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGSPPTIPPNATLQFDVELLSW 
Sbjct  102  FKLGRGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGSPPTIPPNATLQFDVELLSWS  161

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHF  671
            SVKDICKDGGI KKVL EGEKW+NPKD DEV VKYEA LEDGTL++KSD VEFTV +G+F
Sbjct  162  SVKDICKDGGILKKVLVEGEKWDNPKDLDEVFVKYEASLEDGTLISKSDGVEFTVGDGYF  221

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            C AL KAVKTMKKGEKV LTV PQY FGE
Sbjct  222  CAALAKAVKTMKKGEKVLLTVMPQYAFGE  250


 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 118/205 (58%), Gaps = 12/205 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y  +L DGT    S       +FT+G G     
Sbjct  169  DGGILKKVLVEGEKWDNPKDLDEVFVKYEASLEDGTLISKS----DGVEFTVGDGYFCAA  224

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE+G P +     +PP+A+LQ  +EL+SW +V D+ 
Sbjct  225  LAKAVKTMKKGEKVLLTVMPQYAFGETGRPASGDEAAVPPDASLQIMLELVSWKTVSDVT  284

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI---VEFTVEEGHFCPA  680
            KD  + KK L EGE +E P D   V V+   +L+DGT+  K D     EF ++E      
Sbjct  285  KDKKVLKKTLKEGEGYERPNDGAAVQVRLCGKLQDGTVFVKKDDEEPFEFKIDEEQVIDG  344

Query  681  LTKAVKTMKKGEKVQLTVKPQYGFG  755
            L +AVK MKKGE   +T++P+Y FG
Sbjct  345  LDRAVKNMKKGEVALVTIQPEYAFG  369


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK +KEG G+E P  G  V+V   G L DGT F   +D   PF+F + + QVI G
Sbjct  286  DKKVLKKTLKEGEGYERPNDGAAVQVRLCGKLQDGTVF-VKKDDEEPFEFKIDEEQVIDG  344

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VELLS+V  K+
Sbjct  345  LDRAVKNMKKGEVALVTIQPEYAFGPTESQQDLAVVPANSTVYYEVELLSFVKEKE  400



>ref|XP_010023593.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW59904.1| hypothetical protein EUGRSUZ_H02629 [Eucalyptus grandis]
Length=617

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = +3

Query  132  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  311
            V+KVGEE+EIG  G KKKLVKEG GWETP  GDEVEVHYTGTLLDGTKFDSSRDRGTPFK
Sbjct  42   VLKVGEEREIGKAGFKKKLVKEGEGWETPSSGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  101

Query  312  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            F LG+GQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGSPPTIPPNATLQFDVELLSW 
Sbjct  102  FKLGRGQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGSPPTIPPNATLQFDVELLSWS  161

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHF  671
            SVKDICKDGGI KKVL EGEKW+NPKD DEV VKYEA LEDGTL++KSD VEFTV +G+F
Sbjct  162  SVKDICKDGGILKKVLVEGEKWDNPKDLDEVFVKYEASLEDGTLISKSDGVEFTVGDGYF  221

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            C AL KAVKTMKKGEKV LTV PQY FGE
Sbjct  222  CAALAKAVKTMKKGEKVLLTVMPQYAFGE  250


 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 118/205 (58%), Gaps = 12/205 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  W+ P+  DEV V Y  +L DGT    S       +FT+G G     
Sbjct  169  DGGILKKVLVEGEKWDNPKDLDEVFVKYEASLEDGTLISKS----DGVEFTVGDGYFCAA  224

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+GE+G P +     +PP+A+LQ  +EL+SW +V D+ 
Sbjct  225  LAKAVKTMKKGEKVLLTVMPQYAFGETGRPASGDEAAVPPDASLQIMLELVSWKTVSDVT  284

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI---VEFTVEEGHFCPA  680
            KD  + KK L EGE +E P D   V V+   +L+DGT+  K D     EF ++E      
Sbjct  285  KDKKVLKKTLKEGEGYERPNDGAAVQVRLCGKLQDGTVFVKKDDEEPFEFKIDEEQVIDG  344

Query  681  LTKAVKTMKKGEKVQLTVKPQYGFG  755
            L +AVK MKKGE   +T++P+Y FG
Sbjct  345  LDRAVKNMKKGEVALVTIQPEYAFG  369


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK +KEG G+E P  G  V+V   G L DGT F   +D   PF+F + + QVI G
Sbjct  286  DKKVLKKTLKEGEGYERPNDGAAVQVRLCGKLQDGTVF-VKKDDEEPFEFKIDEEQVIDG  344

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VELLS+V  K+
Sbjct  345  LDRAVKNMKKGEVALVTIQPEYAFGPTESQQDLAVVPANSTVYYEVELLSFVKEKE  400



>dbj|BAB02082.1| peptidylprolyl isomerase; FK506-binding protein [Arabidopsis 
thaliana]
Length=555

 Score =   360 bits (924),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 199/232 (86%), Gaps = 5/232 (2%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIP NATLQFDVELL W SVKDICKDGG+FKK+LA GEKWENPKD DEV VK+EA
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +LEDGT+V KSD VEFTV++GHFCPALTKAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  KLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 122/235 (52%), Gaps = 16/235 (7%)
 Frame = +3

Query  87   PPAEMDDLDLPDDNPVMKVGEEKEI-GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            PP    +  L  D  ++K    K+I  D G+ KK++  G  WE P+  DEV V +   L 
Sbjct  126  PPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEAKLE  185

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-  440
            DGT    S       +FT+  G       + +KTMKKGE  + T+ P   +GE G P + 
Sbjct  186  DGTVVGKS----DGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASA  241

Query  441  ----IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
                +PPNATL+ ++EL+SW +V ++  D  + KKVL EG+ +E P +   V VK   +L
Sbjct  242  GEGAVPPNATLEINLELVSWKTVSEVTDDNKVVKKVLKEGDGYERPNEGAVVKVKLIGKL  301

Query  609  EDGTLVAKS------DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            +DGT+  K       +  EF  +E      L +AV  MKKGE   +T+ P+Y FG
Sbjct  302  QDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFG  356


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>ref|XP_006395163.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
 gb|ESQ32449.1| hypothetical protein EUTSA_v10003906mg [Eutrema salsugineum]
Length=573

 Score =   360 bits (925),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 205/237 (86%), Gaps = 9/237 (4%)
 Frame = +3

Query  72   EDFDMP-----PAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            +DFDM      P EMD LDL DD   +P+MKVGEEKEIG  GLKKKLVKEG  W+TPE G
Sbjct  3    DDFDMQLPAEEPEEMD-LDLADDAESDPIMKVGEEKEIGKLGLKKKLVKEGEKWDTPENG  61

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+
Sbjct  62   DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWDIGIKTMKKGENAIFTIPPE  121

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGE+GSPPTIPPNATLQFDVELLSW SVKDIC DGG+FKK++ EGEKWE PKD DEV 
Sbjct  122  LAYGETGSPPTIPPNATLQFDVELLSWRSVKDICGDGGLFKKIIVEGEKWEKPKDLDEVF  181

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLEDGT+V +SD  EFTV+EGHFCPAL KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  182  VKYEARLEDGTIVGRSDGAEFTVKEGHFCPALAKAVKTMKRGEKVLLTVKPQYGFGE  238


 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 112/210 (53%), Gaps = 16/210 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD GL KK++ EG  WE P+  DEV V Y   L DGT       R    +FT+ +G    
Sbjct  156  GDGGLFKKIIVEGEKWEKPKDLDEVFVKYEARLEDGTIVG----RSDGAEFTVKEGHFCP  211

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPP------TIPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE G P        IPPNATLQ D++L+SW +V +
Sbjct  212  ALAKAVKTMKRGEKVLLTVKPQYGFGEIGRPADAGSHAAIPPNATLQIDLQLVSWKTVLE  271

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEG  665
            +  D  + KK+L EGE ++ P +   V +K   RL++G +  K       +  EF  +E 
Sbjct  272  VTDDKKVIKKILKEGEGYDRPNEGALVKLKLIGRLQNGIVFLKKGHAEDDEPFEFKTDEE  331

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L + V +MKKGE   +T+ P+Y FG
Sbjct  332  QVIEGLERGVMSMKKGEVALITICPEYAFG  361


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 90/157 (57%), Gaps = 11/157 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--  278
            DL L     V++V ++K++      KK++KEG G++ P  G  V++   G L +G  F  
Sbjct  260  DLQLVSWKTVLEVTDDKKV-----IKKILKEGEGYDRPNEGALVKLKLIGRLQNGIVFLK  314

Query  279  DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPP  449
                +   PF+F   + QVI+G ++G+ +MKKGE  + TI P+ A+G S S      IPP
Sbjct  315  KGHAEDDEPFEFKTDEEQVIEGLERGVMSMKKGEVALITICPEYAFGSSESKQELALIPP  374

Query  450  NATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWE  560
            ++T+ F+VEL+S++  K+   D    +K+ A G+K E
Sbjct  375  SSTVCFEVELVSFIKEKESW-DMNTQEKIEAAGKKKE  410



>gb|AAB82061.1| rof1 [Arabidopsis thaliana]
Length=551

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 199/232 (86%), Gaps = 5/232 (2%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIP NATLQFDVELL W SVKDICKDGG+FKK+LA GEKWENPKD DEV VK+EA
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +LEDGT+V KSD VEFTV++GHFCPALTKAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  KLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 122/235 (52%), Gaps = 16/235 (7%)
 Frame = +3

Query  87   PPAEMDDLDLPDDNPVMKVGEEKEI-GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            PP    +  L  D  ++K    K+I  D G+ KK++  G  WE P+  DEV V +   L 
Sbjct  126  PPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEAKLE  185

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-  440
            DGT    S       +FT+  G       + +KTMKKGE  + T+ P   +GE G P + 
Sbjct  186  DGTVVGKS----DGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASA  241

Query  441  ----IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
                +PPNATL+ ++EL+SW +V ++  D  + KKVL EG+ +E P +   V VK   +L
Sbjct  242  GEGAVPPNATLEINLELVSWKTVSEVTDDNKVVKKVLKEGDGYERPNEGAVVKVKLIGKL  301

Query  609  EDGTLVAKS------DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            +DGT+  K       +  EF  +E      L +AV  MKKGE   +T+ P+Y FG
Sbjct  302  QDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFG  356


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>ref|NP_189160.3| rotamase FKBP 1 [Arabidopsis thaliana]
 sp|Q38931.2|FKB62_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP62; Short=PPIase 
FKBP62; AltName: Full=70 kDa peptidyl-prolyl isomerase; 
AltName: Full=FK506-binding protein 62; Short=AtFKBP62; 
AltName: Full=Immunophilin FKBP62; AltName: Full=Peptidylprolyl 
isomerase ROF1; AltName: Full=Protein ROTAMASE FKBP 1; 
AltName: Full=Rotamase [Arabidopsis thaliana]
 gb|AAB82062.1| rof1 [Arabidopsis thaliana]
 gb|AEE76996.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=551

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 199/232 (86%), Gaps = 5/232 (2%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIP NATLQFDVELL W SVKDICKDGG+FKK+LA GEKWENPKD DEV VK+EA
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +LEDGT+V KSD VEFTV++GHFCPALTKAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  KLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 122/235 (52%), Gaps = 16/235 (7%)
 Frame = +3

Query  87   PPAEMDDLDLPDDNPVMKVGEEKEI-GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            PP    +  L  D  ++K    K+I  D G+ KK++  G  WE P+  DEV V +   L 
Sbjct  126  PPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEAKLE  185

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-  440
            DGT    S       +FT+  G       + +KTMKKGE  + T+ P   +GE G P + 
Sbjct  186  DGTVVGKS----DGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASA  241

Query  441  ----IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
                +PPNATL+ ++EL+SW +V ++  D  + KKVL EG+ +E P +   V VK   +L
Sbjct  242  GEGAVPPNATLEINLELVSWKTVSEVTDDNKVVKKVLKEGDGYERPNEGAVVKVKLIGKL  301

Query  609  EDGTLVAKS------DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            +DGT+  K       +  EF  +E      L +AV  MKKGE   +T+ P+Y FG
Sbjct  302  QDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFG  356


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>dbj|BAE99990.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=578

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 190/218 (87%), Gaps = 0/218 (0%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D D  D  P +K+GEE EIG  GLKKKLVKE   W+TPE GDEVEVHYTGTLLDGTKFDS
Sbjct  25   DNDEADSAPYLKIGEEMEIGKSGLKKKLVKECEKWDTPENGDEVEVHYTGTLLDGTKFDS  84

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            SRDRGTPFKFTLGQG VIKGWD GIKTMKKGE  IFTIPP+LAYGE+GSPPTIPPNATLQ
Sbjct  85   SRDRGTPFKFTLGQGHVIKGWDLGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNATLQ  144

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIV  644
            FDVEL++W SVKDIC DGG+ KK++ EGEKWE PKD DEV VKYEARLEDGT+V KSD V
Sbjct  145  FDVELIAWRSVKDICGDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGV  204

Query  645  EFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             FTV+EGHFCPAL+KAVKTMK+GEKV LTVKPQYGFGE
Sbjct  205  GFTVKEGHFCPALSKAVKTMKRGEKVLLTVKPQYGFGE  242


 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 114/211 (54%), Gaps = 17/211 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  WE P+  DEV V Y   L DGT    S   G    FT+ +G    
Sbjct  160  GDGGVSKKIIVEGEKWEKPKDLDEVYVKYEARLEDGTIVGKSDGVG----FTVKEGHFCP  215

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
               + +KTMK+GE  + T+ P   +GE G P +      IPPNATLQ D+EL+SW +V +
Sbjct  216  ALSKAVKTMKRGEKVLLTVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELVSWKTVVE  275

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV-------AKSDIVEFTVEE  662
            +  D  + KK+L EGE +E P +   V +K   +L+DGT V          +  EF ++E
Sbjct  276  VTDDRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDE  335

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                  L KAV  MKKGE   +T+ P+Y FG
Sbjct  336  EQVIEGLEKAVMGMKKGEVALITISPEYAFG  366


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 71/119 (60%), Gaps = 6/119 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQV  335
            D+ + KK++KEG G+E P  G  V++   G L DGT         +   PF+F + + QV
Sbjct  279  DRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDEEQV  338

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            I+G ++ +  MKKGE  + TI P+ A+G S S      IPPN+T+ ++VEL+S++  K+
Sbjct  339  IEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELVSFIKEKE  397



>ref|XP_010466944.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 202/233 (87%), Gaps = 6/233 (3%)
 Frame = +3

Query  75   DFDMPPA-----EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            D++MPP      +  D+D  D    +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  4    DYEMPPVGGMNDDDIDMDFGDAAAYLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELL+WVSVKDICKDGG+FKK+LA GEKWENPKD DEV VK+E
Sbjct  123  ESGSPPTIPANATLQFDVELLTWVSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+L+DGT+V KSD VEFTV++G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  AKLDDGTIVGKSDGVEFTVKDGNFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  235


 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++  G  WE P+  DEV V +   L DGT    S       +FT+  G     
Sbjct  154  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLDDGTIVGKS----DGVEFTVKDGNFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASSGEGAVPPNATLEINLELVSWKTVSEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +     VK   +L+DGT+  K       ++ EF  +E   
Sbjct  270  DDNKVMKKILKEGEGYERPNEGAVAKVKLIGKLQDGTVFLKKGHGENEELFEFKTDEEQV  329

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +TV+P+Y FG
Sbjct  330  VDGLDRAVMKMKKGEVALVTVEPEYAFG  357


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = +3

Query  111  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  284
            ++ DDN VMK              K++KEG G+E P  G   +V   G L DGT F    
Sbjct  267  EVTDDNKVMK--------------KILKEGEGYERPNEGAVAKVKLIGKLQDGTVFLKKG  312

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
              +    F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S      +PPN+
Sbjct  313  HGENEELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVEPEYAFGSNESKQELAVVPPNS  372

Query  456  TLQFDVELLSW  488
            T+ ++V+L+++
Sbjct  373  TVYYEVDLVTF  383



>gb|AFK48961.1| unknown [Medicago truncatula]
Length=495

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 203/233 (87%), Gaps = 6/233 (3%)
 Frame = +3

Query  66   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            + +DF++P AE   +D DLP++    KVG+E+E+GD+GLKKKL+K G GW+TPE GDEV+
Sbjct  1    MNDDFEIPQAEEMNEDFDLPEE----KVGDEREVGDRGLKKKLLKLGEGWDTPESGDEVQ  56

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  57   VHYTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDEGIKTMKKGENALFTIPPELAYG  116

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVE+LSW SVKDICKDGGIFK++L EGEKWENPKDPDEV V YE
Sbjct  117  ESGSPPTIPPNATLQFDVEMLSWTSVKDICKDGGIFKRILKEGEKWENPKDPDEVLVNYE  176

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             RLEDG  VAKSD VEFTV EGH+CPA +KAVK MKKGEKV L VKPQYGFGE
Sbjct  177  VRLEDGKAVAKSDGVEFTVSEGHYCPAFSKAVKAMKKGEKVILLVKPQYGFGE  229


 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 15/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K+++KEG  WE P+  DEV V+Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILKEGEKWENPKDPDEVLVNYEVRLEDGKAVAKS----DGVEFTVSEGHYCPA  203

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
            + + +K MKKGE  I  + P   +GE G P       +PPNA+LQ  +EL+SW +V D+ 
Sbjct  204  FSKAVKAMKKGEKVILLVKPQYGFGEKGKPAHGDEGAVPPNASLQITLELVSWKTVSDVT  263

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV------AKSDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT+        +  + EF  +E   
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGF  752
               L KAV TMKKGE   L + P+Y F
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAF  350


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQV  335
             D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP--TIPPNATLQFDV  473
            I G D+ + TMKKGE  +  I P+ A+  S S     +PPN+T+ ++ 
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAFDSSQSQQELAVPPNSTVYYEA  371



>ref|XP_004290160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Fragaria 
vesca subsp. vesca]
Length=565

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/232 (82%), Positives = 205/232 (88%), Gaps = 3/232 (1%)
 Frame = +3

Query  72   EDFDM--PPAEM-DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            +DFDM  P  EM DD DLPDD PV+KVGEEKEIG QGLKKKL+K G  WETP+ GDEVEV
Sbjct  3    DDFDMAAPGGEMMDDFDLPDDGPVLKVGEEKEIGKQGLKKKLLKAGESWETPKSGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GIKTMKKGE  +FTIPP++AYG 
Sbjct  63   HYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIKTMKKGENALFTIPPEMAYGA  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIPPNATLQFDVELLSW SV DI KDGGI KKVL EGEKWENPKD DEV VK+EA
Sbjct  123  SGSPPTIPPNATLQFDVELLSWTSVNDITKDGGIIKKVLKEGEKWENPKDLDEVIVKFEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             LED TL+AKSD VEFTV+EG+FCPAL+KAVKTMKKGEKV L VKPQYGFG+
Sbjct  183  YLEDKTLIAKSDTVEFTVKEGYFCPALSKAVKTMKKGEKVLLAVKPQYGFGD  234


 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 110/208 (53%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V +   L D T    S       +FT+ +G     
Sbjct  153  DGGIIKKVLKEGEKWENPKDLDEVIVKFEAYLEDKTLIAKS----DTVEFTVKEGYFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +G+ G   +     +PPNATL   +EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEKVLLAVKPQYGFGDKGKAASGDEGAVPPNATLHITLELVSWRTVSELT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V+VK   +L+DGT+  K       +  EF  +E   
Sbjct  269  DDKKVIKKILKEGEGYERPNEGAVVTVKLIGKLQDGTVFLKKGHGEGEEPFEFKTDEEQV  328

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   + + P+Y FG
Sbjct  329  IEGLDKAVVTMKKGEIALVIIAPEYAFG  356


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F      +   PF+F   + QVI
Sbjct  270  DKKVIKKILKEGEGYERPNEGAVVTVKLIGKLQDGTVFLKKGHGEGEEPFEFKTDEEQVI  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ + TMKKGE  +  I P+ A+G S S      +PPN+TL +++EL+S+V  K+  
Sbjct  330  EGLDKAVVTMKKGEIALVIIAPEYAFGVSESKQELAVVPPNSTLYYEIELVSFVKDKESW  389

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  390  -DMNTPEKIEAAGKKKE  405



>gb|ACJ85592.1| unknown [Medicago truncatula]
Length=495

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 203/233 (87%), Gaps = 6/233 (3%)
 Frame = +3

Query  66   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            + +DF++P AE   +D DLP++    KVG+E+E+GD+GLKKKL+K G GW+TPE GDEV+
Sbjct  1    MNDDFEIPQAEEMNEDFDLPEE----KVGDEREVGDRGLKKKLLKLGEGWDTPESGDEVQ  56

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  57   VHYTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDEGIKTMKKGENALFTIPPELAYG  116

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVE+LSW SVKDICKDGGIFK++L EGEKWENPKDPDEV V YE
Sbjct  117  ESGSPPTIPPNATLQFDVEMLSWTSVKDICKDGGIFKRILKEGEKWENPKDPDEVLVNYE  176

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             RLEDG  VAKSD VEFTV EGH+CPA +KAVK MKKGEKV L VKPQYGFGE
Sbjct  177  VRLEDGKAVAKSDGVEFTVSEGHYCPAFSKAVKAMKKGEKVILLVKPQYGFGE  229


 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 15/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K+++KEG  WE P+  DEV V+Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILKEGEKWENPKDPDEVLVNYEVRLEDGKAVAKS----DGVEFTVSEGHYCPA  203

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
            + + +K MKKGE  I  + P   +GE G P       +PPNA+LQ  +EL+SW +V D+ 
Sbjct  204  FSKAVKAMKKGEKVILLVKPQYGFGEKGKPAHGDEGAVPPNASLQITLELVSWKTVSDVT  263

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV------AKSDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT+        +  + EF  +E   
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGF  752
               L KAV TMKKGE   L + P+Y F
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAF  350


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQV  335
             D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP--TIPPNATLQFDV  473
            I G D+ + TMKKGE  +  I P+ A+  S S     +PPN+T+ ++ 
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAFDSSQSQQELAVPPNSTVYYEA  371



>gb|KHN44911.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine soja]
Length=582

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/229 (83%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDFD   A   DLD    NP++KVGEEKEIG +GLKKKL+KEG GW+TPE GDEV+VHYT
Sbjct  15   EDFDFAGATGGDLDGSSSNPILKVGEEKEIGKEGLKKKLLKEGEGWDTPEVGDEVQVHYT  74

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYGE+GS
Sbjct  75   GTLLDGTKFDSSRDRGTPFSFTLGQGQVIKGWDQGIITMKKGENSLFTIPAELAYGETGS  134

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L +GEKWENPKDPDEV VKYEA LE
Sbjct  135  PPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTKGEKWENPKDPDEVLVKYEACLE  194

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DGTLVAKSD VEFTV +G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  195  DGTLVAKSDGVEFTVNDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  243


 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++ +G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  162  DGGLFKKILTKGEKWENPKDPDEVLVKYEACLEDGTLVAKSDG----VEFTVNDGYFCPA  217

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  218  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPAHDEEGAVPPNATLQITLELVSWKTVSEVT  277

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
            +D  I KK+L EGE +E P +   V +K   +L+DGTL  K       ++ EF  +E   
Sbjct  278  EDKKIIKKILKEGEGYERPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQV  337

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   L + P+Y FG
Sbjct  338  IDGLDRAVLTMKKGEIALLIIAPEYAFG  365


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVIKGWDQGIKTM  368
            EG G+E P  G  V++   G L DGT F      D G  F+F   + QVI G D+ + TM
Sbjct  289  EGEGYERPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQVIDGLDRAVLTM  348

Query  369  KKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            KKGE  +  I P+ A+G S S      +PPN+T+ ++VEL+S+
Sbjct  349  KKGEIALLIIAPEYAFGSSESQLELAVVPPNSTVYYEVELVSF  391



>gb|KEH22557.1| FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=544

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 203/233 (87%), Gaps = 6/233 (3%)
 Frame = +3

Query  66   IMEDFDMPPAE--MDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            + +DF++P AE   +D DLP++    KVG+E+E+GD+GLKKKL+K G GW+TPE GDEV+
Sbjct  1    MNDDFEIPQAEEMNEDFDLPEE----KVGDEREVGDRGLKKKLLKLGEGWDTPESGDEVQ  56

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR +PF FTLGQGQVI+GWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  57   VHYTGTLLDGTKFDSSRDRDSPFSFTLGQGQVIQGWDEGIKTMKKGENALFTIPPELAYG  116

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVE+LSW SVKDICKDGGIFK++L EGEKWENPKDPDEV V YE
Sbjct  117  ESGSPPTIPPNATLQFDVEMLSWTSVKDICKDGGIFKRILKEGEKWENPKDPDEVLVNYE  176

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             RLEDG  VAKSD VEFTV EGH+CPA +KAVK MKKGEKV L VKPQYGFGE
Sbjct  177  VRLEDGKAVAKSDGVEFTVSEGHYCPAFSKAVKAMKKGEKVILLVKPQYGFGE  229


 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 15/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K+++KEG  WE P+  DEV V+Y   L DG     S       +FT+ +G     
Sbjct  148  DGGIFKRILKEGEKWENPKDPDEVLVNYEVRLEDGKAVAKS----DGVEFTVSEGHYCPA  203

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
            + + +K MKKGE  I  + P   +GE G P       +PPNA+LQ  +EL+SW +V D+ 
Sbjct  204  FSKAVKAMKKGEKVILLVKPQYGFGEKGKPAHGDEGAVPPNASLQITLELVSWKTVSDVT  263

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV------AKSDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT+        +  + EF  +E   
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGF  752
               L KAV TMKKGE   L + P+Y F
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAF  350


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 76/137 (55%), Gaps = 5/137 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQV  335
             D+ + KK++KEG G+E P  G  V++   G L DGT F      +    F+F   + QV
Sbjct  264  SDKKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTVFFEKGHDEEEKLFEFKTDEEQV  323

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP--TIPPNATLQFDVELLSWVSVKDIC  509
            I G D+ + TMKKGE  +  I P+ A+  S S     +PPN+T+ ++VEL+S+   K+  
Sbjct  324  IDGLDKAVLTMKKGEVALLIIAPEYAFDSSQSQQELAVPPNSTVYYEVELVSYEKEKESW  383

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  384  -DMNTQEKIEAAGKKKE  399



>ref|NP_001118695.1| rotamase FKBP 1 [Arabidopsis thaliana]
 gb|AEE76997.1| rotamase FKBP 1 [Arabidopsis thaliana]
Length=562

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 199/232 (86%), Gaps = 5/232 (2%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            +F+MPP    + D   D       +KVGEEKEI  QGLKKKL+KEG G+ETPE GDEVEV
Sbjct  4    NFEMPPVGGMNDDDDMDFGDGASFLKVGEEKEI-QQGLKKKLLKEGEGYETPENGDEVEV  62

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGTKFDSSRDR TPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYGE
Sbjct  63   HYTGTLLDGTKFDSSRDRATPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYGE  122

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIP NATLQFDVELL W SVKDICKDGG+FKK+LA GEKWENPKD DEV VK+EA
Sbjct  123  SGSPPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEA  182

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +LEDGT+V KSD VEFTV++GHFCPALTKAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  KLEDGTVVGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGE  234


 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 122/235 (52%), Gaps = 16/235 (7%)
 Frame = +3

Query  87   PPAEMDDLDLPDDNPVMKVGEEKEI-GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            PP    +  L  D  ++K    K+I  D G+ KK++  G  WE P+  DEV V +   L 
Sbjct  126  PPTIPANATLQFDVELLKWDSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFEAKLE  185

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-  440
            DGT    S       +FT+  G       + +KTMKKGE  + T+ P   +GE G P + 
Sbjct  186  DGTVVGKS----DGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQYGFGEKGKPASA  241

Query  441  ----IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
                +PPNATL+ ++EL+SW +V ++  D  + KKVL EG+ +E P +   V VK   +L
Sbjct  242  GEGAVPPNATLEINLELVSWKTVSEVTDDNKVVKKVLKEGDGYERPNEGAVVKVKLIGKL  301

Query  609  EDGTLVAKS------DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            +DGT+  K       +  EF  +E      L +AV  MKKGE   +T+ P+Y FG
Sbjct  302  QDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVALVTIDPEYAFG  356


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D  + KK++KEG G+E P  G  V+V   G L DGT F      +   PF+F   + QV+
Sbjct  270  DNKVVKKVLKEGDGYERPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVV  329

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ +  MKKGE  + TI P+ A+G + S      +PPN+T+ ++V+LL++
Sbjct  330  DGLDRAVMKMKKGEVALVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTF  382



>ref|XP_003520990.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine 
max]
Length=582

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/229 (83%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDFD   A   DLD    NP++KVGEEKEIG +GLKKKL+KEG GW+TPE GDEV+VHYT
Sbjct  15   EDFDFAGATGGDLDGSSSNPILKVGEEKEIGKEGLKKKLLKEGEGWDTPEVGDEVQVHYT  74

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDSSRDRGTPF FTLGQGQVIKGWDQGI TMKKGE  +FTIP +LAYGE+GS
Sbjct  75   GTLLDGTKFDSSRDRGTPFSFTLGQGQVIKGWDQGIITMKKGENSLFTIPAELAYGETGS  134

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNATLQFDVELLSW SVKDICKDGG+FKK+L +GEKWENPKDPDEV VKYEA LE
Sbjct  135  PPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKILTKGEKWENPKDPDEVLVKYEACLE  194

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DGTLVAKSD VEFTV +G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  195  DGTLVAKSDGVEFTVNDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  243


 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++ +G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  162  DGGLFKKILTKGEKWENPKDPDEVLVKYEACLEDGTLVAKS----DGVEFTVNDGYFCPA  217

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  218  LSKAVKTMKKGEKVLLTVKPQYGFGEKGKPAHDEEGAVPPNATLQITLELVSWKTVSEVT  277

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
            +D  I KK+L EGE +E P +   V +K   +L+DGTL  K       ++ EF  +E   
Sbjct  278  EDKKIIKKILKEGEGYERPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQV  337

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   L + P+Y FG
Sbjct  338  IDGLDRAVLTMKKGEIALLIIGPEYAFG  365


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVIKGWDQGIKTM  368
            EG G+E P  G  V++   G L DGT F      D G  F+F   + QVI G D+ + TM
Sbjct  289  EGEGYERPNEGAIVKLKVIGKLQDGTLFLKKGHDDEGELFEFKTDEEQVIDGLDRAVLTM  348

Query  369  KKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            KKGE  +  I P+ A+G S S      +PPN+T+ ++VEL+S+
Sbjct  349  KKGEIALLIIGPEYAFGSSESQLELAVVPPNSTVYYEVELVSF  391



>ref|XP_006652190.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Oryza brachyantha]
Length=570

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = +3

Query  132  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  311
             MKVGEEKEIG QGL+KKL++EG GW+ PE GDEV+VHYTGTLLDGTKFDSSRDRGTPF 
Sbjct  22   AMKVGEEKEIGKQGLRKKLLREGEGWDRPETGDEVQVHYTGTLLDGTKFDSSRDRGTPFT  81

Query  312  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            F LGQG+VIKGWDQGIKTM+KGE  + T+PP+LAYGE+GSPP IP NATLQFDVELLSW 
Sbjct  82   FKLGQGEVIKGWDQGIKTMRKGEQAVLTVPPELAYGEAGSPPAIPANATLQFDVELLSWA  141

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHF  671
            SVKDICKDGG+FKKVLAEG+KW+NPKD DEV VKYEARLEDGT+V+KSD VEF V++G+F
Sbjct  142  SVKDICKDGGVFKKVLAEGQKWDNPKDLDEVLVKYEARLEDGTVVSKSDGVEFAVKDGYF  201

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            CPAL+KAVKTMKKGEK  LTVKPQYGFGE
Sbjct  202  CPALSKAVKTMKKGEKALLTVKPQYGFGE  230


 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 119/234 (51%), Gaps = 15/234 (6%)
 Frame = +3

Query  87   PPAEMDDLDLPDDNPVMKVGEEKEI-GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            PPA   +  L  D  ++     K+I  D G+ KK++ EG  W+ P+  DEV V Y   L 
Sbjct  122  PPAIPANATLQFDVELLSWASVKDICKDGGVFKKVLAEGQKWDNPKDLDEVLVKYEARLE  181

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-  440
            DGT    S       +F +  G       + +KTMKKGE  + T+ P   +GE G P + 
Sbjct  182  DGTVVSKS----DGVEFAVKDGYFCPALSKAVKTMKKGEKALLTVKPQYGFGEQGRPASG  237

Query  441  ----IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARL  608
                +PPNA L  D+EL+SW  V  I  D  I KKVL EGE +E P D   V V++  +L
Sbjct  238  DEGAVPPNAILHIDLELVSWKIVTLIGDDKRILKKVLKEGEGYERPNDGAIVRVRFIGKL  297

Query  609  EDGTLVAKS-----DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            EDGT+ AK      +  EF  +E      L + V TMKKGE   + V PQ+ FG
Sbjct  298  EDGTVFAKRGHDGDEPFEFKTDEEQVIEGLDRTVVTMKKGEVALVRVPPQHAFG  351


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V  +G++K I      KK++KEG G+E P  G  V V + G L DGT F  
Sbjct  251  DLELVSWKIVTLIGDDKRI-----LKKVLKEGEGYERPNDGAIVRVRFIGKLEDGTVFAK  305

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   PF+F   + QVI+G D+ + TMKKGE  +  +PP  A+G + +      +P N
Sbjct  306  RGHDGDEPFEFKTDEEQVIEGLDRTVVTMKKGEVALVRVPPQHAFGSTETKQDLAVVPAN  365

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL S+
Sbjct  366  STVWYEVELGSF  377



>ref|XP_010514063.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Camelina 
sativa]
Length=562

 Score =   358 bits (918),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 199/233 (85%), Gaps = 6/233 (3%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLPDDN-----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            DF+MPP    + D  D +       +KVGEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  4    DFEMPPVGGMNDDDMDMDFGDAAAYLKVGEEKEI-QQGLKKKLVKEGEGYETPENGDEVE  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDR  PFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP +LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRAAPFKFTLGQGQVIKGWDIGIKTMKKGENAVFTIPAELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATL+FDVELL+WVSVKDICKDGG+FKK+LA GEKWENPKD DEV VK+E
Sbjct  123  ESGSPPTIPANATLRFDVELLTWVSVKDICKDGGVFKKILAVGEKWENPKDLDEVLVKFE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            A+L+DGT+V KSD V FTV++GHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  AKLDDGTIVGKSDGVGFTVKDGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  235


 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 112/208 (54%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++  G  WE P+  DEV V +   L DGT    S   G    FT+  G     
Sbjct  154  DGGVFKKILAVGEKWENPKDLDEVLVKFEAKLDDGTIVGKSDGVG----FTVKDGHFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P +     +PPNATL+ ++EL+SW +V ++ 
Sbjct  210  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPASAGEGAVPPNATLEINLELVSWKTVSEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +     VK   +L+DGT+  K       ++ EF  +E   
Sbjct  270  DDNKVMKKILKEGEGYERPNEGAVAKVKLIGKLQDGTVFLKKGHGENEELFEFKTDEEQV  329

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV  MKKGE   +TV+P+Y FG
Sbjct  330  VDGLDRAVMKMKKGEVALVTVEPEYAFG  357


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = +3

Query  111  DLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DS  284
            ++ DDN VMK              K++KEG G+E P  G   +V   G L DGT F    
Sbjct  267  EVTDDNKVMK--------------KILKEGEGYERPNEGAVAKVKLIGKLQDGTVFLKKG  312

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
              +    F+F   + QV+ G D+ +  MKKGE  + T+ P+ A+G + S      +PPN+
Sbjct  313  HGENEELFEFKTDEEQVVDGLDRAVMKMKKGEVALVTVEPEYAFGSNESKQELAVVPPNS  372

Query  456  TLQFDVELLSW  488
            T+ ++V+L+++
Sbjct  373  TVYYEVDLVTF  383



>ref|XP_004247908.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Solanum lycopersicum]
Length=581

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = +3

Query  114  LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRD  293
            +P+ +PVMKV EEKEIG  G+KKKL+KEG GWE P  GD++EVHY GTLLDGT+FDSS D
Sbjct  32   VPEPDPVMKVDEEKEIGKSGIKKKLLKEGEGWEHPSQGDDIEVHYVGTLLDGTQFDSSCD  91

Query  294  RGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDV  473
            RGTPFKF LG+GQVIKGWD+GIKTMKKGE  +FTIPPD+AYGESGSPPTIPPNATLQF+V
Sbjct  92   RGTPFKFKLGEGQVIKGWDEGIKTMKKGEKALFTIPPDMAYGESGSPPTIPPNATLQFEV  151

Query  474  ELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFT  653
            ELLSW+SVKDICKDGGIFKK+L EGE W+NPKD DEV VKYEARLEDGT+V+KSD VEFT
Sbjct  152  ELLSWISVKDICKDGGIFKKILIEGEGWQNPKDLDEVFVKYEARLEDGTVVSKSDGVEFT  211

Query  654  VEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VE+G+ CPAL+KAVKTMKKGEKV LTVKPQY FG+
Sbjct  212  VEDGYCCPALSKAVKTMKKGEKVILTVKPQYAFGQ  246


 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 116/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  165  DGGIFKKILIEGEGWQNPKDLDEVFVKYEARLEDGTVVSKS----DGVEFTVEDGYCCPA  220

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I T+ P  A+G++G   +     +PPNATLQ ++EL+SW  V ++ 
Sbjct  221  LSKAVKTMKKGEKVILTVKPQYAFGQTGKVGSGEDGGVPPNATLQINLELISWKIVSEVT  280

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  + K++L EGE +E P D   V VK   +L+DGT+  K      +  EF ++E    
Sbjct  281  NDKKVLKRILKEGEGYERPNDSALVKVKLIGKLQDGTVFVKKGHNEGEPFEFKIDEEQVV  340

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAVK MKKGE   +T++P+Y FG
Sbjct  341  DGLDKAVKKMKKGEIALITIQPEYAFG  367


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (58%), Gaps = 5/137 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  338
             D+ + K+++KEG G+E P     V+V   G L DGT F     + G PF+F + + QV+
Sbjct  281  NDKKVLKRILKEGEGYERPNDSALVKVKLIGKLQDGTVFVKKGHNEGEPFEFKIDEEQVV  340

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G D+ +K MKKGE  + TI P+ A+G   SP     +P N+ + ++VEL+S+V  K+  
Sbjct  341  DGLDKAVKKMKKGEIALITIQPEYAFGAFDSPQDLAVVPGNSVVYYEVELVSFVKEKE-S  399

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  400  WDMSTQEKIEAAGKKKE  416



>ref|XP_010685108.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Beta vulgaris 
subsp. vulgaris]
Length=547

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/233 (82%), Positives = 205/233 (88%), Gaps = 5/233 (2%)
 Frame = +3

Query  72   EDFDMPPAE--MDD--LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            +DFDMP AE  M+D  +D  D+   MKVGEEKEI  +GLKKKL+KEG GW+ P+ GDEVE
Sbjct  3    DDFDMPAAEDMMNDENMDFADETS-MKVGEEKEISKEGLKKKLLKEGEGWDNPDNGDEVE  61

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  I TIP +LAYG
Sbjct  62   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDIGIKTMKKGENAILTIPAELAYG  121

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            E+GSPPTIPP+ATLQFDVELLSWVSVKDICKDGGIFKK+L EGEKWENPKD DEV V+YE
Sbjct  122  EAGSPPTIPPSATLQFDVELLSWVSVKDICKDGGIFKKILTEGEKWENPKDTDEVFVRYE  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGTLV KSD VEFTV EGHFCPAL+KAVKTMKKGEK  L+VKPQYGFGE
Sbjct  182  ARLEDGTLVGKSDGVEFTVNEGHFCPALSKAVKTMKKGEKALLSVKPQYGFGE  234


 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 113/206 (55%), Gaps = 13/206 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  153  DGGIFKKILTEGEKWENPKDTDEVFVRYEARLEDGTLVGKS----DGVEFTVNEGHFCPA  208

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + ++ P   +GE G P +     +PP+A L+  +EL+SW +V ++ 
Sbjct  209  LSKAVKTMKKGEKALLSVKPQYGFGEQGKPASGNEGAVPPSAVLEITLELVSWKTVSNVT  268

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  + KK+L EGE ++ P +   V +K   +L+DGT+  K     D+ EF  +E     
Sbjct  269  DDKKVVKKILKEGEGYDRPNEGAVVKLKLIGKLQDGTVFLKKGHEDDLFEFKTDEEQVIQ  328

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AV TMKKGE   LT+ P+Y FG
Sbjct  329  GLDRAVLTMKKGEVASLTIAPEYAFG  354


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 65/111 (59%), Gaps = 3/111 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK++KEG G++ P  G  V++   G L DGT F         F+F   + QVI+G
Sbjct  270  DKKVVKKILKEGEGYDRPNEGAVVKLKLIGKLQDGTVFLKKGHEDDLFEFKTDEEQVIQG  329

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             D+ + TMKKGE    TI P+ A+G   +      +PPN+T+ +++EL+S+
Sbjct  330  LDRAVLTMKKGEVASLTIAPEYAFGSLETKQDLAVVPPNSTVCYEIELVSF  380



>ref|XP_009420312.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=562

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/233 (81%), Positives = 205/233 (88%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPAE--MDD--LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFD+P +E   DD  +D PD++P  ++GEEKEIG QGLKKKLVK+G GW+ PE GDEVE
Sbjct  4    EDFDLPGSEEAADDGLMDPPDEDPSFEIGEEKEIGKQGLKKKLVKKGDGWDVPEAGDEVE  63

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+LAYG
Sbjct  64   VHYTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPELAYG  123

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            E GSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKD DEV VKYE
Sbjct  124  EHGSPPTIPPNATLQFDVELLSWCSVKDICKDGGIFKKILKEGEKWENPKDLDEVLVKYE  183

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARLEDGT+++KS+ VEFTV +G FCPAL KAVKTMK+ EKV LTVKPQY FGE
Sbjct  184  ARLEDGTVISKSEGVEFTVTDGLFCPALAKAVKTMKRAEKVLLTVKPQYAFGE  236


 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 111/206 (54%), Gaps = 14/206 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S+  G   +FT+  G     
Sbjct  155  DGGIFKKILKEGEKWENPKDLDEVLVKYEARLEDGTVI--SKSEGV--EFTVTDGLFCPA  210

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMK+ E  + T+ P  A+GE G P +     +PPNA L  ++EL+SW +V  I 
Sbjct  211  LAKAVKTMKRAEKVLLTVKPQYAFGEKGRPASGDEGAVPPNANLYVELELVSWKTVTQIG  270

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I K +L EGE +++P +   V+VK   +L+DGT+  K      +  EF   E    
Sbjct  271  DDKKIIKMILKEGEGYDHPNEGAVVTVKLIGKLQDGTIFVKKGHDEQESFEFKTAEEKVI  330

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGF  752
              L +AV TM KGE   +T+ P+Y F
Sbjct  331  EGLDQAVMTMNKGEIALVTIPPEYAF  356


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 77/137 (56%), Gaps = 9/137 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            +L+L     V ++G++K+I      K ++KEG G++ P  G  V V   G L DGT F  
Sbjct  257  ELELVSWKTVTQIGDDKKI-----IKMILKEGEGYDHPNEGAVVTVKLIGKLQDGTIFVK  311

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D    F+F   + +VI+G DQ + TM KGE  + TIPP+ A+  + S      +P N
Sbjct  312  KGHDEQESFEFKTAEEKVIEGLDQAVMTMNKGEIALVTIPPEYAFLSTESKQDLAVVPAN  371

Query  453  ATLQFDVELLSWVSVKD  503
            +T+ ++VEL+S+V  K+
Sbjct  372  STVIYEVELVSFVKEKE  388



>gb|EEC73201.1| hypothetical protein OsI_07270 [Oryza sativa Indica Group]
Length=600

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            M+VGEEKEIG +GL+KKLVKEG GWE P+ GDEV+VHYTGTLLDGTKFDSSRDR  PFKF
Sbjct  1    MEVGEEKEIGKEGLRKKLVKEGEGWERPDAGDEVQVHYTGTLLDGTKFDSSRDRDAPFKF  60

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  494
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVEL+SW S
Sbjct  61   TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELISWES  120

Query  495  VKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFC  674
            VKDICKDGGI KKVLAEG KWENP+D DEV VKYE RLEDGT+VA+SD VEFTV++GHFC
Sbjct  121  VKDICKDGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAESDGVEFTVKDGHFC  180

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            PA++KAVKTMKK EK  LTVKPQYGFGE
Sbjct  181  PAISKAVKTMKKNEKALLTVKPQYGFGE  208


 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 108/207 (52%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  127  DGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAES----DGVEFTVKDGHFCPA  182

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P       IPPNATL  ++EL+SW +V +I 
Sbjct  183  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPAARDEAAIPPNATLHINLELVSWKAVTEIG  242

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE +E P D   V VK   +LEDGT+         +  EF  +E    
Sbjct  243  NDKKILKKILHEGEGYERPSDCTLVRVKLIGKLEDGTIFVTRGHDGDEPFEFKTDEDQVV  302

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P+Y FG
Sbjct  303  EGLDKAVLSMKKGEVALVTIPPEYAFG  329


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = +3

Query  90   PAEMDDLDLPDDNPVMKVGEE-------KEIG-DQGLKKKLVKEGAGWETPEPGDEVEVH  245
            PA  D+  +P  N  + +  E        EIG D+ + KK++ EG G+E P     V V 
Sbjct  212  PAARDEAAIPP-NATLHINLELVSWKAVTEIGNDKKILKKILHEGEGYERPSDCTLVRVK  270

Query  246  YTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
              G L DGT F +   D   PF+F   + QV++G D+ + +MKKGE  + TIPP+ A+G 
Sbjct  271  LIGKLEDGTIFVTRGHDGDEPFEFKTDEDQVVEGLDKAVLSMKKGEVALVTIPPEYAFGS  330

Query  423  SGSP---PTIPPNATLQFDVELLSW  488
              +      +PPN+T+ ++VEL+S+
Sbjct  331  DETRQDLSVVPPNSTVYYEVELVSF  355



>gb|EEE57017.1| hypothetical protein OsJ_06790 [Oryza sativa Japonica Group]
Length=600

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            M+VGEEKEIG +GL+KKLVKEG GWE P+ GDEV+VHYTGTLLDGTKFDSSRDR  PFKF
Sbjct  1    MEVGEEKEIGKEGLRKKLVKEGEGWERPDAGDEVQVHYTGTLLDGTKFDSSRDRDAPFKF  60

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  494
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVEL+SW S
Sbjct  61   TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELISWES  120

Query  495  VKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFC  674
            VKDICKDGGI KKVLAEG KWENP+D DEV VKYE RLEDGT+VA+SD VEFTV++GHFC
Sbjct  121  VKDICKDGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAESDGVEFTVKDGHFC  180

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            PA++KAVKTMKK EK  LTVKPQYGFGE
Sbjct  181  PAISKAVKTMKKNEKALLTVKPQYGFGE  208


 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 108/207 (52%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  127  DGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAES----DGVEFTVKDGHFCPA  182

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P       IPPNATL  ++EL+SW +V +I 
Sbjct  183  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPAARDEAAIPPNATLHINLELVSWKAVTEIG  242

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE +E P D   V VK   +LEDGT+         +  EF  +E    
Sbjct  243  NDKKILKKILHEGEGYERPSDCTLVRVKLIGKLEDGTIFVTRGHDGDEPFEFKTDEDQVV  302

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P+Y FG
Sbjct  303  EGLDKAVLSMKKGEVALVTIPPEYAFG  329


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = +3

Query  90   PAEMDDLDLPDDNPVMKVGEE-------KEIG-DQGLKKKLVKEGAGWETPEPGDEVEVH  245
            PA  D+  +P  N  + +  E        EIG D+ + KK++ EG G+E P     V V 
Sbjct  212  PAARDEAAIPP-NATLHINLELVSWKAVTEIGNDKKILKKILHEGEGYERPSDCTLVRVK  270

Query  246  YTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
              G L DGT F +   D   PF+F   + QV++G D+ + +MKKGE  + TIPP+ A+G 
Sbjct  271  LIGKLEDGTIFVTRGHDGDEPFEFKTDEDQVVEGLDKAVLSMKKGEVALVTIPPEYAFGS  330

Query  423  SGSP---PTIPPNATLQFDVELLSW  488
              +      +PPN+T+ ++VEL+S+
Sbjct  331  DETRQDLSVVPPNSTVYYEVELVSF  355



>ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula]
 gb|AET01419.1| peptidyl-prolyl cis-trans isomerase FKBP62-like protein [Medicago 
truncatula]
Length=575

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 190/233 (82%), Positives = 206/233 (88%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM--DDLDLPD--DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFD+P  +   DD D     DNP++KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEV 
Sbjct  3    EDFDIPAVDSMNDDFDFAGAGDNPILKVGEEKEIGKQGLKKKLLKEGEGWDTPDVGDEVH  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGT F FTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTTFNFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIPPNATLQFDVELLSW SVKDICKDGG+FKK++ EGEKWENPKD DEV VKYE
Sbjct  123  ESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGLFKKIVKEGEKWENPKDLDEVLVKYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARL+DGTLVAKSD VEFTV+EG+FCPAL KAVKTMKKGEKV LTVKPQYGF E
Sbjct  183  ARLDDGTLVAKSDGVEFTVKEGYFCPALPKAVKTMKKGEKVILTVKPQYGFDE  235


 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 115/209 (55%), Gaps = 16/209 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK+VKEG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  154  DGGLFKKIVKEGEKWENPKDLDEVLVKYEARLDDGTLVAKS----DGVEFTVKEGYFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I T+ P   + E G P       +PPNATL+  +EL+SW +V ++ 
Sbjct  210  LPKAVKTMKKGEKVILTVKPQYGFDEKGKPAHGDEGAVPPNATLEITLELVSWKTVSEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-------SDIVEFTVEEGH  668
             D  + KK++ EGE +E P D   V +K   +L+DGT+  K       +++ EFT +E  
Sbjct  270  DDKKVIKKIVKEGEGYERPNDGAVVKLKLIGKLQDGTVFLKKGHGDDEAELFEFTTDEEQ  329

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L +AV TMKKGE   LT+ P+Y FG
Sbjct  330  VIDGLDRAVMTMKKGEVALLTIAPEYAFG  358


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 72/128 (56%), Gaps = 7/128 (5%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQVIKGWDQGIKT  365
            EG G+E P  G  V++   G L DGT F       D    F+FT  + QVI G D+ + T
Sbjct  281  EGEGYERPNDGAVVKLKLIGKLQDGTVFLKKGHGDDEAELFEFTTDEEQVIDGLDRAVMT  340

Query  366  MKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKV  536
            MKKGE  + TI P+ A+G S S      +PPN+TL ++VEL+S++  K+   D    +KV
Sbjct  341  MKKGEVALLTIAPEYAFGSSESRQELAVVPPNSTLYYEVELVSFIKDKE-SWDMTTGEKV  399

Query  537  LAEGEKWE  560
             A G+K E
Sbjct  400  EAAGKKKE  407



>emb|CAA68913.1| peptidylprolyl isomerase [Triticum aestivum]
Length=568

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 6/225 (3%)
 Frame = +3

Query  99   MDDLDLPD----DNPV-MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            MD LD+ D    D+P  MKV EEKEIG QGLKKKLVKEG GW+T E   +VEVHYTGTLL
Sbjct  7    MDGLDVDDEEEADSPATMKVREEKEIGKQGLKKKLVKEGEGWDTAETALKVEVHYTGTLL  66

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  443
            DGTKFDSSRDRGTPFKF L QGQVIKGWDQGIKTMKKGE    TIPPDLAYGE  +P TI
Sbjct  67   DGTKFDSSRDRGTPFKFKLEQGQVIKGWDQGIKTMKKGENASLTIPPDLAYGER-APRTI  125

Query  444  PPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTL  623
            PPNATL+FDVELLSW SVKDICKDGGIFKKVL EG+KWENPKD DEV+VKYEARLEDG++
Sbjct  126  PPNATLRFDVELLSWASVKDICKDGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSV  185

Query  624  VAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V+KS+ +EF+V++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  186  VSKSESIEFSVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGE  230


 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 106/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DG+    S       +F++  G     
Sbjct  149  DGGIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSE----SIEFSVKDGYFCPA  204

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G   T     +PPN+TL  D++L+SW ++  I 
Sbjct  205  LSKAVKTMKKGEKVLLTVKPQYGFGEQGRAATEVEGAVPPNSTLHIDLQLVSWKTLTLIG  264

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KKVL EGE +E P D   V V    +L+DGT+  K      +  EF  +E    
Sbjct  265  DDKRILKKVLKEGEGYERPNDGAVVRVGLIGKLDDGTVFTKKGHEGDEPFEFKTDEEQVI  324

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L   V TMKKGE+    + P++ FG
Sbjct  325  QGLDTTVLTMKKGEEASARIPPEHAFG  351


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 7/115 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG-TPFKFTLGQGQVIK  341
            D+ + KK++KEG G+E P  G  V V   G L DGT F      G  PF+F   + QVI+
Sbjct  266  DKRILKKVLKEGEGYERPNDGAVVRVGLIGKLDDGTVFTKKGHEGDEPFEFKTDEEQVIQ  325

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP------PTIPPNATLQFDVELLSW  488
            G D  + TMKKGE     IPP+ A+G + +         +PPN+++ ++VEL+S+
Sbjct  326  GLDTTVLTMKKGEEASARIPPEHAFGSTETKLSSLIFAVVPPNSSVFYEVELVSF  380



>ref|XP_004952509.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Setaria italica]
Length=676

 Score =   357 bits (916),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            +K+GEE+EIG +GLKKKLV+EG GW+ P  GDEVEVHYTGTLLDGTKFDSSRDR +PFKF
Sbjct  78   LKIGEEREIGKEGLKKKLVQEGEGWDRPGAGDEVEVHYTGTLLDGTKFDSSRDRDSPFKF  137

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  494
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVELLSWV+
Sbjct  138  TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVN  197

Query  495  VKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFC  674
            +KDICKDGGI KKVL+EGEKWENPKDPDEV VKYEARLEDGT+V+KSD VEFTV++G FC
Sbjct  198  IKDICKDGGILKKVLSEGEKWENPKDPDEVFVKYEARLEDGTVVSKSDGVEFTVKDGLFC  257

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            PA++KAVKTMKK EK  LTVKPQYGFGE
Sbjct  258  PAISKAVKTMKKNEKAFLTVKPQYGFGE  285


 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 106/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  204  DGGILKKVLSEGEKWENPKDPDEVFVKYEARLEDGTVVSKS----DGVEFTVKDGLFCPA  259

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E    T+ P   +GE     SG    +PP+ATL  D++++SW +V +I 
Sbjct  260  ISKAVKTMKKNEKAFLTVKPQYGFGEQGRSASGEEAAVPPDATLHIDLQVVSWKTVTEIG  319

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  + KK+L EGE ++ P +   V VK   +L DGTL         +  EF  +E    
Sbjct  320  HDKKVLKKILKEGEGYDRPNECAVVRVKLIGKLADGTLFVNKGHDGEEPFEFKTDEDQVI  379

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P + FG
Sbjct  380  EGLDKAVLSMKKGEVALVTIPPHHAFG  406


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 84/149 (56%), Gaps = 9/149 (6%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIG-DQGLKKKLVKEGAGWETPEPGDEVEVHY  248
            E+  +PP    D  L  D  V+      EIG D+ + KK++KEG G++ P     V V  
Sbjct  293  EEAAVPP----DATLHIDLQVVSWKTVTEIGHDKKVLKKILKEGEGYDRPNECAVVRVKL  348

Query  249  TGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
             G L DGT F +   D   PF+F   + QVI+G D+ + +MKKGE  + TIPP  A+G +
Sbjct  349  IGKLADGTLFVNKGHDGEEPFEFKTDEDQVIEGLDKAVLSMKKGEVALVTIPPHHAFGAN  408

Query  426  GSP---PTIPPNATLQFDVELLSWVSVKD  503
             +     T+PPN+++ ++VEL+S+   KD
Sbjct  409  ETDQDLATVPPNSSVYYEVELVSFDKEKD  437



>ref|XP_008244682.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Prunus 
mume]
Length=572

 Score =   353 bits (905),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 208/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMP-PAEMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMP P EM+ D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPVPEEMNGDFDLPDEGPVLKVGEEKEIGKQGLKKKLLKEGEGWDTPKNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGE+
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGEA  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPP ATLQFDVELLSW SV DI KDGGI KK+L EGEKWENPKD DEV V +EAR
Sbjct  123  GSPPTIPPKATLQFDVELLSWTSVNDISKDGGIIKKILKEGEKWENPKDLDEVIVNFEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            L+DG +V KSD VEFTV++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFG+
Sbjct  183  LDDGKVVEKSDRVEFTVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGD  233


 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 115/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V++   L DG   + S DR    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIVNFEARLDDGKVVEKS-DR---VEFTVKDGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +G+ G P +     IPPNATL   +EL+SW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGYEGAIPPNATLHITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT   K       ++ EF  +E   
Sbjct  268  DDKKVIKKILKEGEGFERPNEGAVVKLKLIGKLQDGTEFLKKGHAEGEELFEFKTDEEEV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDRAVLTMKKGEVALLTIAPEYAFG  355


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT+F      +    F+F   + +VI
Sbjct  269  DKKVIKKILKEGEGFERPNEGAVVKLKLIGKLQDGTEFLKKGHAEGEELFEFKTDEEEVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + TI P+ A+G S SP     +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVLTMKKGEVALLTIAPEYAFGSSESPQELAVVPPNSTVYYEVELVSF  381



>ref|XP_007200299.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
 gb|EMJ01498.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica]
Length=572

 Score =   353 bits (905),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 208/231 (90%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMP-PAEMD-DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDFDMP P EM+ D DLPD+ PV+KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEVEVH
Sbjct  3    EDFDMPVPEEMNGDFDLPDEGPVLKVGEEKEIGKQGLKKKLLKEGEGWDTPKNGDEVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD+GI+TMKKGE  +FTIPP+LAYGE+
Sbjct  63   YTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDEGIRTMKKGEDALFTIPPELAYGET  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPP ATLQFDVELLSW SV DI KDGGI KK+L EGEKWENPKD DEV V +EAR
Sbjct  123  GSPPTIPPKATLQFDVELLSWTSVNDISKDGGIIKKILKEGEKWENPKDLDEVIVNFEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            L+DG +V KSD VEFTV++G+FCPAL+KAVKTMKKGEKV LTVKPQYGFG+
Sbjct  183  LDDGKVVEKSDRVEFTVKDGYFCPALSKAVKTMKKGEKVLLTVKPQYGFGD  233


 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 115/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V++   L DG   + S DR    +FT+  G     
Sbjct  152  DGGIIKKILKEGEKWENPKDLDEVIVNFEARLDDGKVVEKS-DR---VEFTVKDGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +G+ G P +     +PPNATL   +EL+SW +V ++ 
Sbjct  208  LSKAVKTMKKGEKVLLTVKPQYGFGDKGKPASGYVGAVPPNATLHITLELVSWKTVSEVT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS------DIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V +K   +L+DGT   K       ++ EF  +E   
Sbjct  268  DDKKVIKKILKEGEGFERPNEGAVVKLKLIGKLQDGTEFLKKGHAEGEELFEFKTDEEEV  327

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AV TMKKGE   LT+ P+Y FG
Sbjct  328  IDGLDRAVLTMKKGEVALLTLAPEYAFG  355


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF--DSSRDRGTPFKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V++   G L DGT+F      +    F+F   + +VI
Sbjct  269  DKKVIKKILKEGEGFERPNEGAVVKLKLIGKLQDGTEFLKKGHAEGEELFEFKTDEEEVI  328

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
             G D+ + TMKKGE  + T+ P+ A+G S SP     +PPN+T+ ++VEL+S+
Sbjct  329  DGLDRAVLTMKKGEVALLTLAPEYAFGSSESPQELAVVPPNSTVYYEVELVSF  381



>ref|NP_001046873.1| Os02g0491400 [Oryza sativa Japonica Group]
 dbj|BAD21897.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAD22074.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAF08787.1| Os02g0491400 [Oryza sativa Japonica Group]
Length=682

 Score =   356 bits (914),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            M+VGEEKEIG +GL+KKLVKEG GWE P+ GDEV+VHYTGTLLDGTKFDSSRDR  PFKF
Sbjct  83   MEVGEEKEIGKEGLRKKLVKEGEGWERPDAGDEVQVHYTGTLLDGTKFDSSRDRDAPFKF  142

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  494
            TLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP IPPNATLQFDVEL+SW S
Sbjct  143  TLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELISWES  202

Query  495  VKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFC  674
            VKDICKDGGI KKVLAEG KWENP+D DEV VKYE RLEDGT+VA+SD VEFTV++GHFC
Sbjct  203  VKDICKDGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAESDGVEFTVKDGHFC  262

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            PA++KAVKTMKK EK  LTVKPQYGFGE
Sbjct  263  PAISKAVKTMKKNEKALLTVKPQYGFGE  290


 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 108/207 (52%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  209  DGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAES----DGVEFTVKDGHFCPA  264

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P       IPPNATL  ++EL+SW +V +I 
Sbjct  265  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPAARDEAAIPPNATLHINLELVSWKAVTEIG  324

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE +E P D   V VK   +LEDGT+         +  EF  +E    
Sbjct  325  NDKKILKKILHEGEGYERPSDCTLVRVKLIGKLEDGTIFVTRGHDGDEPFEFKTDEDQVV  384

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P+Y FG
Sbjct  385  EGLDKAVLSMKKGEVALVTIPPEYAFG  411


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = +3

Query  90   PAEMDDLDLPDDNPVMKVGEE-------KEIG-DQGLKKKLVKEGAGWETPEPGDEVEVH  245
            PA  D+  +P  N  + +  E        EIG D+ + KK++ EG G+E P     V V 
Sbjct  294  PAARDEAAIPP-NATLHINLELVSWKAVTEIGNDKKILKKILHEGEGYERPSDCTLVRVK  352

Query  246  YTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
              G L DGT F +   D   PF+F   + QV++G D+ + +MKKGE  + TIPP+ A+G 
Sbjct  353  LIGKLEDGTIFVTRGHDGDEPFEFKTDEDQVVEGLDKAVLSMKKGEVALVTIPPEYAFGS  412

Query  423  SGSP---PTIPPNATLQFDVELLSW  488
              +      +PPN+T+ ++VEL+S+
Sbjct  413  DETRQDLSVVPPNSTVYYEVELVSF  437



>gb|AFK35673.1| unknown [Medicago truncatula]
Length=575

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 205/233 (88%), Gaps = 4/233 (2%)
 Frame = +3

Query  72   EDFDMPPAEM--DDLDLPD--DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            EDFD+P  +   DD D     DNP++KVGEEKEIG QGLKKKL+KEG GW+TP+ GDEV 
Sbjct  3    EDFDIPAVDSMNDDFDFAGAGDNPILKVGEEKEIGKQGLKKKLLKEGEGWDTPDVGDEVH  62

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGT F FTLGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYG
Sbjct  63   VHYTGTLLDGTKFDSSRDRGTTFNFTLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYG  122

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPT PPNATLQFDVELLSW SVKDICKDGG+FKK++ EGEKWENPKD DEV VKYE
Sbjct  123  ESGSPPTTPPNATLQFDVELLSWTSVKDICKDGGLFKKIVKEGEKWENPKDLDEVLVKYE  182

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ARL+DGTLVAKSD VEFTV+EG+FCPAL KAVKTMKKGEKV LTVKPQYGF E
Sbjct  183  ARLDDGTLVAKSDGVEFTVKEGYFCPALPKAVKTMKKGEKVILTVKPQYGFDE  235


 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 116/209 (56%), Gaps = 16/209 (8%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK+VKEG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  154  DGGLFKKIVKEGEKWENPKDLDEVLVKYEARLDDGTLVAKS----DGVEFTVKEGYFCPA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  I T+ P   + E G P       +PPNATL+  +EL+SW +V ++ 
Sbjct  210  LPKAVKTMKKGEKVILTVKPQYGFDEKGKPAHGDEGAVPPNATLEITLELVSWKTVSEVT  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-------SDIVEFTVEEGH  668
             D  + KK++ EGE +E P D   V +K   +L+DGT+  K       +++ EFT +EG 
Sbjct  270  DDKKVIKKIVKEGEGYERPNDGAVVKLKLIGKLQDGTVFLKKGHGDDEAELFEFTTDEGQ  329

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L +AV TMKKGE   LT+ P+Y FG
Sbjct  330  VIDGLDRAVMTMKKGEVALLTIAPEYAFG  358


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 73/128 (57%), Gaps = 7/128 (5%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF---DSSRDRGTPFKFTLGQGQVIKGWDQGIKT  365
            EG G+E P  G  V++   G L DGT F       D    F+FT  +GQVI G D+ + T
Sbjct  281  EGEGYERPNDGAVVKLKLIGKLQDGTVFLKKGHGDDEAELFEFTTDEGQVIDGLDRAVMT  340

Query  366  MKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKV  536
            MKKGE  + TI P+ A+G S S      +PPN+TL ++VEL+S++  K+   D    +KV
Sbjct  341  MKKGEVALLTIAPEYAFGSSESRQELAVVPPNSTLYYEVELVSFIKDKE-SWDMTTGEKV  399

Query  537  LAEGEKWE  560
             A G+K E
Sbjct  400  EAAGKKKE  407



>tpg|DAA48153.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=492

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 193/243 (79%), Positives = 208/243 (86%), Gaps = 14/243 (6%)
 Frame = +3

Query  72   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKDPDEV 
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILKEGEKWENPKDPDEVL  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKP------QYG  749
            VKYEARLEDGT+V+KS+ VEFTV++G+FCPAL KAVKTMKK EKV LTVKP      Q G
Sbjct  183  VKYEARLEDGTVVSKSEGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQCEIPFQNG  242

Query  750  FGE  758
            FGE
Sbjct  243  FGE  245


 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 109/212 (51%), Gaps = 19/212 (9%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDL------AYGESGSPPT-----IPPNATLQFDVELLSWV  491
              + +KTMKK E  + T+ P         +GE G P       +PPNA+L  D+EL+SW 
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQCEIPFQNGFGEKGRPAAGEEGAVPPNASLLIDLELISWK  273

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVE  659
            +V +I  D  I KKVL EGE +E P +   V VK   +L+DG +  K     +  +F  +
Sbjct  274  TVTEIGDDKKILKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTKKGHDEEPFKFKTD  333

Query  660  EGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            E      L +AV  MKKGE   +T+ P+Y FG
Sbjct  334  EEEVIAGLDRAVLNMKKGEVALVTIPPEYAFG  365


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  266  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  320

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  321  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  380

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  381  TVIYEVELISFVKDKE  396



>tpg|DAA48152.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays]
Length=559

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 193/243 (79%), Positives = 208/243 (86%), Gaps = 14/243 (6%)
 Frame = +3

Query  72   EDFDMPPAEMDDL-------DLP-DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            EDF+MPPA  D++       D   D+ PVMKVGEEKE+G +GLKKKL+KEG GWETPE G
Sbjct  3    EDFEMPPAGADEMMGDDEMGDFGGDEGPVMKVGEEKEVGKEGLKKKLLKEGEGWETPEVG  62

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDGTKFDSSRDRG PFKF LGQGQVIKGWDQGIKTMKKGE  IFTIPP+
Sbjct  63   DEVEVHYTGTLLDGTKFDSSRDRGEPFKFKLGQGQVIKGWDQGIKTMKKGENAIFTIPPE  122

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYG SGSPPTIPPNATLQFDVELLSW SVKDICKDGGIFKK+L EGEKWENPKDPDEV 
Sbjct  123  LAYGASGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKILKEGEKWENPKDPDEVL  182

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKP------QYG  749
            VKYEARLEDGT+V+KS+ VEFTV++G+FCPAL KAVKTMKK EKV LTVKP      Q G
Sbjct  183  VKYEARLEDGTVVSKSEGVEFTVKDGYFCPALAKAVKTMKKAEKVLLTVKPQCEIPFQNG  242

Query  750  FGE  758
            FGE
Sbjct  243  FGE  245


 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 109/212 (51%), Gaps = 19/212 (9%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  158  DGGIFKKILKEGEKWENPKDPDEVLVKYEARLEDGTVVSKSEG----VEFTVKDGYFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDL------AYGESGSPPT-----IPPNATLQFDVELLSWV  491
              + +KTMKK E  + T+ P         +GE G P       +PPNA+L  D+EL+SW 
Sbjct  214  LAKAVKTMKKAEKVLLTVKPQCEIPFQNGFGEKGRPAAGEEGAVPPNASLLIDLELISWK  273

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVE  659
            +V +I  D  I KKVL EGE +E P +   V VK   +L+DG +  K     +  +F  +
Sbjct  274  TVTEIGDDKKILKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTKKGHDEEPFKFKTD  333

Query  660  EGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            E      L +AV  MKKGE   +T+ P+Y FG
Sbjct  334  EEEVIAGLDRAVLNMKKGEVALVTIPPEYAFG  365


 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V ++G++K+I      KK++KEG G+E P  G  VEV   G L DG  F  
Sbjct  266  DLELISWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVEVKIIGKLQDGAVFTK  320

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
                  PFKF   + +VI G D+ +  MKKGE  + TIPP+ A+G + S      +PPN+
Sbjct  321  KGHDEEPFKFKTDEEEVIAGLDRAVLNMKKGEVALVTIPPEYAFGSTESKQDLAVVPPNS  380

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  381  TVIYEVELISFVKDKE  396



>ref|XP_009373610.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Pyrus x bretschneideri]
Length=567

 Score =   350 bits (899),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 204/239 (85%), Gaps = 10/239 (4%)
 Frame = +3

Query  72   EDFDMPPAEMD-----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  221
            +DFD   A        DLDLPD      +P +KVG+EKEIG  GLKKKL+KEG GW+TP 
Sbjct  3    DDFDFSAATNSLNDPGDLDLPDAEDDATSPTLKVGDEKEIGKNGLKKKLLKEGEGWDTPG  62

Query  222  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  401
             GDEVEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIP
Sbjct  63   SGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAVFTIP  122

Query  402  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDE  581
            P+LAYGESGSPPTIPPNATLQFDVELLSW SVKDI KDGG+ KK++ EGEKWENPKD DE
Sbjct  123  PELAYGESGSPPTIPPNATLQFDVELLSWTSVKDILKDGGVMKKIITEGEKWENPKDLDE  182

Query  582  VSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V VKYEARLEDGTLV+KS+ VEFTV++GHFCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  VFVKYEARLEDGTLVSKSEGVEFTVQDGHFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  241


 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 113/208 (54%), Gaps = 13/208 (6%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  158  LKDGGVMKKIITEGEKWENPKDLDEVFVKYEARLEDGTLVSKSEG----VEFTVQDGHFC  213

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKD  503
                + +KTMKKGE  + T+ P   +GE+G   T     +PPNATL+  +EL+SW +V D
Sbjct  214  PALAKAVKTMKKGEKVLLTVKPQYGFGEAGRSATGDEGVVPPNATLEIALELVSWKTVSD  273

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHF  671
            + KD  + KK L EGE +E P D   V VK   +L DGT+  K     +  EF  +E   
Sbjct  274  VIKDKKVLKKTLKEGEGYERPNDGAVVKVKLVGKLPDGTIFTKKGHDDEPFEFKTDEEQV  333

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AVK MKKGE   +T++P+Y FG
Sbjct  334  IEGLDRAVKNMKKGEVALVTIQPEYAFG  361


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            I D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F   + QVI
Sbjct  275  IKDKKVLKKTLKEGEGYERPNDGAVVKVKLVGKLPDGTIFTKKGHDDEPFEFKTDEEQVI  334

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            +G D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VEL+S+V  K+
Sbjct  335  EGLDRAVKNMKKGEVALVTIQPEYAFGSTESAQDLAVVPANSTVHYEVELVSFVKDKE  392



>ref|XP_008352304.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Malus domestica]
Length=567

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 205/239 (86%), Gaps = 10/239 (4%)
 Frame = +3

Query  72   EDFDMPPAEMD-----DLDLPD-----DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  221
            +DFD   A  +     DLDLPD      +P +KVG+EKEIG  GLKKKL+KEG GW+TP 
Sbjct  3    DDFDFSAATNNLNDAGDLDLPDAEDDATSPTLKVGDEKEIGKNGLKKKLLKEGEGWDTPG  62

Query  222  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  401
             GDEVEVHYTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIP
Sbjct  63   SGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFNLGQGQVIKGWDEGIKTMKKGENAVFTIP  122

Query  402  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDE  581
            P+LAYGESGSPPTIPPNATLQFDVELLSW SVKDI KDGG+ KK++ EGEKWENPKD DE
Sbjct  123  PELAYGESGSPPTIPPNATLQFDVELLSWTSVKDILKDGGVMKKIITEGEKWENPKDLDE  182

Query  582  VSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V VKYEARLEDGTLV+KS+ VEFTV++G+FCPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  183  VFVKYEARLEDGTLVSKSNGVEFTVQDGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGE  241


 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 113/208 (54%), Gaps = 13/208 (6%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            + D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+  G   
Sbjct  158  LKDGGVMKKIITEGEKWENPKDLDEVFVKYEARLEDGTLVSKS----NGVEFTVQDGYFC  213

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKD  503
                + +KTMKKGE  + T+ P   +GE+G P       +PPNATL+  +EL+SW +V D
Sbjct  214  PALAKAVKTMKKGEKVLLTVKPQYGFGEAGRPAIGDEGAVPPNATLEIALELVSWKTVSD  273

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHF  671
            + KD  + KK L EGE +E P D   V VK   +L DGT+  K     +  EF  +E   
Sbjct  274  VTKDKKVLKKTLKEGEGYERPNDGAVVKVKLVGKLPDGTIFTKKGHDDEPFEFKTDEEQV  333

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L +AVK MKKGE   +T++P+Y FG
Sbjct  334  IEGLDRAVKNMKKGEGALVTIQPEYAFG  361


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK +KEG G+E P  G  V+V   G L DGT F        PF+F   + QVI+G
Sbjct  277  DKKVLKKTLKEGEGYERPNDGAVVKVKLVGKLPDGTIFTKKGHDDEPFEFKTDEEQVIEG  336

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             D+ +K MKKGE  + TI P+ A+G + S      +P N+T+ ++VEL+S+V  K+
Sbjct  337  LDRAVKNMKKGEGALVTIQPEYAFGSTESAQDLAVVPANSTVHYEVELVSFVKDKE  392



>ref|XP_002453845.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
 gb|EES06821.1| hypothetical protein SORBIDRAFT_04g019590 [Sorghum bicolor]
Length=685

 Score =   351 bits (901),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 189/225 (84%), Gaps = 12/225 (5%)
 Frame = +3

Query  81   DMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTL  260
            D PPAE+            KVGEE+EIG +GLKKKLVKEG GW  P  GDEVEVHYTGTL
Sbjct  80   DNPPAEL------------KVGEEREIGKEGLKKKLVKEGEGWGRPGDGDEVEVHYTGTL  127

Query  261  LDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT  440
            +DGTKFDSSRDR +PFKF LGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP 
Sbjct  128  MDGTKFDSSRDRDSPFKFKLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPV  187

Query  441  IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGT  620
            IPPNATLQFDVELLSWV +KDICKDGGI KKVLAEG+KWENP+DPDEV VKYEARLEDGT
Sbjct  188  IPPNATLQFDVELLSWVCIKDICKDGGILKKVLAEGDKWENPRDPDEVFVKYEARLEDGT  247

Query  621  LVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            +V+KSD VEFTV +G FCPA++KAVKTMKK EK  LTV PQYGFG
Sbjct  248  VVSKSDGVEFTVRDGVFCPAISKAVKTMKKNEKAHLTVMPQYGFG  292


 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 106/207 (51%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  212  DGGILKKVLAEGDKWENPRDPDEVFVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  267

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E    T+ P   +G  G P      ++PPNATL  D++++SW +V ++ 
Sbjct  268  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRPTSGEEASVPPNATLHIDLQVVSWRTVTELG  327

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  + KK+L EGE ++ P D   V VK   +LEDGTL  K      +  EF  +E    
Sbjct  328  NDKKVLKKILKEGEGYDRPNDCAIVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVI  387

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   + + P + FG
Sbjct  388  EGLDKAVLSMKKGEVALVIIPPHHAFG  414


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 42/84 (50%), Gaps = 4/84 (5%)
 Frame = +3

Query  519  GIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALT  686
            G+ KK++ EGE W  P D DEV V Y   L DGT    S       +F + +G       
Sbjct  98   GLKKKLVKEGEGWGRPGDGDEVEVHYTGTLMDGTKFDSSRDRDSPFKFKLGQGQVIKGWD  157

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
              +KTMKKGE    T+ P+  +GE
Sbjct  158  LGIKTMKKGENAVFTIPPELAYGE  181



>ref|XP_003574982.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Brachypodium 
distachyon]
Length=648

 Score =   348 bits (893),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT  302
            D   MK GEEK IG +GL+KKLVKEG G E P  GDEVEVHYTGTL+DGTKFDSSRDRGT
Sbjct  48   DIAAMKAGEEKGIGKEGLRKKLVKEGEGSEHPGAGDEVEVHYTGTLMDGTKFDSSRDRGT  107

Query  303  PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELL  482
            PFKFTLG+GQVIKGWD GIKTMK+GE  IFTIPP+L YGE GSPP IP NA LQFDVELL
Sbjct  108  PFKFTLGRGQVIKGWDLGIKTMKRGENAIFTIPPELGYGEDGSPPVIPANAVLQFDVELL  167

Query  483  SWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEE  662
            SW SVKDICKDG IFKK+L EG KWENPKD DEV VKYEARLEDG++++KSD +EFTV+E
Sbjct  168  SWASVKDICKDGSIFKKILVEGNKWENPKDSDEVFVKYEARLEDGSIISKSDGIEFTVKE  227

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GHFCPA++KAVKTMKK EK  LTVKPQYGFGE
Sbjct  228  GHFCPAISKAVKTMKKNEKAVLTVKPQYGFGE  259


 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D  + KK++ EG  WE P+  DEV V Y   L DG+    S       +FT+ +G     
Sbjct  178  DGSIFKKILVEGNKWENPKDSDEVFVKYEARLEDGSIISKS----DGIEFTVKEGHFCPA  233

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PP+ATL  D++L+SW +V +I 
Sbjct  234  ISKAVKTMKKNEKAVLTVKPQYGFGEQGRPASADKAAVPPDATLHIDIQLVSWKTVTEIG  293

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L +GE ++ P D   V VK   +LEDGT+  K      +  EF  +E    
Sbjct  294  NDKKIQKKILQDGEGYDRPNDCATVKVKLIGKLEDGTVFFKKGHDGEEPFEFKTDEEQVI  353

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P++ FG
Sbjct  354  EGLDKAVLSMKKGEIAFVTISPEHAFG  380


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
 Frame = +3

Query  156  EIG-DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQG  329
            EIG D+ ++KK++++G G++ P     V+V   G L DGT F     D   PF+F   + 
Sbjct  291  EIGNDKKIQKKILQDGEGYDRPNDCATVKVKLIGKLEDGTVFFKKGHDGEEPFEFKTDEE  350

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            QVI+G D+ + +MKKGE    TI P+ A+G   +      +PPN+T+ +D+EL+S+
Sbjct  351  QVIEGLDKAVLSMKKGEIAFVTISPEHAFGSDETKQDLAVVPPNSTVYYDLELVSF  406



>gb|EMS49100.1| 70 kDa peptidyl-prolyl isomerase [Triticum urartu]
Length=651

 Score =   348 bits (892),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = +3

Query  132  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  311
             MK GEE+ IG +GL+KKL++EG G + P  GDEVEVHYTGTL+DGTKFDSSRDR  PF+
Sbjct  59   AMKAGEERGIGKEGLRKKLLREGEGSQLPGAGDEVEVHYTGTLVDGTKFDSSRDRDAPFR  118

Query  312  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            FTLG+GQVIKGWD GIKTMK+GE  IFTIPP+LAYGE GSPP IPPNATLQFDVELLSW 
Sbjct  119  FTLGRGQVIKGWDLGIKTMKRGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWA  178

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHF  671
            SVKDICKDG IFKK+LAEGEKWENPKD DEV VKYEARLEDGTLV KSD VEFTV+EGHF
Sbjct  179  SVKDICKDGSIFKKILAEGEKWENPKDRDEVFVKYEARLEDGTLVTKSDGVEFTVKEGHF  238

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            CPA+ KAVKTMKK EK  LTVKPQYGFGE
Sbjct  239  CPAIAKAVKTMKKNEKALLTVKPQYGFGE  267


 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D  + KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  186  DGSIFKKILAEGEKWENPKDRDEVFVKYEARLEDGTLVTKS----DGVEFTVKEGHFCPA  241

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNA L  D++L+SW +V +I 
Sbjct  242  IAKAVKTMKKNEKALLTVKPQYGFGEQGRPASRDEAAVPPNAMLHIDLQLVSWKTVTEIG  301

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE ++ PKD   V VK   +LEDGT+  K      +  EF  +E    
Sbjct  302  NDKTILKKILQEGEGYDRPKDCSTVKVKLIGKLEDGTMFVKKGHDGEEPFEFKTDEDQVI  361

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV +MKKGE   +T+ P++ FG
Sbjct  362  EGLDQAVLSMKKGEVAFVTIPPEHAFG  388


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 78/141 (55%), Gaps = 11/141 (8%)
 Frame = +3

Query  84   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  257
            +PP  M   DL L     V ++G +K I      KK+++EG G++ P+    V+V   G 
Sbjct  279  VPPNAMLHIDLQLVSWKTVTEIGNDKTI-----LKKILQEGEGYDRPKDCSTVKVKLIGK  333

Query  258  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  434
            L DGT F     D   PF+F   + QVI+G DQ + +MKKGE    TIPP+ A+G   + 
Sbjct  334  LEDGTMFVKKGHDGEEPFEFKTDEDQVIEGLDQAVLSMKKGEVAFVTIPPEHAFGSDETK  393

Query  435  ---PTIPPNATLQFDVELLSW  488
                 +PPN T+ +DVEL+S+
Sbjct  394  QDLAIVPPNTTVYYDVELVSF  414



>ref|XP_003524915.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoformX1 [Glycine 
max]
Length=570

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 201/231 (87%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDF+ P A       +   ++P++KVGEEKEIG  GLKKKL+KEG GW+TP+ GD+VEVH
Sbjct  3    EDFEFPSAGNMEMPEEEEFESPILKVGEEKEIGKMGLKKKLLKEGEGWDTPDSGDQVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFKLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI K ++ EGEKW+NPKD DEV VK+EAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGILKNIITEGEKWDNPKDLDEVFVKFEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDGT+++KSD VEFTVEEG+FCPAL KAVKTMKKGEKV L VKPQY FGE
Sbjct  183  LEDGTVISKSDGVEFTVEEGYFCPALAKAVKTMKKGEKVLLNVKPQYAFGE  233


 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 113/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K ++ EG  W+ P+  DEV V +   L DGT    S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKFEARLEDGTVISKS----DGVEFTVEEGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GESG P       +PPNA LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPALGDEGAVPPNAYLQLDLELVSWKTVSDIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIV-----EFTVEEGHFC  674
            KD  + KK L EGE +E P D   V VK   +L+DGT+  K   V     EF ++E    
Sbjct  268  KDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFVKKGYVDEQPFEFKIDEEQVI  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVK MKKGE   L ++P+Y FG
Sbjct  328  DGLDQAVKNMKKGEIALLIIQPEYAFG  354


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 5/136 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK +KEG G+E P  G  V+V   G L DGT F         PF+F + + QVI 
Sbjct  269  DRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFVKKGYVDEQPFEFKIDEEQVID  328

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G DQ +K MKKGE  +  I P+ A+G SGS      +PPN+T+ ++VELLS+V  K+   
Sbjct  329  GLDQAVKNMKKGEIALLIIQPEYAFGPSGSSQELANVPPNSTVYYEVELLSFVKEKE-SW  387

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G+K E
Sbjct  388  DLNTQEKIEAAGKKKE  403



>ref|XP_011084142.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Sesamum 
indicum]
Length=650

 Score =   345 bits (885),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 183/241 (76%), Positives = 206/241 (85%), Gaps = 12/241 (5%)
 Frame = +3

Query  72   EDFDMPPA---------EMD---DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWET  215
            +DF+ P A         EMD   D+DLP  NP++KVGEEKEIG  GLKKKL+KEG GWE 
Sbjct  3    DDFEFPAAGSNEMEMDDEMDAGNDMDLPVGNPILKVGEEKEIGKDGLKKKLLKEGEGWEN  62

Query  216  PEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFT  395
            P+ GDEVEVHY GTLLDGT+FDSSRDRGTPF F LGQGQVIKGWD+GIKTMKKGE  +FT
Sbjct  63   PDSGDEVEVHYVGTLLDGTQFDSSRDRGTPFTFKLGQGQVIKGWDEGIKTMKKGEKALFT  122

Query  396  IPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDP  575
            IPP+LAYGESGSPP IPPN+TLQF+VELLSW SVKDICKDGGI+KKVL EGE W+NPKD 
Sbjct  123  IPPELAYGESGSPPKIPPNSTLQFEVELLSWNSVKDICKDGGIYKKVLTEGEGWQNPKDL  182

Query  576  DEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            DEV VKYEARLEDGT+V+K+D VEFTV++G+FCPAL+KA+KTMKKGEKV LTVK QYGFG
Sbjct  183  DEVFVKYEARLEDGTIVSKADGVEFTVKDGYFCPALSKAIKTMKKGEKVLLTVKAQYGFG  242

Query  756  E  758
            E
Sbjct  243  E  243


 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 113/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG GW+ P+  DEV V Y   L DGT       +    +FT+  G     
Sbjct  162  DGGIYKKVLTEGEGWQNPKDLDEVFVKYEARLEDGTIVS----KADGVEFTVKDGYFCPA  217

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + IKTMKKGE  + T+     +GE G P T     +PPNATLQ ++EL+SW +V D+ 
Sbjct  218  LSKAIKTMKKGEKVLLTVKAQYGFGEKGRPATGDELYVPPNATLQINLELVSWKTVSDVS  277

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  I KK+L EGE +E P D   V VK   +L DGT+  +         EF V+E    
Sbjct  278  NDQKILKKILKEGEGYERPDDGATVQVKLIGKLHDGTIFVRKGYDDEPPFEFKVDEDQVI  337

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L + +KTMKKGE   ++++P+Y FG
Sbjct  338  EGLDRTIKTMKKGEVALVSIQPEYAFG  364


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (61%), Gaps = 5/137 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  338
             DQ + KK++KEG G+E P+ G  V+V   G L DGT F     D   PF+F + + QVI
Sbjct  278  NDQKILKKILKEGEGYERPDDGATVQVKLIGKLHDGTIFVRKGYDDEPPFEFKVDEDQVI  337

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
            +G D+ IKTMKKGE  + +I P+ A+G S SP     +P N+ + +++E++S++  K+  
Sbjct  338  EGLDRTIKTMKKGEVALVSIQPEYAFGPSESPQELAVVPGNSVVYYELEMISFLKEKE-S  396

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  397  WDMNTEEKIAAAGKKKE  413



>ref|XP_010552023.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Tarenaya 
hassleriana]
Length=548

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 186/229 (81%), Gaps = 9/229 (4%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            EDFDMP A     D  D  P MK     EIG QGLKKKLVKEG G ETPE GDEVEVHYT
Sbjct  3    EDFDMPAAH----DGADVAPSMK-----EIGKQGLKKKLVKEGEGRETPETGDEVEVHYT  53

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLL GTKFDSSRDRGTPFKFTLGQG VI+GWD GIKTMKKGE  I TIPP+LAYGESGS
Sbjct  54   GTLLAGTKFDSSRDRGTPFKFTLGQGNVIEGWDIGIKTMKKGENAILTIPPELAYGESGS  113

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
            PPTIPPNA LQFDVELLSWVS KDIC+DGGIFK ++ EG+K E PKD DEV VKYEARLE
Sbjct  114  PPTIPPNAMLQFDVELLSWVSGKDICRDGGIFKNIVVEGDKREKPKDLDEVLVKYEARLE  173

Query  612  DGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DGT+V KS  V+FTV+EGHFCPA   AVKTMKK EKV L VKPQYGFGE
Sbjct  174  DGTVVGKSAGVDFTVKEGHFCPAFALAVKTMKKREKVLLIVKPQYGFGE  222


 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 104/208 (50%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K +V EG   E P+  DEV V Y   L DGT    S        FT+ +G     
Sbjct  141  DGGIFKNIVVEGDKREKPKDLDEVLVKYEARLEDGTVVGKS----AGVDFTVKEGHFCPA  196

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGS-----PPTIPPNATLQFDVELLSWVSVKDIC  509
            +   +KTMKK E  +  + P   +GESG         +PPNATLQ D+EL+SW +V ++ 
Sbjct  197  FALAVKTMKKREKVLLIVKPQYGFGESGKLACDGQSAVPPNATLQIDLELVSWKTVSEVT  256

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI------VEFTVEEGHF  671
             D  + KK+L EGE ++ P +   V V    +L+DGT+             EF  +E   
Sbjct  257  DDKKVIKKILKEGEGYDRPNEGAIVKVNLIGKLQDGTVFLNKGHGEIEGPFEFKTDEEQV  316

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               +  AV +MKKGE   +T+ P+Y FG
Sbjct  317  IEGVDMAVMSMKKGEVAFVTISPEYAFG  344


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 73/119 (61%), Gaps = 7/119 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT---PFKFTLGQGQV  335
            D+ + KK++KEG G++ P  G  V+V+  G L DGT F  ++  G    PF+F   + QV
Sbjct  258  DKKVIKKILKEGEGYDRPNEGAIVKVNLIGKLQDGTVF-LNKGHGEIEGPFEFKTDEEQV  316

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            I+G D  + +MKKGE    TI P+ A+G S S      +PPN+T+ ++VELLS+V  K+
Sbjct  317  IEGVDMAVMSMKKGEVAFVTISPEYAFGSSESQQELAVVPPNSTVYYEVELLSFVKEKE  375



>dbj|BAJ95453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=650

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  132  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  311
             MK G+E+ +G +GL+K+LV+EG G + P  GDEVEVHYTGTL DGT FDSSRDRG PF+
Sbjct  58   AMKAGDERGVGKEGLRKRLVREGEGSQLPGAGDEVEVHYTGTLADGTNFDSSRDRGAPFR  117

Query  312  FTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            FTLG+GQVIKGWD GIKTMK+GE  IFTIPP+LAYGE GSPP IPPNATLQFDVELLSW 
Sbjct  118  FTLGRGQVIKGWDLGIKTMKRGENAIFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWA  177

Query  492  SVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHF  671
            SVKDICKDG IFKK+LAEGEKWENPKD DEV VKYEARLEDGTLV KSD VEFTV+EGHF
Sbjct  178  SVKDICKDGSIFKKILAEGEKWENPKDRDEVFVKYEARLEDGTLVTKSDGVEFTVKEGHF  237

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            CPA++KA+KTMKK EK  LTVKPQYGFG
Sbjct  238  CPAVSKAIKTMKKNEKALLTVKPQYGFG  265


 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D  + KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  185  DGSIFKKILAEGEKWENPKDRDEVFVKYEARLEDGTLVTKS----DGVEFTVKEGHFCPA  240

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + IKTMKK E  + T+ P   +G  G P +     +PPNA LQ D++L+SW +V +I 
Sbjct  241  VSKAIKTMKKNEKALLTVKPQYGFGGQGRPASRGEAAVPPNAMLQIDLQLVSWKTVTEIG  300

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE ++ PKD   V VK   +L+DGT+  K      +  EF  +E    
Sbjct  301  NDKTILKKILQEGEGYDRPKDCSTVKVKLIGKLDDGTMFVKKGHDGEEPFEFKTDEDQVI  360

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P++ FG
Sbjct  361  DGLDKAVLSMKKGEVAFVTIPPEHAFG  387


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 77/141 (55%), Gaps = 11/141 (8%)
 Frame = +3

Query  84   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  257
            +PP  M   DL L     V ++G +K I      KK+++EG G++ P+    V+V   G 
Sbjct  278  VPPNAMLQIDLQLVSWKTVTEIGNDKTI-----LKKILQEGEGYDRPKDCSTVKVKLIGK  332

Query  258  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  434
            L DGT F     D   PF+F   + QVI G D+ + +MKKGE    TIPP+ A+G   + 
Sbjct  333  LDDGTMFVKKGHDGEEPFEFKTDEDQVIDGLDKAVLSMKKGEVAFVTIPPEHAFGSDETK  392

Query  435  ---PTIPPNATLQFDVELLSW  488
                 +PPN T+ +D+EL+S+
Sbjct  393  HDLAIVPPNTTVYYDIELVSF  413



>ref|XP_007153782.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
 gb|ESW25776.1| hypothetical protein PHAVU_003G064500g [Phaseolus vulgaris]
Length=569

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 201/232 (87%), Gaps = 5/232 (2%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDD---NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEV  242
            EDF+ P A    +++PD+   + ++KVGEEKEIG  GLKKKL+KEG GW++P  GD+VEV
Sbjct  3    EDFEFPSA--GSMEMPDEEMESSILKVGEEKEIGKMGLKKKLLKEGEGWDSPNSGDQVEV  60

Query  243  HYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            HYTGTLLDGT FDSSRDRGTPF+F LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGE
Sbjct  61   HYTGTLLDGTHFDSSRDRGTPFRFNLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGE  120

Query  423  SGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEA  602
            SGSPPTIPPNATLQFDVELLSW SVKDICKDGGI K ++ EGEKW+NPKD DEV VKYEA
Sbjct  121  SGSPPTIPPNATLQFDVELLSWTSVKDICKDGGILKNIITEGEKWDNPKDLDEVFVKYEA  180

Query  603  RLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            RLEDGT+++KSD VEFTVEEG+FC AL KAVKTMKKGEKV L VKPQY FGE
Sbjct  181  RLEDGTVISKSDGVEFTVEEGYFCRALAKAVKTMKKGEKVLLNVKPQYAFGE  232


 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 116/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K ++ EG  W+ P+  DEV V Y   L DGT    S       +FT+ +G   + 
Sbjct  151  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGTVISKS----DGVEFTVEEGYFCRA  206

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GESG P +     +PPNA+L+ D+EL+SW SV DI 
Sbjct  207  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPASGEEGAVPPNASLEVDLELVSWKSVSDIT  266

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
            KDG + KK L EGE +E P D   V VK   +L+DGT+  K         EF ++E    
Sbjct  267  KDGKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYGDEQPFEFKIDEEQVI  326

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAVK MKKGE   L ++P+Y FG
Sbjct  327  DGLEKAVKNMKKGEIALLIIQPEYAFG  353


 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  180  KKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQG  356
            KK +KEG G+E P  G  V+V   G L DGT F         PF+F + + QVI G ++ 
Sbjct  273  KKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYGDEQPFEFKIDEEQVIDGLEKA  332

Query  357  IKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            +K MKKGE  +  I P+ A+G SGSP     IPPN+TL ++VELLS+V  K+
Sbjct  333  VKNMKKGEIALLIIQPEYAFGPSGSPQELAIIPPNSTLYYEVELLSFVKEKE  384



>ref|XP_006492988.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
FKBP65-like [Citrus sinensis]
Length=567

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 195/239 (82%), Gaps = 23/239 (10%)
 Frame = +3

Query  72   EDFDMPP-AEMD-----DLDLPDDN----PVMKVGEEKEIGDQGLKKKLVKEGAGWETPE  221
            +DF+ P  + M+     D+D+P+D+    P++KVGEEKEIG  GLK              
Sbjct  3    DDFEFPTTSNMEEGLDMDMDVPEDDDPVSPILKVGEEKEIGKNGLKX-------------  49

Query  222  PGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIP  401
             GDEVEVHYTGTLLDGTKFDSSRDR TPFKF LGQGQVIKGWD+GIKTMKKG+  +FTIP
Sbjct  50   SGDEVEVHYTGTLLDGTKFDSSRDRETPFKFKLGQGQVIKGWDEGIKTMKKGKNAVFTIP  109

Query  402  PDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDE  581
            P+LAYGESGSPPTIPPNATLQFDVELL+W SVKDICKDGGIFKK+L EGEKWENPKD DE
Sbjct  110  PELAYGESGSPPTIPPNATLQFDVELLAWTSVKDICKDGGIFKKILVEGEKWENPKDLDE  169

Query  582  VSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V VKYEARLEDGTL++KSD VEFTV +G+FC AL KAVKTMKKGEKV LTVKPQY FG+
Sbjct  170  VFVKYEARLEDGTLISKSDGVEFTVGDGYFCAALAKAVKTMKKGEKVLLTVKPQYAFGK  228


 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 115/207 (56%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+G G     
Sbjct  147  DGGIFKKILVEGEKWENPKDLDEVFVKYEARLEDGTLISKS----DGVEFTVGDGYFCAA  202

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P  A+G++G P T     +P NA L   +EL+SW +V DI 
Sbjct  203  LAKAVKTMKKGEKVLLTVKPQYAFGKNGRPATGDEDAVPSNANLHITLELVSWKTVSDIT  262

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSD-----IVEFTVEEGHFC  674
            KD  + KK+L EG+ +E P D   V VK   +L DGT+  K       + EF ++E    
Sbjct  263  KDKKVLKKILKEGDGYEXPNDGAVVQVKLIGKLHDGTVFVKKGHDEEPLFEFKIDEEQVI  322

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVKT+KKGE   +T++P+Y FG
Sbjct  323  DGLDRAVKTLKKGEVALVTIEPEYAFG  349


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 79/136 (58%), Gaps = 5/136 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK++KEG G+E P  G  V+V   G L DGT F     D    F+F + + QVI 
Sbjct  264  DKKVLKKILKEGDGYEXPNDGAVVQVKLIGKLHDGTVFVKKGHDEEPLFEFKIDEEQVID  323

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ +KT+KKGE  + TI P+ A+G   S      +P N+TL ++VEL+S++  K+   
Sbjct  324  GLDRAVKTLKKGEVALVTIEPEYAFGSCSSEKELAIVPANSTLFYEVELVSFIKEKE-SW  382

Query  513  DGGIFKKVLAEGEKWE  560
            D    +K+ A G+K E
Sbjct  383  DMNTQEKIEAAGKKKE  398



>ref|XP_003574798.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Brachypodium distachyon]
Length=567

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT  302
            D PV+KVGEEKE+G QGLKKKL+KEG GWETPE GDEVEVHYTGTLLDG KFDSSRDR  
Sbjct  30   DGPVLKVGEEKEVGKQGLKKKLLKEGEGWETPEVGDEVEVHYTGTLLDGKKFDSSRDRAD  89

Query  303  PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELL  482
             FKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGE+GSPPTIP NATLQFDVELL
Sbjct  90   TFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGETGSPPTIPANATLQFDVELL  149

Query  483  SWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEE  662
            SW SV+DICKDGGIFKK+L EGEKWENPKDPDEV VKYEARLEDGT+V+KS+ VEFTV++
Sbjct  150  SWTSVRDICKDGGIFKKILKEGEKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKD  209

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            G+ CPAL KAVKTMKK EKV LTVKPQYGFGE
Sbjct  210  GYLCPALAKAVKTMKKAEKVLLTVKPQYGFGE  241


 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 112/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  160  DGGIFKKILKEGEKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGYLCPA  215

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P T     IPPNA+L  D+EL+SW +V +I 
Sbjct  216  LAKAVKTMKKAEKVLLTVKPQYGFGEMGRPATGQEGGIPPNASLLIDLELVSWKTVTEIG  275

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
            +D  I KKV+ EGE +E P +   V VK   +L+DGT+  K      +  EF  +E    
Sbjct  276  EDKKILKKVIKEGEGYERPNEGAVVKVKITGKLQDGTVFLKKGQDEQEPFEFKTDEEEVI  335

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L  AV  MKKGE   +T+ P++ +G
Sbjct  336  GGLELAVLNMKKGEVALVTIPPEHAYG  362


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 11/146 (8%)
 Frame = +3

Query  84   MPP--AEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  257
            +PP  + + DL+L     V ++GE+K+I      KK++KEG G+E P  G  V+V  TG 
Sbjct  253  IPPNASLLIDLELVSWKTVTEIGEDKKI-----LKKVIKEGEGYERPNEGAVVKVKITGK  307

Query  258  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  434
            L DGT F    +D   PF+F   + +VI G +  +  MKKGE  + TIPP+ AYG + S 
Sbjct  308  LQDGTVFLKKGQDEQEPFEFKTDEEEVIGGLELAVLNMKKGEVALVTIPPEHAYGSTESK  367

Query  435  ---PTIPPNATLQFDVELLSWVSVKD  503
                 +PPN+T+ ++VEL+S+V  K+
Sbjct  368  QDLAIVPPNSTVIYEVELVSFVKDKE  393



>gb|EMT24309.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=611

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/237 (79%), Positives = 203/237 (86%), Gaps = 10/237 (4%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPD--------DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            +DFD+P    DDL + D        + P MKVGEEKEIG QGLKKKL+KEG GW+TPE G
Sbjct  3    DDFDIPAG--DDLMMGDGMGDFGGAEGPGMKVGEEKEIGKQGLKKKLLKEGEGWDTPEVG  60

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDG KFDSSRDR   FKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+
Sbjct  61   DEVEVHYTGTLLDGKKFDSSRDRDDTFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPE  120

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIP NATLQFDVELLSW SV+DICKDGGIFKK+L EG+KWENPKDPDEV 
Sbjct  121  LAYGESGSPPTIPANATLQFDVELLSWTSVRDICKDGGIFKKILKEGDKWENPKDPDEVF  180

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLEDGT+V+KS+ VEFTV++GH CPAL KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  181  VKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLTVKPQYGFGE  237


 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 112/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  156  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNA L  D+EL+SW +V +I 
Sbjct  212  LAKAVKTMKKGEKVLLTVKPQYGFGEMGRPAAGEGGAVPPNAGLVIDLELVSWKTVTEIG  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I KKVL EGE +E P +   V+VK   +L+DGT+  K      +  EF  +E    
Sbjct  272  DDKKILKKVLKEGEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVI  331

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV  MKKGE   +T+ P+Y +G
Sbjct  332  EGLDRAVLNMKKGEVALVTIPPEYAYG  358


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 81/136 (60%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V ++G++K+I      KK++KEG G+E P  G  V V  TG L DGT F  
Sbjct  258  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVTVKITGKLQDGTVFLK  312

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  455
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  313  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAVVPPNS  372

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  373  TVIYEVELVSFVKDKE  388



>gb|AFW71473.2| peptidyl-prolyl isomerase [Zea mays]
Length=619

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            +KVGEE+EIG +GLKKKLVKEG G + P  GDEVEVHYTGTL+DGT FDS+RDR +PFKF
Sbjct  20   LKVGEEREIGKEGLKKKLVKEGEGCDRPGAGDEVEVHYTGTLIDGTMFDSTRDRDSPFKF  79

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  494
            TLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP IPPNATLQFDVELLSWV 
Sbjct  80   TLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVC  139

Query  495  VKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFC  674
            +KDI KDGGI KKV+A+G+KWENP+DPDEV VKYEARLEDGT+V+KSD VEFTV +G FC
Sbjct  140  IKDISKDGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKSDGVEFTVRDGVFC  199

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
            PA++KAVKTMKK EK  LTV PQYGFG
Sbjct  200  PAISKAVKTMKKNEKAHLTVMPQYGFG  226


 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 107/207 (52%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V +G  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  146  DGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  201

Query  345  WDQGIKTMKKGECCIFTIPPDLAYG-----ESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E    T+ P   +G      SG   ++PPNATL  D++++SW +V ++ 
Sbjct  202  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRQASGEEASVPPNATLHIDLQVVSWRTVTELG  261

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE ++ P D   V VK   +LEDGTL  K      +  EF  +E    
Sbjct  262  SDKKILKKILKEGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVI  321

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P + FG
Sbjct  322  EGLDKAVLSMKKGEVSLVTIPPHHAFG  348


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 87/189 (46%), Gaps = 15/189 (8%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G++ P     V V   G L DGT F     D   PF+F   + QVI+G D+ + +MK
Sbjct  273  EGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMK  332

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLA  542
            KGE  + TIPP  A+G + +     T+PPN+ + +++EL+S+   KD      + +K+ A
Sbjct  333  KGEVSLVTIPPHHAFGTNETTKDLATVPPNSYVYYEMELVSFDKEKDSWDLKNVAEKIEA  392

Query  543  ------EGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTM  704
                  EG  W         S +YE  L   + V       FT EE      L  + K  
Sbjct  393  AAKKKEEGNVWFKIGKYARASKRYEKAL---SFVEYDS--SFTEEEKQLSKPLQISCKLN  447

Query  705  KKGEKVQLT  731
                K++L 
Sbjct  448  NAACKLRLN  456



>dbj|BAK02378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 201/237 (85%), Gaps = 10/237 (4%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPD--------DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPG  227
            +DFD+P    DD+ + D        D P MKVGEEKEIG QGLKKKL+KEG GW+TPE G
Sbjct  3    DDFDIPAG--DDMMMGDGTGDFGGADGPGMKVGEEKEIGKQGLKKKLLKEGEGWDTPEVG  60

Query  228  DEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPD  407
            DEVEVHYTGTLLDG KFDSSRDR   FKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+
Sbjct  61   DEVEVHYTGTLLDGKKFDSSRDRDDTFKFKLGQGQVIKGWDEGIKTMKKGENALFTIPPE  120

Query  408  LAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVS  587
            LAYGESGSPPTIP NATLQFDVELLSW SV+DICKDGGIFKK+L EG+KWE PKDPDEV 
Sbjct  121  LAYGESGSPPTIPANATLQFDVELLSWTSVRDICKDGGIFKKILKEGDKWETPKDPDEVF  180

Query  588  VKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            VKYEARLEDGT+V+KS+ VEFTV++GH CPAL KAVKTMKKGEKV L VKPQYGFGE
Sbjct  181  VKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGE  237


 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 113/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WETP+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  156  DGGIFKKILKEGDKWETPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I 
Sbjct  212  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLIIDLELVSWKTVTEIG  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I KKVL EGE +E P +   V+VK   +L+DGT+  K      +  EF  +E    
Sbjct  272  DDKKILKKVLKEGEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEDAVI  331

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV  MKKGE   +T+ P+Y +G
Sbjct  332  EGLDRAVLNMKKGEVAFVTIPPEYAYG  358


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V ++G++K+I      KK++KEG G+E P  G  V V  TG L DGT F  
Sbjct  258  DLELVSWKTVTEIGDDKKI-----LKKVLKEGEGYERPNEGAVVTVKITGKLQDGTVFLK  312

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  455
               D   PF+F   +  VI+G D+ +  MKKGE    TIPP+ AYG  ES     +PPN+
Sbjct  313  KGHDEQEPFEFKTDEDAVIEGLDRAVLNMKKGEVAFVTIPPEYAYGSTESKQDAIVPPNS  372

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  373  TVIYEVELVSFVKDKE  388



>ref|NP_001151484.1| LOC100285117 [Zea mays]
 gb|ACG43033.1| peptidyl-prolyl isomerase [Zea mays]
Length=677

 Score =   340 bits (872),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            +KVGEE+EIG +GLKKKLVKEG G + P  GDEVEVHYTGTL+DGT FDS+RDR +PFKF
Sbjct  78   LKVGEEREIGKEGLKKKLVKEGEGCDRPGAGDEVEVHYTGTLIDGTMFDSTRDRDSPFKF  137

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  494
            TLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP IPPNATLQFDVELLSWV 
Sbjct  138  TLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVC  197

Query  495  VKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFC  674
            +KDI KDGGI KKV+A+G+KWENP+DPDEV VKYEARLEDGT+V+KSD VEFTV +G FC
Sbjct  198  IKDISKDGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKSDGVEFTVRDGVFC  257

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
            PA++KAVKTMKK EK  LTV PQYGFG
Sbjct  258  PAISKAVKTMKKNEKAHLTVMPQYGFG  284


 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 107/207 (52%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V +G  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  204  DGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  259

Query  345  WDQGIKTMKKGECCIFTIPPDLAYG-----ESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E    T+ P   +G      SG   ++PPNATL  D++++SW +V ++ 
Sbjct  260  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRQASGEEASVPPNATLHIDLQVVSWRTVTELG  319

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE ++ P D   V VK   +LEDGTL  K      +  EF  +E    
Sbjct  320  SDKKILKKILKEGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVI  379

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P + FG
Sbjct  380  EGLDKAVLSMKKGEVSLVTIPPHHAFG  406


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 87/189 (46%), Gaps = 15/189 (8%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G++ P     V V   G L DGT F     D   PF+F   + QVI+G D+ + +MK
Sbjct  331  EGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMK  390

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLA  542
            KGE  + TIPP  A+G + +     T+PPN+ + +++EL+S+   KD      + +K+ A
Sbjct  391  KGEVSLVTIPPHHAFGTNETTKDLATVPPNSYVYYEMELVSFDKEKDSWDLKNVAEKIEA  450

Query  543  ------EGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTM  704
                  EG  W         S +YE  L   + V       FT EE      L  + K  
Sbjct  451  AAKKKEEGNVWFKIGKYARASKRYEKAL---SFVEYDS--SFTEEEKQLSKPLQISCKLN  505

Query  705  KKGEKVQLT  731
                K++L 
Sbjct  506  NAACKLRLN  514



>gb|ACN30883.1| unknown [Zea mays]
Length=677

 Score =   340 bits (872),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            +KVGEE+EIG +GLKKKLVKEG G + P  GDEVEVHYTGTL+DGT FDS+RDR +PFKF
Sbjct  78   LKVGEEREIGKEGLKKKLVKEGEGCDRPGAGDEVEVHYTGTLIDGTMFDSTRDRDSPFKF  137

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVS  494
            TLGQGQVIKGWD GIKTMKKGE  +FTIPP+LAYGE GSPP IPPNATLQFDVELLSWV 
Sbjct  138  TLGQGQVIKGWDLGIKTMKKGENAVFTIPPELAYGEDGSPPVIPPNATLQFDVELLSWVC  197

Query  495  VKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFC  674
            +KDI KDGGI KKV+A+G+KWENP+DPDEV VKYEARLEDGT+V+KSD VEFTV +G FC
Sbjct  198  IKDISKDGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKSDGVEFTVRDGVFC  257

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
            PA++KAVKTMKK EK  LTV PQYGFG
Sbjct  258  PAISKAVKTMKKNEKAHLTVMPQYGFG  284


 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 107/207 (52%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V +G  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  204  DGGILKKVVAKGDKWENPRDPDEVVVKYEARLEDGTVVSKS----DGVEFTVRDGVFCPA  259

Query  345  WDQGIKTMKKGECCIFTIPPDLAYG-----ESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E    T+ P   +G      SG   ++PPNATL  D++++SW +V ++ 
Sbjct  260  ISKAVKTMKKNEKAHLTVMPQYGFGVKGRQASGEEASVPPNATLHIDLQVVSWRTVTELG  319

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE ++ P D   V VK   +LEDGTL  K      +  EF  +E    
Sbjct  320  SDKKILKKILKEGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVI  379

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P + FG
Sbjct  380  EGLDKAVLSMKKGEVSLVTIPPHHAFG  406


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 87/189 (46%), Gaps = 15/189 (8%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G++ P     V V   G L DGT F     D   PF+F   + QVI+G D+ + +MK
Sbjct  331  EGEGYDCPNDCAVVRVKLIGKLEDGTLFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMK  390

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLA  542
            KGE  + TIPP  A+G + +     T+PPN+ + +++EL+S+   KD      + +K+ A
Sbjct  391  KGEVSLVTIPPHHAFGTNETTKDLATVPPNSYVYYEMELVSFDKEKDSWDLKNVAEKIEA  450

Query  543  ------EGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTM  704
                  EG  W         S +YE  L   + V       FT EE      L  + K  
Sbjct  451  AAKKKEEGNVWFKIGKYARASKRYEKAL---SFVEYDS--SFTEEEKQLSKPLQISCKLN  505

Query  705  KKGEKVQLT  731
                K++L 
Sbjct  506  NAACKLRLN  514



>ref|XP_003532733.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max]
Length=570

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 199/231 (86%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDF+ P A       +   ++P++KVGEEKEIG  GLKKKL+KEG GW+ P+ GD+VEVH
Sbjct  3    EDFEFPSAGNMEMPEEEEIESPILKVGEEKEIGKMGLKKKLLKEGEGWDIPDCGDQVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFRLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI K ++ EGEKW+NPKD DEV VKYEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGILKNIITEGEKWDNPKDLDEVFVKYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +++KSD VEFTVEEG+FCPAL KAVKTMKKGEKV L VKPQY FGE
Sbjct  183  LEDGIVISKSDGVEFTVEEGYFCPALAKAVKTMKKGEKVLLNVKPQYAFGE  233


 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 113/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGIVISKS----DGVEFTVEEGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GESG P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPASGDEGAVPPNASLQVDLELVSWKTVSDIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  + KK L EGE +E P D   V VK   +L+DGT+  K         EF ++E    
Sbjct  268  NDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYDDQQPFEFKIDEEQVT  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVK+MKKGE   L ++P+Y FG
Sbjct  328  DGLDQAVKSMKKGEIALLIIQPEYAFG  354


 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 80/137 (58%), Gaps = 5/137 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  338
             D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QV 
Sbjct  268  NDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYDDQQPFEFKIDEEQVT  327

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G DQ +K+MKKGE  +  I P+ A+G SGS      +PPN+T+ ++VELLS++  K+  
Sbjct  328  DGLDQAVKSMKKGEIALLIIQPEYAFGPSGSSQELANVPPNSTVYYEVELLSFIKEKE-S  386

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  387  WDLNTQEKIEAAGKKKE  403



>gb|KHN12365.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Glycine soja]
Length=570

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 199/231 (86%), Gaps = 2/231 (1%)
 Frame = +3

Query  72   EDFDMPPA--EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            EDF+ P A       +   ++P++KVGEEKEIG  GLKKKL+KEG GW+ P+ GD+VEVH
Sbjct  3    EDFEFPSAGNMEMPEEEEIESPILKVGEEKEIGKMGLKKKLLKEGEGWDIPDCGDQVEVH  62

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSSRDRGTPFKF LGQGQVIKGWD+GIKTMKKGE  +FTIPP+LAYGES
Sbjct  63   YTGTLLDGTKFDSSRDRGTPFKFRLGQGQVIKGWDEGIKTMKKGENALFTIPPELAYGES  122

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPPTIPPNATLQFDVELLSW SVKDICKDGGI K ++ EGEKW+NPKD DEV VKYEAR
Sbjct  123  GSPPTIPPNATLQFDVELLSWTSVKDICKDGGILKNIITEGEKWDNPKDLDEVFVKYEAR  182

Query  606  LEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            LEDG +++KSD VEFTVEEG+FCPAL KAVKTMKKGEKV L VKPQY FGE
Sbjct  183  LEDGIVISKSDGVEFTVEEGYFCPALAKAVKTMKKGEKVLLNVKPQYAFGE  233


 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 113/207 (55%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ K ++ EG  W+ P+  DEV V Y   L DG     S       +FT+ +G     
Sbjct  152  DGGILKNIITEGEKWDNPKDLDEVFVKYEARLEDGIVISKS----DGVEFTVEEGYFCPA  207

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P  A+GESG P +     +PPNA+LQ D+EL+SW +V DI 
Sbjct  208  LAKAVKTMKKGEKVLLNVKPQYAFGESGRPASGDEGAVPPNASLQVDLELVSWKTVSDIT  267

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  + KK L EGE +E P D   V VK   +L+DGT+  K         EF ++E    
Sbjct  268  NDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYDDQQPFEFKIDEEQVT  327

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AVK+MKKGE   L ++P+Y FG
Sbjct  328  DGLDQAVKSMKKGEIALLIIQPEYAFG  354


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 5/137 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVI  338
             D+ + KK +KEG G+E P  G  V+V   G L DGT F     D   PF+F + + QV 
Sbjct  268  NDRKVLKKTLKEGEGYERPNDGAVVQVKLIGKLQDGTVFIKKGYDDQQPFEFKIDEEQVT  327

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKDIC  509
             G DQ +K+MKKGE  +  I P+ A+G SGS      +PPN+T+ ++VELLS++  K++ 
Sbjct  328  DGLDQAVKSMKKGEIALLIIQPEYAFGPSGSSQELANVPPNSTVYYEVELLSFIKEKELW  387

Query  510  KDGGIFKKVLAEGEKWE  560
             D    +K+ A G+K E
Sbjct  388  -DLNTQEKIEAAGKKKE  403



>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73
 pdb|3JYM|B Chain B, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73
Length=377

 Score =   328 bits (842),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +3

Query  123  DNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGT  302
            + P MKVGEE EIG QGLKKKL+KEG GW+TPE GDEVEVHYTGTLLDG KFDSSRDR  
Sbjct  12   EGPGMKVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDD  71

Query  303  PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELL  482
             FKF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGESGSPPTIP NATLQFDVELL
Sbjct  72   TFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELL  131

Query  483  SWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEE  662
            SW SV+DI KDGGIFKK+L EG+KWENPKDPDEV VKYEARLEDGT+V+KS+ VEFTV++
Sbjct  132  SWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKD  191

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GH CPAL KAVKTMKKGEKV L VKPQYGFGE
Sbjct  192  GHLCPALAKAVKTMKKGEKVLLAVKPQYGFGE  223


 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  142  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  197

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I 
Sbjct  198  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIG  257

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I KKVL E E +E P +   V+VK   +L+DGT+  K      +  EF  +E    
Sbjct  258  DDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVI  317

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV  MKKGE   +T+ P+Y +G
Sbjct  318  EGLDRAVLNMKKGEVALVTIPPEYAYG  344


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V ++G++K+I      KK++KE  G+E P  G  V V  TG L DGT F  
Sbjct  244  DLELVSWKTVTEIGDDKKI-----LKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLK  298

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  455
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  299  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNS  358

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  359  TVIYEVELVSFVKDKE  374



>sp|Q43207.1|FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase; AltName: Full=Peptidyl-prolyl 
cis-trans isomerase; Short=PPIase; AltName: 
Full=Rotamase [Triticum aestivum]
 emb|CAA60505.1| peptidylprolyl isomerase [Triticum aestivum]
Length=559

 Score =   333 bits (853),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P MKVGEE EIG QGLKKKL+KEG GW+TPE GDEVEVHYTGTLLDG KFDSSRDR   F
Sbjct  28   PGMKVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTF  87

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
            KF LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGESGSPPTIP NATLQFDVELLSW
Sbjct  88   KFKLGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSW  147

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGH  668
             SV+DI KDGGIFKK+L EG+KWENPKDPDEV VKYEARLEDGT+V+KS+ VEFTV++GH
Sbjct  148  TSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGH  207

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             CPAL KAVKTMKKGEKV L VKPQYGFGE
Sbjct  208  LCPALAKAVKTMKKGEKVLLAVKPQYGFGE  237


 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  156  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  211

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I 
Sbjct  212  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIG  271

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I KKVL E E +E P +   V+VK   +L+DGT+  K      +  EF  +E    
Sbjct  272  DDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVI  331

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV  MKKGE   +T+ P+Y +G
Sbjct  332  EGLDRAVLNMKKGEVALVTIPPEYAYG  358


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V ++G++K+I      KK++KE  G+E P  G  V V  TG L DGT F  
Sbjct  258  DLELVSWKTVTEIGDDKKI-----LKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLK  312

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  455
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  313  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNS  372

Query  456  TLQFDVELLSWVSVKD  503
            T+ ++VEL+S+V  K+
Sbjct  373  TVIYEVELVSFVKDKE  388



>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73
Length=356

 Score =   325 bits (833),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +3

Query  138  KVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFT  317
            KVGEE EIG QGLKKKL+KEG GW+TPE GDEVEVHYTGTLLDG KFDSSRDR   FKF 
Sbjct  1    KVGEENEIGKQGLKKKLLKEGEGWDTPEVGDEVEVHYTGTLLDGKKFDSSRDRDDTFKFK  60

Query  318  LGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSV  497
            LGQGQVIKGWDQGIKTMKKGE  +FTIPP+LAYGESGSPPTIP NATLQFDVELLSW SV
Sbjct  61   LGQGQVIKGWDQGIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLSWTSV  120

Query  498  KDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCP  677
            +DI KDGGIFKK+L EG+KWENPKDPDEV VKYEARLEDGT+V+KS+ VEFTV++GH CP
Sbjct  121  RDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCP  180

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            AL KAVKTMKKGEKV L VKPQYGFGE
Sbjct  181  ALAKAVKTMKKGEKVLLAVKPQYGFGE  207


 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++KEG  WE P+  DEV V Y   L DGT    S       +FT+  G +   
Sbjct  126  DGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEG----VEFTVKDGHLCPA  181

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  +  + P   +GE G P       +PPNA+L  D+EL+SW +V +I 
Sbjct  182  LAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIG  241

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK-----SDIVEFTVEEGHFC  674
             D  I KKVL E E +E P +   V+VK   +L+DGT+  K      +  EF  +E    
Sbjct  242  DDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVI  301

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV  MKKGE   +T+ P+Y +G
Sbjct  302  EGLDRAVLNMKKGEVALVTIPPEYAYG  328


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 8/132 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-D  281
            DL+L     V ++G++K+I      KK++KE  G+E P  G  V V  TG L DGT F  
Sbjct  228  DLELVSWKTVTEIGDDKKI-----LKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLK  282

Query  282  SSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG--ESGSPPTIPPNA  455
               D   PF+F   +  VI+G D+ +  MKKGE  + TIPP+ AYG  ES     +PPN+
Sbjct  283  KGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNS  342

Query  456  TLQFDVELLSWV  491
            T+ ++VEL+S+V
Sbjct  343  TVIYEVELVSFV  354



>gb|EMT19050.1| 70 kDa peptidyl-prolyl isomerase [Aegilops tauschii]
Length=676

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 182/236 (77%), Gaps = 27/236 (11%)
 Frame = +3

Query  132  VMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFK  311
             MK GEE+ IG +GL+++L +EG G + P  GDEVEVHYTGTL DGTKFDSSRDR  PF+
Sbjct  57   AMKAGEERGIGKEGLRERLGREGEGPQLPGAGDEVEVHYTGTLADGTKFDSSRDRDAPFR  116

Query  312  FTLGQ---------------------------GQVIKGWDQGIKTMKKGECCIFTIPPDL  410
            FTLG+                           GQVIKGWD GIKTMK+GE  IFTIPP+L
Sbjct  117  FTLGRAYPHAKALFSVKPSLLSVGWKNKYIASGQVIKGWDLGIKTMKRGENAIFTIPPEL  176

Query  411  AYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSV  590
            AYGE GSPP IPPNATLQFDVELLSW SVKDICKDG IFKK+LAEGEKWENPKD DEV V
Sbjct  177  AYGEDGSPPVIPPNATLQFDVELLSWASVKDICKDGSIFKKILAEGEKWENPKDCDEVFV  236

Query  591  KYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            KYEARLEDGTL+ KSD +EFTV+EGHFCPA++KAVKTMKK EK  LTVKPQYGFGE
Sbjct  237  KYEARLEDGTLITKSDGIEFTVKEGHFCPAISKAVKTMKKNEKALLTVKPQYGFGE  292


 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 112/207 (54%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D  + KK++ EG  WE P+  DEV V Y   L DGT    S       +FT+ +G     
Sbjct  211  DGSIFKKILAEGEKWENPKDCDEVFVKYEARLEDGTLITKS----DGIEFTVKEGHFCPA  266

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKK E  + T+ P   +GE G P +     +PPNA LQ D++L+SW +V +I 
Sbjct  267  ISKAVKTMKKNEKALLTVKPQYGFGEQGRPASRGEAAVPPNAMLQIDLQLVSWKTVTEIG  326

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             D  I KK+L EGE ++ PKD   V VK   +L+DGT+  K      +  EF  +E    
Sbjct  327  NDKTILKKILQEGEGYDRPKDCSTVKVKLIGKLDDGTMFVKKGHDGEEPFEFKTDEDQVI  386

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P++ FG
Sbjct  387  EGLDKAVLSMKKGEVAFVTIPPEHAFG  413


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 78/141 (55%), Gaps = 11/141 (8%)
 Frame = +3

Query  84   MPPAEM--DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  257
            +PP  M   DL L     V ++G +K I      KK+++EG G++ P+    V+V   G 
Sbjct  304  VPPNAMLQIDLQLVSWKTVTEIGNDKTI-----LKKILQEGEGYDRPKDCSTVKVKLIGK  358

Query  258  LLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP  434
            L DGT F     D   PF+F   + QVI+G D+ + +MKKGE    TIPP+ A+G   + 
Sbjct  359  LDDGTMFVKKGHDGEEPFEFKTDEDQVIEGLDKAVLSMKKGEVAFVTIPPEHAFGSDETK  418

Query  435  ---PTIPPNATLQFDVELLSW  488
                 +PPN T+ +DVEL+S+
Sbjct  419  QDLAVVPPNTTVYYDVELVSF  439



>ref|XP_002977259.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
 gb|EFJ21868.1| hypothetical protein SELMODRAFT_443450 [Selaginella moellendorffii]
Length=567

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 188/236 (80%), Gaps = 6/236 (3%)
 Frame = +3

Query  66   IMEDFDMPPAEMDD---LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            + +DF++  A MD+   ++     P +K GEE+EIG  GLKK LVK G GWE PEPGDEV
Sbjct  1    MADDFEIADAGMDEEAGMEATSAAP-LKAGEEQEIGKNGLKKLLVKAGTGWEMPEPGDEV  59

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            +VHYTGTLLDG+KFDSSRDRG PF F LGQGQVIKGWD+GIKTMKKGE  +FTIPP LAY
Sbjct  60   KVHYTGTLLDGSKFDSSRDRGDPFTFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPALAY  119

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GE+GSPPTIPPNATL+FDVELLSW SVKDICKDGG+ KK+++EG+K+E PKD DEV+VKY
Sbjct  120  GEAGSPPTIPPNATLKFDVELLSWDSVKDICKDGGVVKKIVSEGKKYEMPKDLDEVTVKY  179

Query  597  EARLEDGTLVAKS--DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             A+ E G +V +S  +  EF V +GHFC AL  AVKTM KGEK  LTV+P+YG GE
Sbjct  180  VAKNEAGLVVGQSPEEGAEFYVHQGHFCEALAIAVKTMMKGEKALLTVRPKYGLGE  235


 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 103/202 (51%), Gaps = 14/202 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  +E P+  DEV V Y      G     S + G   +F + QG   + 
Sbjct  152  DGGVVKKIVSEGKKYEMPKDLDEVTVKYVAKNEAGLVVGQSPEEGA--EFYVHQGHFCEA  209

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGI  524
                +KTM KGE  + T+ P    GES           L  D+EL+SW +V+ I +DG I
Sbjct  210  LAIAVKTMMKGEKALLTVRPKYGLGES--------QGILSIDLELVSWKTVEKIGQDGKI  261

Query  525  FKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALTKA  692
             KK++   E  + P D   V +KY A+L DGT+  K     D  EF  +E      L KA
Sbjct  262  TKKIIKASEGHDKPNDGTIVKIKYVAKLLDGTVFEKKGDDEDPFEFKTDEEQVIDGLDKA  321

Query  693  VKTMKKGEKVQLTVKPQYGFGE  758
            V TMKKGE   +T+ P++GFG+
Sbjct  322  VATMKKGEVAVVTIGPEHGFGD  343


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V K+G+     D  + KK++K   G + P  G  V++ Y   LLDGT F+ 
Sbjct  243  DLELVSWKTVEKIGQ-----DGKITKKIIKASEGHDKPNDGTIVKIKYVAKLLDGTVFEK  297

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
              D   PF+F   + QVI G D+ + TMKKGE  + TI P+  +G+  +      +P N+
Sbjct  298  KGDDEDPFEFKTDEEQVIDGLDKAVATMKKGEVAVVTIGPEHGFGDVDTQRDLALVPANS  357

Query  456  TLQFDVELLSWVSVKD  503
            TL ++VE++S+V  KD
Sbjct  358  TLVYEVEMISFVKAKD  373



>gb|KJB28026.1| hypothetical protein B456_005G022600, partial [Gossypium raimondii]
Length=493

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 169/206 (82%), Gaps = 18/206 (9%)
 Frame = +3

Query  126  NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP  305
            NP++K GEEK+IG+ GLKKKLVKEG GWETP+ G +VEVHYTG L+DGTKFDSS DRGTP
Sbjct  5    NPILKAGEEKDIGNDGLKKKLVKEGEGWETPKNGYDVEVHYTGALIDGTKFDSSLDRGTP  64

Query  306  FKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLS  485
            FKF LG GQVIKGWD+GIKTMKKGE  IFT+PP+LAYGESGSPPTIPPNATLQFDVEL+S
Sbjct  65   FKFKLGLGQVIKGWDEGIKTMKKGENAIFTVPPELAYGESGSPPTIPPNATLQFDVELIS  124

Query  486  WVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEG  665
            W SVKDIC+DGGIFKK+L                  YE  LEDGTLV+KS  VEFTV +G
Sbjct  125  WTSVKDICQDGGIFKKIL------------------YEVCLEDGTLVSKSHGVEFTVGDG  166

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQ  743
            +FCPA ++AVKTMKKGE+V LTVKPQ
Sbjct  167  YFCPAFSEAVKTMKKGEQVLLTVKPQ  192


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 65/107 (61%), Gaps = 5/107 (5%)
 Frame = +3

Query  195  EGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIKGWDQGIKTMK  371
            EG G++ P  G  V+V   G L DG  F     D G+ F+F + +GQVI G ++ +KTMK
Sbjct  205  EGEGYDRPYNGTMVQVKLIGKLEDGMIFVKKGHDEGS-FEFKVDEGQVIDGLEKTVKTMK  263

Query  372  KGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            KGE  + TI P+ A+G S S      +P N+T+ ++VEL+S+V  K+
Sbjct  264  KGEHALTTIQPEYAFGSSESQQELAVVPANSTVYYEVELVSFVKEKE  310


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 76/176 (43%), Gaps = 41/176 (23%)
 Frame = +3

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            + Y   L DGT    S       +FT+G G     + + +KTMKKGE  + T+ P     
Sbjct  141  ILYEVCLEDGTLVSKSHG----VEFTVGDGYFCPAFSEAVKTMKKGEQVLLTVKPQ----  192

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
                                         CKD  I KK+L EGE ++ P +   V VK  
Sbjct  193  -----------------------------CKDKKILKKILKEGEGYDRPYNGTMVQVKLI  223

Query  600  ARLEDGTLVAKSD----IVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
             +LEDG +  K        EF V+EG     L K VKTMKKGE    T++P+Y FG
Sbjct  224  GKLEDGMIFVKKGHDEGSFEFKVDEGQVIDGLEKTVKTMKKGEHALTTIQPEYAFG  279


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 47/91 (52%), Gaps = 5/91 (5%)
 Frame = +3

Query  498  KDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEG  665
            KDI  DG + KK++ EGE WE PK+  +V V Y   L DGT    S       +F +  G
Sbjct  14   KDIGNDG-LKKKLVKEGEGWETPKNGYDVEVHYTGALIDGTKFDSSLDRGTPFKFKLGLG  72

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
                   + +KTMKKGE    TV P+  +GE
Sbjct  73   QVIKGWDEGIKTMKKGENAIFTVPPELAYGE  103



>ref|XP_002992143.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
 gb|EFJ06798.1| hypothetical protein SELMODRAFT_134839 [Selaginella moellendorffii]
Length=593

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 183/231 (79%), Gaps = 6/231 (3%)
 Frame = +3

Query  66   IMEDFDMPPAEMDD---LDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            + +DF++  A MD+   ++     P +K GEE+EIG  GLKK LVK G GWE PEPGDEV
Sbjct  1    MADDFEIADAGMDEEAGMEATSAAP-LKAGEEQEIGKNGLKKLLVKAGTGWEMPEPGDEV  59

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            +VHYTGTLLDG+KFDSSRDRG PF F LGQGQVIKGWD+GIKTMKKGE  +FTIPP LAY
Sbjct  60   KVHYTGTLLDGSKFDSSRDRGDPFTFKLGQGQVIKGWDEGIKTMKKGENAVFTIPPALAY  119

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            GE+GSPPTIPPNATL+FDVELLSW SVKDI KDGG+ KK+++EG+K+E PKD DEV+VKY
Sbjct  120  GEAGSPPTIPPNATLKFDVELLSWDSVKDISKDGGVVKKIVSEGKKYEMPKDLDEVTVKY  179

Query  597  EARLEDGTLVAKS--DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQ  743
             A+ E G +V +S  +  EF V +GHFC AL  AVKTM KGEK  LTV+P+
Sbjct  180  VAKNEAGLVVGQSPEEGAEFYVHQGHFCEALAIAVKTMMKGEKALLTVRPK  230


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 105/207 (51%), Gaps = 11/207 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  +E P+  DEV V Y      G     S + G   +F + QG   + 
Sbjct  152  DGGVVKKIVSEGKKYEMPKDLDEVTVKYVAKNEAGLVVGQSPEEGA--EFYVHQGHFCEA  209

Query  345  WDQGIKTMKKGECCIFTIPPDL-AYGESGSPPTI----PPNATLQFDVELLSWVSVKDIC  509
                +KTM KGE  + T+ P    +  S +   +        TL  D+EL+SW +V+ I 
Sbjct  210  LAIAVKTMMKGEKALLTVRPKCEMFVFSNALDRLDGLGESQGTLSIDLELVSWKTVEKIG  269

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
            +DG I KK++   E  + P D   V +KY A+L DGT+  K     D  EF  +E     
Sbjct  270  QDGKITKKIIKASEGHDKPNDGTIVKIKYVAKLLDGTVFEKKGDDEDPFEFKTDEEQVID  329

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             L KAV TMKKGE   +T+ P++GFG+
Sbjct  330  GLDKAVATMKKGEVAVVTIGPEHGFGD  356


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L     V K+G+     D  + KK++K   G + P  G  V++ Y   LLDGT F+ 
Sbjct  256  DLELVSWKTVEKIGQ-----DGKITKKIIKASEGHDKPNDGTIVKIKYVAKLLDGTVFEK  310

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNA  455
              D   PF+F   + QVI G D+ + TMKKGE  + TI P+  +G+  +      +P N+
Sbjct  311  KGDDEDPFEFKTDEEQVIDGLDKAVATMKKGEVAVVTIGPEHGFGDVDTQRDLALVPANS  370

Query  456  TLQFDVELLSWVSVKD  503
            TL ++VE++S+V  KD
Sbjct  371  TLVYEVEMISFVKAKD  386



>ref|XP_002979133.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
 gb|EFJ19541.1| hypothetical protein SELMODRAFT_110584 [Selaginella moellendorffii]
Length=569

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = +3

Query  138  KVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFT  317
            K G+E+EIG  GLKK LVK G GWE P  GDEV+VHYTG LLDGT+FDSSRDRG PF F 
Sbjct  14   KEGQEREIGKHGLKKLLVKAGEGWERPSTGDEVKVHYTGMLLDGTEFDSSRDRGEPFSFK  73

Query  318  LGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSV  497
            LG GQVIKGWD GI TM+KGE   FTIPP+LAYGE+G+ P+IP NATL+FDVELLSW S+
Sbjct  74   LGVGQVIKGWDHGISTMRKGESATFTIPPELAYGEAGAGPSIPGNATLKFDVELLSWDSI  133

Query  498  KDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI--VEFTVEEGHF  671
            K+ICKDGGI KK++AEG  W  PKD DEV V++EA+LEDGT+VA + +  VEF V +G+ 
Sbjct  134  KEICKDGGILKKIVAEGRNWATPKDDDEVLVRFEAKLEDGTVVATTPLAGVEFRVTDGYL  193

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            CPA++KAV+TMK+ EKV LTVK QYGFGE
Sbjct  194  CPAISKAVRTMKREEKVILTVKSQYGFGE  222


 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 109/206 (53%), Gaps = 11/206 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  W TP+  DEV V +   L DGT   ++   G  F+ T   G +   
Sbjct  139  DGGILKKIVAEGRNWATPKDDDEVLVRFEAKLEDGTVVATTPLAGVEFRVT--DGYLCPA  196

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + ++TMK+ E  I T+     +GE+G         IPPNA+L   +ELLSW  V  I 
Sbjct  197  ISKAVRTMKREEKVILTVKSQYGFGEAGKKAHGNECAIPPNASLIISLELLSWRVVDYIT  256

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  + KK+L +GE +E P D   V VKY  +L +G +  +     ++ EF V+E     
Sbjct  257  PDRKVVKKILKQGEGYEMPNDGSLVKVKYVGKLANGRVFDERGLAGELFEFRVDEEQVIS  316

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAV  MKKGE   +T+ P+YG+G
Sbjct  317  GLDKAVSKMKKGEVSLITIDPEYGYG  342


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK++K+G G+E P  G  V+V Y G L +G  FD     G  F+F + + QVI G
Sbjct  258  DRKVVKKILKQGEGYEMPNDGSLVKVKYVGKLANGRVFDERGLAGELFEFRVDEEQVISG  317

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKD  503
             D+ +  MKKGE  + TI P+  YG S   GS   IP N+TL +++EL S+V  KD
Sbjct  318  LDKAVSKMKKGEVSLITIDPEYGYGNSVTRGSLSLIPANSTLTYELELDSFVKEKD  373



>ref|XP_002988507.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
 gb|EFJ10303.1| hypothetical protein SELMODRAFT_183937 [Selaginella moellendorffii]
Length=569

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = +3

Query  138  KVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFT  317
            K G+E+EIG  GLKK LVK G GWE P  GDEV+VHYTG LLDGT+FDSSRDRG PF F 
Sbjct  14   KEGQEREIGKHGLKKLLVKAGEGWERPSTGDEVKVHYTGMLLDGTEFDSSRDRGEPFSFK  73

Query  318  LGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSV  497
            LG GQVIKGWD GI TM+KGE   FTIPP+LAYGE+G+ P+IP NATL+FDVELLSW S+
Sbjct  74   LGVGQVIKGWDHGISTMRKGETATFTIPPELAYGEAGAGPSIPGNATLKFDVELLSWDSI  133

Query  498  KDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI--VEFTVEEGHF  671
            K+ICKDGGI KK++AEG  W  PKD DEV V++EA+LEDGT+VA + +  VEF V +G+ 
Sbjct  134  KEICKDGGILKKIVAEGRNWATPKDDDEVLVRFEAKLEDGTVVATTPLAGVEFRVTDGYL  193

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            CPA++KAV+TMK+ EKV LTVK QYGFGE
Sbjct  194  CPAISKAVRTMKREEKVILTVKSQYGFGE  222


 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 109/206 (53%), Gaps = 11/206 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V EG  W TP+  DEV V +   L DGT   ++   G  F+ T   G +   
Sbjct  139  DGGILKKIVAEGRNWATPKDDDEVLVRFEAKLEDGTVVATTPLAGVEFRVT--DGYLCPA  196

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + ++TMK+ E  I T+     +GE+G         IPPNA+L   +ELLSW  V  I 
Sbjct  197  ISKAVRTMKREEKVILTVKSQYGFGEAGKKAHGNECAIPPNASLIISLELLSWRVVDYIT  256

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCP  677
             D  + KK+L +GE +E P D   V VKY  +L +G +  +     ++ EF V+E     
Sbjct  257  PDRKVVKKILKQGEGYEMPNDGSLVKVKYVGKLANGRVFDERGLAGELFEFRVDEEQVIS  316

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L KAV  MKKGE   +T+ P+YG+G
Sbjct  317  GLDKAVSKMKKGEVSLITIDPEYGYG  342


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D+ + KK++K+G G+E P  G  V+V Y G L +G  FD     G  F+F + + QVI G
Sbjct  258  DRKVVKKILKQGEGYEMPNDGSLVKVKYVGKLANGRVFDERGLAGELFEFRVDEEQVISG  317

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKD  503
             D+ +  MKKGE  + TI P+  YG S   GS   IP N+TL +++EL S+V  KD
Sbjct  318  LDKAVSKMKKGEVSLITIDPEYGYGNSVTRGSLSLIPANSTLTYELELDSFVKEKD  373



>ref|XP_001769063.1| predicted protein [Physcomitrella patens]
 gb|EDQ66141.1| predicted protein [Physcomitrella patens]
Length=562

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 180/234 (77%), Gaps = 7/234 (3%)
 Frame = +3

Query  75   DFDMPPAEMDDLDLP--DDNPVMKVGEEKE-IGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            DFD+P AE  +      D +P   VG+ +E I   GL+K + K G GWETP+ GDEV VH
Sbjct  5    DFDIPDAEEVEETGEEVDYDP-QTVGKVQELIKGGGLQKLITKAGEGWETPDTGDEVSVH  63

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
            YTGTLLDGTKFDSS DRG PF F LGQGQVIKGWD+G+ TMKKGE   FTI P+ AYGE+
Sbjct  64   YTGTLLDGTKFDSSLDRGQPFTFKLGQGQVIKGWDKGVATMKKGEKATFTISPENAYGEA  123

Query  426  GSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEAR  605
            GSPP IP NATL+FDVELL W SVKDICKDGGI KK++ EG+KWENPKD DEV VKYE R
Sbjct  124  GSPPVIPANATLKFDVELLHWASVKDICKDGGIIKKIVTEGKKWENPKDLDEVLVKYEVR  183

Query  606  LE-DGTLVAKS--DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            L+   T+VAKS    VEFTV++GHFCPA+ +AVKTM KGEK  LTVKP+YGFGE
Sbjct  184  LQRHQTVVAKSPESGVEFTVKDGHFCPAIGQAVKTMLKGEKALLTVKPRYGFGE  237


 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 115/208 (55%), Gaps = 13/208 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTL-LDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            D G+ KK+V EG  WE P+  DEV V Y   L    T    S + G   +FT+  G    
Sbjct  153  DGGIIKKIVTEGKKWENPKDLDEVLVKYEVRLQRHQTVVAKSPESGV--EFTVKDGHFCP  210

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  506
               Q +KTM KGE  + T+ P   +GE G+ P+     IP +A L+ ++EL+SW  V+++
Sbjct  211  AIGQAVKTMLKGEKALLTVKPRYGFGEKGAAPSGDVKAIPSDAVLEIELELISWKVVEEV  270

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHF  671
              D  + KK+L  GE +E P D   V V+Y A+LE+GT+  K+     ++ +F  +EG  
Sbjct  271  TDDKKVIKKILTAGEGYEKPNDGSTVKVRYVAKLENGTIFEKNGQDGEELFQFVTDEGQV  330

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKK E   +T+ P+YGFG
Sbjct  331  IDGLDKAVLTMKKNEHALVTIYPEYGFG  358


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 67/117 (57%), Gaps = 4/117 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIK  341
            D+ + KK++  G G+E P  G  V+V Y   L +GT F+ + +D    F+F   +GQVI 
Sbjct  273  DKKVIKKILTAGEGYEKPNDGSTVKVRYVAKLENGTIFEKNGQDGEELFQFVTDEGQVID  332

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
            G D+ + TMKK E  + TI P+  +G   +      +P N+TL +++EL+ ++  K+
Sbjct  333  GLDKAVLTMKKNEHALVTIYPEYGFGGEETKRDLAIVPANSTLFYEIELVEFIKEKE  389



>gb|EPS59147.1| hypothetical protein M569_15662, partial [Genlisea aurea]
Length=179

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 152/176 (86%), Gaps = 5/176 (3%)
 Frame = +3

Query  72   EDFDMPPAEM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEV  236
            +DFDM  AE      +++D+P+    +KVGEEKEIG +GLKKKLVKEG GW+TPE GDEV
Sbjct  3    DDFDMAQAEEGLGLDEEVDMPEAGNYLKVGEEKEIGKEGLKKKLVKEGEGWDTPENGDEV  62

Query  237  EVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAY  416
            EVHYTGTLLDGTKFDSSRDRG PF FTLGQGQVIKGWD GIKTMKKGE  IFTIP  LAY
Sbjct  63   EVHYTGTLLDGTKFDSSRDRGQPFTFTLGQGQVIKGWDVGIKTMKKGENAIFTIPAGLAY  122

Query  417  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEV  584
            GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKK+L EGEKWENPKD DEV
Sbjct  123  GESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILKEGEKWENPKDLDEV  178


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 47/91 (52%), Gaps = 5/91 (5%)
 Frame = +3

Query  498  KDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEG  665
            K+I K+G + KK++ EGE W+ P++ DEV V Y   L DGT    S        FT+ +G
Sbjct  35   KEIGKEG-LKKKLVKEGEGWDTPENGDEVEVHYTGTLLDGTKFDSSRDRGQPFTFTLGQG  93

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
                     +KTMKKGE    T+     +GE
Sbjct  94   QVIKGWDVGIKTMKKGENAIFTIPAGLAYGE  124



>ref|XP_011024591.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform 
X2 [Populus euphratica]
Length=526

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 165/235 (70%), Gaps = 55/235 (23%)
 Frame = +3

Query  72   EDFDMPPA-EM-----DDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDE  233
            EDF++P   EM     D LDLPD+ P++KVGEEKEIG+QGLKKKL+KEG GW+TP+ GDE
Sbjct  3    EDFELPTGDEMMMNNDDQLDLPDEGPMLKVGEEKEIGNQGLKKKLLKEGEGWDTPDNGDE  62

Query  234  VEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLA  413
            VEVHYTGTLLDGT+FDSSRDRGTPFKFTLGQGQVIKGWD GIKTMKKGE  +FTIP DLA
Sbjct  63   VEVHYTGTLLDGTQFDSSRDRGTPFKFTLGQGQVIKGWDLGIKTMKKGENALFTIPADLA  122

Query  414  YGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVK  593
            YG SGS PTIPPNATLQFDVELLSW S+KDICKDG                         
Sbjct  123  YGSSGSAPTIPPNATLQFDVELLSWSSIKDICKDG-------------------------  157

Query  594  YEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
                                    HFCPAL +AVKTMK+GEKV LTVKPQYGFGE
Sbjct  158  ------------------------HFCPALARAVKTMKEGEKVLLTVKPQYGFGE  188


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTPFKFTLGQGQVIK  341
            D+ + KK++KEG G+E P  G  V+V   G L DGT F    +D    F+F   + QVI 
Sbjct  224  DKKVIKKILKEGNGYERPNEGAVVKVKLIGKLQDGTVFFKKGQDDSELFEFKTDEEQVID  283

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSW  488
            G D+ + TMKKGE  + TI P+ A+G S S      +PPN+T+ +++EL+S+
Sbjct  284  GLDKAVTTMKKGELALLTIAPEYAFGSSESQQELAVVPPNSTVFYEIELVSF  335



>ref|XP_010244430.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Nelumbo nucifera]
Length=541

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 164/202 (81%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E+EIG QGL+K+++++G+ W TP PGDEVEVHY+G +  G  FDSSRDRGTPF+F LGQG
Sbjct  19   EREIGTQGLRKRIIQQGSSWLTPFPGDEVEVHYSGRVEGGLDFDSSRDRGTPFRFKLGQG  78

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD G+ TM+KGE  IFTIPP+LAYGE  SPP IPPN+TL FDVE+LSW SV+D+ 
Sbjct  79   EVIKGWDDGVATMRKGERAIFTIPPELAYGEMVSPPMIPPNSTLIFDVEMLSWSSVRDLS  138

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DEV VKYEARLEDGTL++KSD  +EF + +G+ CPA+ 
Sbjct  139  GDGGILKKIIKEGEGWSTPKDADEVLVKYEARLEDGTLISKSDDGIEFHLSDGYLCPAIA  198

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            KAVKTM+KGEK +L+V+  YG 
Sbjct  199  KAVKTMRKGEKAELSVRFSYGL  220


 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 105/204 (51%), Gaps = 10/204 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP+  DEV V Y   L DGT    S D     +F L  G +  
Sbjct  139  GDGGILKKIIKEGEGWSTPKDADEVLVKYEARLEDGTLISKSDD---GIEFHLSDGYLCP  195

Query  342  GWDQGIKTMKKGE----CCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
               + +KTM+KGE       F+   +   G + S  + PP + L   +EL+SW SV D+ 
Sbjct  196  AIAKAVKTMRKGEKAELSVRFSYGLEHGNGVTKSDCSFPPKSNLSVHLELVSWKSVIDVT  255

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV---AKSDIVEFTVEEGHFCPA  680
             D  + KKV+  GE ++ P +     V Y  +LEDGT+       +  E    EG     
Sbjct  256  DDKKVKKKVIKVGEGYDRPSEGSLAKVVYTGKLEDGTIFESKGSEEPFELMCFEGKIHEG  315

Query  681  LTKAVKTMKKGEKVQLTVKPQYGF  752
            L +A+ TMKKGEK  +T+ P YGF
Sbjct  316  LDRAITTMKKGEKALVTISPDYGF  339


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  GAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKG  377
            G G++ P  G   +V YTG L DGT F+S +    PF+    +G++ +G D+ I TMKKG
Sbjct  268  GEGYDRPSEGSLAKVVYTGKLEDGTIFES-KGSEEPFELMCFEGKIHEGLDRAITTMKKG  326

Query  378  ECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            E  + TI PD  +  + S    P +ATL ++VEL+S+   K
Sbjct  327  EKALVTISPDYGFDNAVSKD-FPKSATLLYEVELISFTKEK  366



>ref|XP_006647293.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Oryza 
brachyantha]
Length=558

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  261  LDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT  440
            +DGTKFDSSRDR  PFKFTLGQGQVIKGWD GIKTMKKGE  IFTIPP+LAYGE GSPP 
Sbjct  1    MDGTKFDSSRDRDAPFKFTLGQGQVIKGWDLGIKTMKKGENAIFTIPPELAYGEDGSPPV  60

Query  441  IPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGT  620
            IPPNATLQFDVEL+SW SVKDICKDGGIFKK+L EG KWENP D DEV VKYE RLEDGT
Sbjct  61   IPPNATLQFDVELISWESVKDICKDGGIFKKILTEGTKWENPGDRDEVFVKYEVRLEDGT  120

Query  621  LVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ++A+SD VEFTV++GHFCPA++KAVK+MKK EK  LTVKPQYGFG+
Sbjct  121  VIAESDGVEFTVKDGHFCPAISKAVKSMKKNEKALLTVKPQYGFGD  166


 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 110/207 (53%), Gaps = 14/207 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ EG  WE P   DEV V Y   L DGT    S       +FT+  G     
Sbjct  85   DGGIFKKILTEGTKWENPGDRDEVFVKYEVRLEDGTVIAES----DGVEFTVKDGHFCPA  140

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +K+MKK E  + T+ P   +G+ G P T     +PPNATL  ++EL+SW +V +I 
Sbjct  141  ISKAVKSMKKNEKALLTVKPQYGFGDEGRPATRDEAAVPPNATLHINLELVSWKAVTEIG  200

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGHFC  674
             +  I KK+L EGE +E P +   V VK   +LEDGT+         + +EF  +E    
Sbjct  201  NEKKILKKILHEGEGYERPNECTIVRVKLIGKLEDGTIFVTRGHDGEEPLEFKTDEDQVI  260

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L KAV +MKKGE   +T+ P+Y FG
Sbjct  261  EGLDKAVLSMKKGEVSLVTIPPEYAFG  287


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            +L+L     V ++G EK+I      KK++ EG G+E P     V V   G L DGT F +
Sbjct  187  NLELVSWKAVTEIGNEKKI-----LKKILHEGEGYERPNECTIVRVKLIGKLEDGTIFVT  241

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP---TIPPN  452
               D   P +F   + QVI+G D+ + +MKKGE  + TIPP+ A+G   +      IPPN
Sbjct  242  RGHDGEEPLEFKTDEDQVIEGLDKAVLSMKKGEVSLVTIPPEYAFGSDETKQDLFVIPPN  301

Query  453  ATLQFDVELLSW  488
            +T+ ++VEL+S+
Sbjct  302  STVYYEVELVSF  313



>ref|XP_006380967.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
 gb|ERP58764.1| hypothetical protein POPTR_0006s03190g [Populus trichocarpa]
Length=535

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 161/202 (80%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            EK+IG QGL+KK+VK+G  W+TP PGDEVEVH+ G +  G   +SSRD+G PFKF LGQG
Sbjct  23   EKKIGSQGLRKKIVKKGNSWQTPFPGDEVEVHFNGYIEGGASLESSRDKGVPFKFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+G+ TMK GE  IFT+PP+LAYGE+GSPP IPPNATL FDVE+LSW S++D+ 
Sbjct  83   EVIKGWDEGVATMKNGERAIFTVPPNLAYGEAGSPPLIPPNATLVFDVEMLSWSSIRDLT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  P+D DEV VKYEAR+E G LV+KS+  VEF V +G+ CPA++
Sbjct  143  GDGGILKKLMKEGEGWATPRDGDEVLVKYEARIETGMLVSKSEEGVEFHVGDGYLCPAVS  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            +AVKTM+KGEK +L V   YGF
Sbjct  203  RAVKTMRKGEKAELAVNLSYGF  224


 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 102/208 (49%), Gaps = 12/208 (6%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KKL+KEG GW TP  GDEV V Y   +  G     S +     +F +G G +  
Sbjct  143  GDGGILKKLMKEGEGWATPRDGDEVLVKYEARIETGMLVSKSEE---GVEFHVGDGYLCP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS-----PPTIPPNATLQFDVELLSWVSVKDI  506
               + +KTM+KGE     +     + + G+        IPP + L   +EL+SW S+ D+
Sbjct  200  AVSRAVKTMRKGEKAELAVNLSYGFIQKGNLAPDIESNIPPYSNLTIQLELVSWRSITDV  259

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFC  674
              D  + KK++  GE ++ P +   V V Y  +LEDGT+  +        EF   E    
Sbjct  260  TGDKKVLKKIVKAGEGFDRPTEGSHVKVTYVGKLEDGTVFDRKGTNGEPFEFITLEEQVN  319

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFGE  758
              L +A+ TMKKGE   +TV  +Y  G 
Sbjct  320  EGLDRAIMTMKKGEHATVTVDAKYLHGH  347


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 65/117 (56%), Gaps = 1/117 (1%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KK+VK G G++ P  G  V+V Y G L DGT FD     G PF+F   + QV +
Sbjct  261  GDKKVLKKIVKAGEGFDRPTEGSHVKVTYVGKLEDGTVFDRKGTNGEPFEFITLEEQVNE  320

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  512
            G D+ I TMKKGE    T+     +G   S   +P N+ L ++VELL ++  K   K
Sbjct  321  GLDRAIMTMKKGEHATVTVDAKYLHGHDIS-GMLPANSMLHYEVELLDFIKEKPFWK  376



>ref|XP_011040721.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Populus 
euphratica]
Length=535

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 162/202 (80%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            EK+IG +GL+KK+VK+G  W+TP PGDEVEVH+ G +  G   +SSRD+G PFKF LGQG
Sbjct  23   EKKIGIEGLRKKIVKKGNSWQTPFPGDEVEVHFNGYIEGGAILESSRDKGIPFKFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+G+ TMK GE  IFT+PP+LAYGE+GSPP IPPNATL FDVE+LSW S++D+ 
Sbjct  83   EVIKGWDEGVATMKNGERAIFTVPPNLAYGEAGSPPLIPPNATLVFDVEMLSWSSIRDLT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  P+D DEV VKYEAR+E G LV+KS+  VEF V +G+ CPAL+
Sbjct  143  GDGGILKKIMKEGEGWATPRDGDEVLVKYEARIETGMLVSKSEEGVEFHVGDGYLCPALS  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            +AVKTM+KGEK +L VK  YGF
Sbjct  203  RAVKTMRKGEKAELAVKLYYGF  224


 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 102/208 (49%), Gaps = 12/208 (6%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP  GDEV V Y   +  G     S +     +F +G G +  
Sbjct  143  GDGGILKKIMKEGEGWATPRDGDEVLVKYEARIETGMLVSKSEE---GVEFHVGDGYLCP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS-----PPTIPPNATLQFDVELLSWVSVKDI  506
               + +KTM+KGE     +     + + G+        IPP + L   +EL+SW SV D+
Sbjct  200  ALSRAVKTMRKGEKAELAVKLYYGFIQKGNLAPDIESNIPPYSNLTIQLELVSWRSVTDV  259

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFC  674
              D  + KK++  GE ++ P +   V V Y  +LEDGT+  +        EF   E    
Sbjct  260  TGDKKVLKKIVKAGEGFDRPTEGSHVKVTYVGKLEDGTVFDRKGTNGEPCEFVTLEEQVN  319

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFGE  758
              L +A+ TMKKGE   +TV  +Y  G 
Sbjct  320  EGLDRAIMTMKKGEHATVTVDAKYLHGH  347


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KK+VK G G++ P  G  V+V Y G L DGT FD     G P +F   + QV +
Sbjct  261  GDKKVLKKIVKAGEGFDRPTEGSHVKVTYVGKLEDGTVFDRKGTNGEPCEFVTLEEQVNE  320

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            G D+ I TMKKGE    T+     +G   S   +P N+ L ++VELL ++  K
Sbjct  321  GLDRAIMTMKKGEHATVTVDAKYLHGHDIS-GMLPANSRLHYEVELLDFIKEK  372



>gb|KEH19113.1| peptidyl-prolyl cis-trans isomerase, FKBP-type protein [Medicago 
truncatula]
Length=594

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = +3

Query  216  PEPGDEVEVHYTGTLL-DGTKFDSSRDRGTP-FKFTLGQGQVIKGWDQGIKTMKKGECCI  389
            P   DEV VH+TGTLL DG KFDSS DRGT  F FTLG+GQVIKGW +G++TM+KGE  +
Sbjct  185  PNLDDEVHVHFTGTLLLDGKKFDSSSDRGTSTFSFTLGRGQVIKGWGEGMRTMRKGEKAL  244

Query  390  FTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC---KDGGIFKKVLAEGEKWE  560
            FTIPP+LAYG+SG PP IPPNATLQ+DVELLS  S KDIC    DGG+FK++L EGEKWE
Sbjct  245  FTIPPELAYGKSGLPPNIPPNATLQYDVELLSSTSSKDICDICMDGGLFKEILDEGEKWE  304

Query  561  NPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKP  740
            NPKD DEV VKYEA L+DGTLVAKSD VEFTV+EG FC AL+KAVKTMKKGE V LTVKP
Sbjct  305  NPKDLDEVLVKYEAHLDDGTLVAKSDGVEFTVKEGFFCLALSKAVKTMKKGENVALTVKP  364

Query  741  QYGFG  755
            QYGFG
Sbjct  365  QYGFG  369


 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 123/234 (53%), Gaps = 14/234 (6%)
 Frame = +3

Query  84   MPPAEMDDLDLPDDNPVMKVGEEKEIGDQ----GLKKKLVKEGAGWETPEPGDEVEVHYT  251
            +PP    +  L  D  ++     K+I D     GL K+++ EG  WE P+  DEV V Y 
Sbjct  258  LPPNIPPNATLQYDVELLSSTSSKDICDICMDGGLFKEILDEGEKWENPKDLDEVLVKYE  317

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              L DGT    S       +FT+ +G       + +KTMKKGE    T+ P   +G  G 
Sbjct  318  AHLDDGTLVAKSDG----VEFTVKEGFFCLALSKAVKTMKKGENVALTVKPQYGFGVKGK  373

Query  432  PP-----TIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
            P       +PPNATL+ ++EL+SW +V ++  D  + KK+L EGE ++ PKD   V +K 
Sbjct  374  PAHGDEIAVPPNATLKINLELVSWKTVFEVTDDKKVIKKILKEGEGYKCPKDGAAVKLKL  433

Query  597  EARLEDGTL-VAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
              +L+D T+ + K    EFT +E      L KAV TMKKGE   LT+ P+Y FG
Sbjct  434  IGKLQDDTVFLKKGHGDEFTTDEEQVIDGLDKAVMTMKKGEVALLTIAPEYAFG  487


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 82/145 (57%), Gaps = 15/145 (10%)
 Frame = +3

Query  90   PAEMDDLDLPDDNPVMKVGEE--------KEIGDQGLKKKLVKEGAGWETPEPGDEVEVH  245
            PA  D++ +P  N  +K+  E        +   D+ + KK++KEG G++ P+ G  V++ 
Sbjct  374  PAHGDEIAVPP-NATLKINLELVSWKTVFEVTDDKKVIKKILKEGEGYKCPKDGAAVKLK  432

Query  246  YTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES  425
              G L D T F     +G   +FT  + QVI G D+ + TMKKGE  + TI P+ A+G S
Sbjct  433  LIGKLQDDTVF---LKKGHGDEFTTDEEQVIDGLDKAVMTMKKGEVALLTIAPEYAFGSS  489

Query  426  GSP---PTIPPNATLQFDVELLSWV  491
             S      +PPN+TL ++VEL+S++
Sbjct  490  ESQQELAVVPPNSTLYYEVELVSFI  514



>ref|XP_002982601.1| hypothetical protein SELMODRAFT_445274 [Selaginella moellendorffii]
 gb|EFJ16354.1| hypothetical protein SELMODRAFT_445274 [Selaginella moellendorffii]
Length=569

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 159/213 (75%), Gaps = 2/213 (1%)
 Frame = +3

Query  126  NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP  305
            + + K G EKE G  GLKK LV+ G GW+ P+PGDE+ VHY G   DGTKFDS+ D+  P
Sbjct  39   SAMQKEGVEKEFGQSGLKKLLVRAGQGWDVPKPGDELTVHYVGRFADGTKFDSTHDKNQP  98

Query  306  FKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLS  485
            F F LGQG+VI+GWD+GI +MKK E  +FTIPPD+AYG++G PP +PPNATL F+VELL+
Sbjct  99   FVFRLGQGEVIRGWDRGIGSMKKKEVAVFTIPPDMAYGKAGCPPLVPPNATLVFEVELLT  158

Query  486  WVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTV--E  659
            W S+ D+ KDGGI KKV++EG KWE PKD DEV+V++ A L+DGTLV K+     T+   
Sbjct  159  WASITDVLKDGGIVKKVVSEGHKWETPKDSDEVTVRFTATLQDGTLVEKTPAKGVTICPR  218

Query  660  EGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +G FCPA+ KAV+ MK GE+  LTV PQYGF E
Sbjct  219  DGFFCPAIGKAVRAMKHGEQALLTVTPQYGFAE  251


 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 111/209 (53%), Gaps = 12/209 (6%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            + D G+ KK+V EG  WETP+  DEV V +T TL DGT  + +  +G         G   
Sbjct  166  LKDGGIVKKVVSEGHKWETPKDSDEVTVRFTATLQDGTLVEKTPAKGVTI--CPRDGFFC  223

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKD  503
                + ++ MK GE  + T+ P   + E G   T     +PP ATL  D+ELL W +V D
Sbjct  224  PAIGKAVRAMKHGEQALLTVTPQYGFAEQGRKATRSGAYVPPYATLTVDIELLEWRTVDD  283

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGH  668
            +  D  + KK+L  GE    P D   V VKYEARL DGT+  +      D++EFT+ E  
Sbjct  284  VTDDRRVVKKILVAGEGQTKPNDGALVRVKYEARLLDGTVFERKGYGQDDLLEFTIGEEQ  343

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L +AV  MKKGE  ++T+ P YG+G
Sbjct  344  AVSGLDRAVAAMKKGEVAEVTIAPDYGYG  372


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIK  341
            D+ + KK++  G G   P  G  V V Y   LLDGT F+     +    +FT+G+ Q + 
Sbjct  287  DRRVVKKILVAGEGQTKPNDGALVRVKYEARLLDGTVFERKGYGQDDLLEFTIGEEQAVS  346

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKDI  506
            G D+ +  MKKGE    TI PD  YG S       T+PP++TL + VEL+S+   KDI
Sbjct  347  GLDRAVAAMKKGEVAEVTIAPDYGYGGSEFRTDLATVPPSSTLVYIVELVSFDKDKDI  404



>ref|XP_002993334.1| hypothetical protein SELMODRAFT_449100 [Selaginella moellendorffii]
 gb|EFJ05596.1| hypothetical protein SELMODRAFT_449100 [Selaginella moellendorffii]
Length=569

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 159/213 (75%), Gaps = 2/213 (1%)
 Frame = +3

Query  126  NPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTP  305
            + + K G EKE G  GLKK LV+ G GW+ P+PGDE+ VHY G   DGTKFDS+ D+  P
Sbjct  39   SAMQKEGVEKEFGQSGLKKLLVRAGQGWDVPKPGDELTVHYVGRFADGTKFDSTHDKNQP  98

Query  306  FKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLS  485
            F F LGQG+VI+GWD+GI +MKK E  +FTIPPD+AYG++G PP +PPNATL F+VELL+
Sbjct  99   FVFRLGQGEVIRGWDRGIGSMKKKEVAVFTIPPDMAYGKAGCPPLVPPNATLVFEVELLT  158

Query  486  WVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTV--E  659
            W S+ D+ KDGGI KKV++EG KWE PKD DEV+V++ A L+DGTLV K+     T+   
Sbjct  159  WASITDVLKDGGIVKKVVSEGHKWETPKDSDEVTVRFTATLQDGTLVEKTPAKGVTICPR  218

Query  660  EGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            +G FCPA+ KAV+ MK GE+  LTV PQYGF E
Sbjct  219  DGFFCPAIGKAVRAMKHGEQALLTVTPQYGFAE  251


 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 111/209 (53%), Gaps = 12/209 (6%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            + D G+ KK+V EG  WETP+  DEV V +T TL DGT  + +  +G         G   
Sbjct  166  LKDGGIVKKVVSEGHKWETPKDSDEVTVRFTATLQDGTLVEKTPAKGVTI--CPRDGFFC  223

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKD  503
                + ++ MK GE  + T+ P   + E G   T     +PP ATL  D+ELL W +V D
Sbjct  224  PAIGKAVRAMKHGEQALLTVTPQYGFAEQGRKATRSGAYVPPYATLTVDIELLEWRTVDD  283

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-----DIVEFTVEEGH  668
            +  D  + KK+L  GE    P D   V VKYEARL DGT+  +      D++EFT+ E  
Sbjct  284  VTDDRRVVKKILVAGEGQTKPNDGALVRVKYEARLLDGTVFERKGYGQDDLLEFTIGEEQ  343

Query  669  FCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                L +AV  MKKGE  ++T+ P YG+G
Sbjct  344  AVSGLDRAVAAMKKGEVAEVTIAPDYGYG  372


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVIK  341
            D+ + KK++  G G   P  G  V V Y   LLDGT F+     +    +FT+G+ Q + 
Sbjct  287  DRRVVKKILVAGEGQTKPNDGALVRVKYEARLLDGTVFERKGYGQDDLLEFTIGEEQAVS  346

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVKDI  506
            G D+ +  MKKGE    TI PD  YG S       T+PP++TL + VEL+S+   KDI
Sbjct  347  GLDRAVAAMKKGEVAEVTIAPDYGYGGSEFRTDLATVPPSSTLVYIVELVSFDKDKDI  404



>emb|CDY15096.1| BnaC03g44570D [Brassica napus]
Length=705

 Score =   273 bits (698),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 175/233 (75%), Gaps = 26/233 (11%)
 Frame = +3

Query  72   EDFDMPPA----EMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVE  239
            +DF+MPP     + D++D  DD   +K GEEKEI  QGLKKKLVKEG G+ETPE GDEVE
Sbjct  21   KDFEMPPVGGMNDDDEMDFGDDASFLKPGEEKEI-QQGLKKKLVKEGEGFETPENGDEVE  79

Query  240  VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYG  419
            VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ IKGWD  IKTMKKGE  +FTIP +LAYG
Sbjct  80   VHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQAIKGWDISIKTMKKGENAVFTIPSELAYG  139

Query  420  ESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYE  599
            ESGSPPTIP NATLQFDVELLSW SVKDICKDGG                    +S++  
Sbjct  140  ESGSPPTIPANATLQFDVELLSWSSVKDICKDGGFL------------------LSMRLS  181

Query  600  ARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             R+     + ++ +V  ++++G+FCPAL+KAVKTMKK EKV LTVKPQYGFGE
Sbjct  182  LRM---VRLLENLMVLSSLKDGYFCPALSKAVKTMKKAEKVLLTVKPQYGFGE  231


 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 114/188 (61%), Gaps = 40/188 (21%)
 Frame = +3

Query  315  TLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVEL  479
            +L  G       + +KTMKK E  + T+ P   +GE G P       +PPNATL+ ++EL
Sbjct  196  SLKDGYFCPALSKAVKTMKKAEKVLLTVKPQYGFGEKGKPAFGGEGALPPNATLEIELEL  255

Query  480  -----------------------------------LSWVSVKDICKDGGIFKKVLAEGEK  554
                                               LSW SVKDICKDGG+FKK++A GEK
Sbjct  256  ISWKTVSEVTDGNKVIKKILKQGEGCERPNDGAELLSWSSVKDICKDGGVFKKIVAAGEK  315

Query  555  WENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTV  734
            WE PKD DEV VKYEA+LEDGT+V KSD VEFTV++G+FCPA  KAVKTMKK EK+ LTV
Sbjct  316  WEMPKDLDEVLVKYEAKLEDGTVVGKSDGVEFTVKDGYFCPAFAKAVKTMKKAEKILLTV  375

Query  735  KPQYGFGE  758
            KPQYGFGE
Sbjct  376  KPQYGFGE  383


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 68/127 (54%), Gaps = 9/127 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V  G  WE P+  DEV V Y   L DGT    S       +FT+  G     
Sbjct  302  DGGVFKKIVAAGEKWEMPKDLDEVLVKYEAKLEDGTVVGKSDG----VEFTVKDGYFCPA  357

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
            + + +KTMKK E  + T+ P   +GE G P +     +PPNATL+ ++ELLSW +V ++ 
Sbjct  358  FAKAVKTMKKAEKILLTVKPQYGFGEKGKPASGGETAVPPNATLEIELELLSWKTVPEVN  417

Query  510  KDGGIFK  530
             D  + K
Sbjct  418  DDNKVIK  424



>ref|XP_010273188.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X3 [Nelumbo 
nucifera]
Length=435

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 163/212 (77%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+EI   G+KKKL+K G GW+TPE GDEV VHY GTLLDGTKF+SSRDR  PF
Sbjct  30   PPLKVGEEREINSSGVKKKLLKRGQGWDTPEFGDEVTVHYVGTLLDGTKFNSSRDRDEPF  89

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
             F LG   ++ G DQGI TMKKGE  +FT+P +L YG  GS   +PPN+ +QF+VEL+SW
Sbjct  90   TFKLGHCPLVAGLDQGIITMKKGEVSLFTLPSNLGYGTKGS-DGVPPNSDIQFEVELISW  148

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTVEE  662
            ++V DICKDGGI KK+L +GE+ E P D DEV VKY+A L DGT+VAK+  +  E  V++
Sbjct  149  ITVVDICKDGGIIKKILEKGERIEQPGDLDEVMVKYQAMLIDGTIVAKTPEEGTELHVKD  208

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GHFCPAL KA+KTMK+GEKV+L V+ +Y FGE
Sbjct  209  GHFCPALEKAIKTMKRGEKVKLIVESKYAFGE  240


 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 110/207 (53%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++++G   E P   DEV V Y   L+DGT    + + GT  +  +  G     
Sbjct  157  DGGIIKKILEKGERIEQPGDLDEVMVKYQAMLIDGTIVAKTPEEGT--ELHVKDGHFCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  509
             ++ IKTMK+GE     +    A+GE+G       P IPPN+ L  D+ LLS+  V D+ 
Sbjct  215  LEKAIKTMKRGEKVKLIVESKYAFGENGRDASNGFPAIPPNSVLNIDLVLLSFKPVIDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  + KK+L EGE   +  D   V+++Y  +L+DGT+  +        +EF ++E    
Sbjct  275  GDTKVLKKILREGEGTVSANDGAAVTIRYTGKLQDGTIFERKGFDGVGPLEFVIDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +A  TMKKGE   +T+ P+YGFG
Sbjct  335  LGLDRAAATMKKGELCIVTINPEYGFG  361


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 11/145 (8%)
 Frame = +3

Query  84   MPPAEMDDLDLP--DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  257
            +PP  + ++DL      PV+ V      GD  + KK+++EG G  +   G  V + YTG 
Sbjct  252  IPPNSVLNIDLVLLSFKPVIDV-----TGDTKVLKKILREGEGTVSANDGAAVTIRYTGK  306

Query  258  LLDGTKFDSSRDRGT-PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES---  425
            L DGT F+     G  P +F + + QVI G D+   TMKKGE CI TI P+  +G +   
Sbjct  307  LQDGTIFERKGFDGVGPLEFVIDEEQVILGLDRAAATMKKGELCIVTINPEYGFGNNEIE  366

Query  426  GSPPTIPPNATLQFDVELLSWVSVK  500
                 IPP +T+ ++VE++ +   K
Sbjct  367  RDLAVIPPCSTVVYEVEMVDFTREK  391



>ref|XP_012068190.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Jatropha 
curcas]
 gb|KDP41599.1| hypothetical protein JCGZ_16006 [Jatropha curcas]
Length=601

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 161/212 (76%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+EI + G+KKKL+K G GWETPE  DEV VHY GTLLDGTKFDS+RDRG P 
Sbjct  30   PPLKVGEEREISNSGIKKKLLKRGLGWETPEFNDEVTVHYVGTLLDGTKFDSTRDRGEPM  89

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
               LGQG VI G D GI +MKKGEC +FT+P +L YG SGS   +PPN+ + F+VEL+SW
Sbjct  90   TLKLGQGDVIAGLDHGIISMKKGECALFTVPAELGYGVSGS-DNVPPNSVVLFEVELISW  148

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTVEE  662
            ++V D+ KDGGI KK++  G + E P D DEV VKYE  L DGT+V ++  + +EF +++
Sbjct  149  ITVVDVSKDGGIIKKIMKRGTRIERPGDMDEVHVKYEVTLADGTVVGQTPEEGIEFHLKD  208

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GH CPAL KA+ TM++GEKV+L V+PQYGFGE
Sbjct  209  GHLCPALPKALITMRRGEKVKLIVQPQYGFGE  240


 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 109/207 (53%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++K G   E P   DEV V Y  TL DGT    + + G   +F L  G +   
Sbjct  157  DGGIIKKIMKRGTRIERPGDMDEVHVKYEVTLADGTVVGQTPEEG--IEFHLKDGHLCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
              + + TM++GE     + P   +GE     +G   ++P N+ L  D+EL+S+  V D+ 
Sbjct  215  LPKALITMRRGEKVKLIVQPQYGFGEEGMDANGGIHSVPQNSILNMDLELVSFKPVVDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  + KK+L EGE      +   V+++Y ARL++GT+  K  +     ++F  +E    
Sbjct  275  GDAKVLKKILKEGEGTLVANEGAIVTIRYTARLQEGTVFEKKGLDGEHPLQFVTDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +A  TMKKGE+  LT+ P+YGFG
Sbjct  335  AGLDRAAATMKKGEQAVLTIHPEYGFG  361


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 68/133 (51%), Gaps = 9/133 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L    PV+ V      GD  + KK++KEG G      G  V + YT  L +GT F+ 
Sbjct  261  DLELVSFKPVVDV-----TGDAKVLKKILKEGEGTLVANEGAIVTIRYTARLQEGTVFEK  315

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE---SGSPPTIPPN  452
               D   P +F   + QVI G D+   TMKKGE  + TI P+  +G          +PP+
Sbjct  316  KGLDGEHPLQFVTDEEQVIAGLDRAAATMKKGEQAVLTIHPEYGFGSIEVKRDLAIVPPS  375

Query  453  ATLQFDVELLSWV  491
            + L ++VE+L ++
Sbjct  376  SVLVYEVEMLDFL  388



>ref|XP_010273182.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 163/212 (77%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+EI   G+KKKL+K G GW+TPE GDEV VHY GTLLDGTKF+SSRDR  PF
Sbjct  30   PPLKVGEEREINSSGVKKKLLKRGQGWDTPEFGDEVTVHYVGTLLDGTKFNSSRDRDEPF  89

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
             F LG   ++ G DQGI TMKKGE  +FT+P +L YG  GS   +PPN+ +QF+VEL+SW
Sbjct  90   TFKLGHCPLVAGLDQGIITMKKGEVSLFTLPSNLGYGTKGS-DGVPPNSDIQFEVELISW  148

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTVEE  662
            ++V DICKDGGI KK+L +GE+ E P D DEV VKY+A L DGT+VAK+  +  E  V++
Sbjct  149  ITVVDICKDGGIIKKILEKGERIEQPGDLDEVMVKYQAMLIDGTIVAKTPEEGTELHVKD  208

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GHFCPAL KA+KTMK+GEKV+L V+ +Y FGE
Sbjct  209  GHFCPALEKAIKTMKRGEKVKLIVESKYAFGE  240


 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 110/207 (53%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++++G   E P   DEV V Y   L+DGT    + + GT  +  +  G     
Sbjct  157  DGGIIKKILEKGERIEQPGDLDEVMVKYQAMLIDGTIVAKTPEEGT--ELHVKDGHFCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  509
             ++ IKTMK+GE     +    A+GE+G       P IPPN+ L  D+ LLS+  V D+ 
Sbjct  215  LEKAIKTMKRGEKVKLIVESKYAFGENGRDASNGFPAIPPNSVLNIDLVLLSFKPVIDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  + KK+L EGE   +  D   V+++Y  +L+DGT+  +        +EF ++E    
Sbjct  275  GDTKVLKKILREGEGTVSANDGAAVTIRYTGKLQDGTIFERKGFDGVGPLEFVIDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +A  TMKKGE   +T+ P+YGFG
Sbjct  335  LGLDRAAATMKKGELCIVTINPEYGFG  361


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 77/145 (53%), Gaps = 11/145 (8%)
 Frame = +3

Query  84   MPPAEMDDLDLP--DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGT  257
            +PP  + ++DL      PV+ V      GD  + KK+++EG G  +   G  V + YTG 
Sbjct  252  IPPNSVLNIDLVLLSFKPVIDV-----TGDTKVLKKILREGEGTVSANDGAAVTIRYTGK  306

Query  258  LLDGTKFDSSRDRGT-PFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGES---  425
            L DGT F+     G  P +F + + QVI G D+   TMKKGE CI TI P+  +G +   
Sbjct  307  LQDGTIFERKGFDGVGPLEFVIDEEQVILGLDRAAATMKKGELCIVTINPEYGFGNNEIE  366

Query  426  GSPPTIPPNATLQFDVELLSWVSVK  500
                 IPP +T+ ++VE++ +   K
Sbjct  367  RDLAVIPPCSTVVYEVEMVDFTREK  391



>gb|KJB42565.1| hypothetical protein B456_007G157600 [Gossypium raimondii]
Length=478

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  327  GQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  506
            GQVIKGWD+GIKTMKKGE  IFTIPP+LAYGESGSPPTIPPNATLQFDVELLSW SVKDI
Sbjct  4    GQVIKGWDEGIKTMKKGENAIFTIPPELAYGESGSPPTIPPNATLQFDVELLSWTSVKDI  63

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALT  686
            CKDGG+FKK+L  GEKWENPKDPDEV V YEA+LEDGT+VAK+D  EFTV EGHFCPAL 
Sbjct  64   CKDGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGKEFTVMEGHFCPALA  123

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
            KAVKTMKKGEKV LTVKPQYGFGE
Sbjct  124  KAVKTMKKGEKVLLTVKPQYGFGE  147


 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 114/208 (55%), Gaps = 15/208 (7%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D GL KK++  G  WE P+  DEV V+Y   L DGT    +  +    +FT+ +G     
Sbjct  66   DGGLFKKILTGGEKWENPKDPDEVLVNYEAKLEDGTVVAKADGK----EFTVMEGHFCPA  121

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              + +KTMKKGE  + T+ P   +GE G P       +PPNATLQ  +EL+SW +V ++ 
Sbjct  122  LAKAVKTMKKGEKVLLTVKPQYGFGEKGKPAAGAEGAVPPNATLQITLELVSWKTVSEVT  181

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAK------SDIVEFTVEEGHF  671
             D  + KK+L EGE +E P +   V VK   +L+DGT+  K       ++ EF  +E   
Sbjct  182  DDKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQV  241

Query  672  CPALTKAVKTMKKGEKVQLTVKPQYGFG  755
               L KAV TMKKGE   LT+ P+Y FG
Sbjct  242  IDGLDKAVMTMKKGEVALLTIAPEYAFG  269


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 5/118 (4%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKF-DSSRDRGTP-FKFTLGQGQVI  338
            D+ + KK++KEG G+E P  G  V V   G L DGT F    +D G   F+F   + QVI
Sbjct  183  DKKVMKKILKEGEGYERPNEGAVVRVKLVGKLQDGTVFLKKGQDEGQELFEFRTDEEQVI  242

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVKD  503
             G D+ + TMKKGE  + TI P+ A+G SGS     ++PPN+T+ ++VE++S++  K+
Sbjct  243  DGLDKAVMTMKKGEVALLTIAPEYAFGSSGSKQELASVPPNSTVYYEVEMVSFIKDKE  300



>ref|XP_011074339.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Sesamum 
indicum]
Length=598

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 158/212 (75%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+EIG  GLKKKL+K G  WETP+ GDEV VHY G+L DG+ F S+R    PF
Sbjct  29   PPLKVGEEREIGSNGLKKKLMKRGLNWETPQFGDEVTVHYVGSLSDGSIFISTRASNEPF  88

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
               LG+G ++ G D GI TM++GE  +FT+PP+LAYG SG    IPPNA +Q +VELLSW
Sbjct  89   TLKLGRGDIVIGLDHGIVTMRRGEVALFTLPPELAYGASGR-AGIPPNAVVQLEVELLSW  147

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVA--KSDIVEFTVEE  662
            ++V D+CKDGGI KK+L  GE+   P D DEV V Y+A L DGT+VA  + + VEF +++
Sbjct  148  ITVVDVCKDGGIIKKILENGEQIGPPGDLDEVRVNYKAMLVDGTIVADTRDEGVEFYIKD  207

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GHFCPAL KA+KTMKKGE+V L V+PQYGFGE
Sbjct  208  GHFCPALVKAIKTMKKGERVNLVVQPQYGFGE  239


 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 108/206 (52%), Gaps = 11/206 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+++ G     P   DEV V+Y   L+DGT    +RD G   +F +  G     
Sbjct  156  DGGIIKKILENGEQIGPPGDLDEVRVNYKAMLVDGTIVADTRDEGV--EFYIKDGHFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP----PTIPPNATLQFDVELLSWVSVKDICK  512
              + IKTMKKGE     + P   +GE G      P+IPP +TL    ELLS+  V DI  
Sbjct  214  LVKAIKTMKKGERVNLVVQPQYGFGEVGKKSNELPSIPPKSTLSISAELLSFKRVIDITG  273

Query  513  DGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFCP  677
            D  + KKVL EGE      +   V+V+Y+A LEDGT+  +  I     +EF  +E     
Sbjct  274  DLKVKKKVLREGEGTVTANEGAAVTVRYKAMLEDGTVFERKGIDGEQPLEFITDEEQTIV  333

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AV TMKK E   +T+ P+YGFG
Sbjct  334  GLDRAVSTMKKNEYALVTISPEYGFG  359


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG-TPFKFTLGQGQVI  338
            GD  +KKK+++EG G  T   G  V V Y   L DGT F+     G  P +F   + Q I
Sbjct  273  GDLKVKKKVLREGEGTVTANEGAAVTVRYKAMLEDGTVFERKGIDGEQPLEFITDEEQTI  332

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVK  500
             G D+ + TMKK E  + TI P+  +G +        +PP++T+ ++VE+L +V  K
Sbjct  333  VGLDRAVSTMKKNEYALVTISPEYGFGSTEVKQDLAVVPPSSTILYEVEMLDFVREK  389



>ref|XP_011074340.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Sesamum 
indicum]
Length=595

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 158/212 (75%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+EIG  GLKKKL+K G  WETP+ GDEV VHY G+L DG+ F S+R    PF
Sbjct  29   PPLKVGEEREIGSNGLKKKLMKRGLNWETPQFGDEVTVHYVGSLSDGSIFISTRASNEPF  88

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
               LG+G ++ G D GI TM++GE  +FT+PP+LAYG SG    IPPNA +Q +VELLSW
Sbjct  89   TLKLGRGDIVIGLDHGIVTMRRGEVALFTLPPELAYGASGR-AGIPPNAVVQLEVELLSW  147

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVA--KSDIVEFTVEE  662
            ++V D+CKDGGI KK+L  GE+   P D DEV V Y+A L DGT+VA  + + VEF +++
Sbjct  148  ITVVDVCKDGGIIKKILENGEQIGPPGDLDEVRVNYKAMLVDGTIVADTRDEGVEFYIKD  207

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GHFCPAL KA+KTMKKGE+V L V+PQYGFGE
Sbjct  208  GHFCPALVKAIKTMKKGERVNLVVQPQYGFGE  239


 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 108/206 (52%), Gaps = 11/206 (5%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+++ G     P   DEV V+Y   L+DGT    +RD G   +F +  G     
Sbjct  156  DGGIIKKILENGEQIGPPGDLDEVRVNYKAMLVDGTIVADTRDEGV--EFYIKDGHFCPA  213

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP----PTIPPNATLQFDVELLSWVSVKDICK  512
              + IKTMKKGE     + P   +GE G      P+IPP +TL    ELLS+  V DI  
Sbjct  214  LVKAIKTMKKGERVNLVVQPQYGFGEVGKKSNELPSIPPKSTLSISAELLSFKRVIDITG  273

Query  513  DGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFCP  677
            D  + KKVL EGE      +   V+V+Y+A LEDGT+  +  I     +EF  +E     
Sbjct  274  DLKVKKKVLREGEGTVTANEGAAVTVRYKAMLEDGTVFERKGIDGEQPLEFITDEEQTIV  333

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFG  755
             L +AV TMKK E   +T+ P+YGFG
Sbjct  334  GLDRAVSTMKKNEYALVTISPEYGFG  359


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG-TPFKFTLGQGQVI  338
            GD  +KKK+++EG G  T   G  V V Y   L DGT F+     G  P +F   + Q I
Sbjct  273  GDLKVKKKVLREGEGTVTANEGAAVTVRYKAMLEDGTVFERKGIDGEQPLEFITDEEQTI  332

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGES---GSPPTIPPNATLQFDVELLSWVSVK  500
             G D+ + TMKK E  + TI P+  +G +        +PP++T+ ++VE+L +V  K
Sbjct  333  VGLDRAVSTMKKNEYALVTISPEYGFGSTEVKQDLAVVPPSSTILYEVEMLDFVREK  389



>ref|XP_006482027.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Citrus 
sinensis]
Length=535

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = +3

Query  141  VGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTL  320
            +  E+EIG QGL+K+++++G  W+TP  GDEV+VH++G +  G    SSRD GTPF F L
Sbjct  20   ISVEREIGKQGLRKQILRKGTSWQTPLLGDEVQVHFSGHIDGGACLASSRDTGTPFCFKL  79

Query  321  GQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            GQG+VIKGWD+G+ TMKKGE  IF IP  LAYGE+GSPP IP N++L FD+ELLSW +++
Sbjct  80   GQGEVIKGWDEGVATMKKGERAIFFIPSVLAYGEAGSPPLIPSNSSLVFDIELLSWSAIR  139

Query  501  DICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCP  677
            DI  DGGI KK++ EGE W  P+D DEV VKYEARL++G LV++S+  VEF V +GH CP
Sbjct  140  DITGDGGILKKIIKEGEGWATPRDNDEVLVKYEARLQNGALVSESNEGVEFRVFDGHLCP  199

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGF  752
            A++KAVKTM++GEK +L VK  YG 
Sbjct  200  AISKAVKTMRRGEKAELAVKFSYGI  224


 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 99/204 (49%), Gaps = 12/204 (6%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP   DEV V Y   L +G    S  + G  F+  +  G +  
Sbjct  143  GDGGILKKIIKEGEGWATPRDNDEVLVKYEARLQNGA-LVSESNEGVEFR--VFDGHLCP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  506
               + +KTM++GE     +         G   T     +   + L   +ELLSW SV D+
Sbjct  200  AISKAVKTMRRGEKAELAVKFSYGIENDGYEATNIEGGVSSFSNLTIQLELLSWKSVVDV  259

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEGHFC  674
              D  + KK+   G+ ++ P +   V V Y  RLEDGT+     +  +  EFT  E +  
Sbjct  260  TGDQKVLKKIKKAGQGFDRPNEGSLVKVIYIGRLEDGTVFETRGSNEEPFEFTTLEENVN  319

Query  675  PALTKAVKTMKKGEKVQLTVKPQY  746
              L +A+ TMKK E+  +T+  +Y
Sbjct  320  EGLERAIMTMKKEEQATVTISAEY  343


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GDQ + KK+ K G G++ P  G  V+V Y G L DGT F++      PF+FT  +  V +
Sbjct  261  GDQKVLKKIKKAGQGFDRPNEGSLVKVIYIGRLEDGTVFETRGSNEEPFEFTTLEENVNE  320

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            G ++ I TMKK E    TI  +       S   +  ++ L ++V L+ +   K
Sbjct  321  GLERAIMTMKKEEQATVTISAEYLCSHEVS-ELVSADSVLHYEVTLIDFTKEK  372



>gb|KDP24694.1| hypothetical protein JCGZ_26469 [Jatropha curcas]
Length=476

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            EK+IG+ GL+KK++K+G  W+TP PGDEVEVH++G +  G   DS+RD+G PF F LGQG
Sbjct  24   EKKIGNDGLRKKILKKGISWQTPFPGDEVEVHFSGHVEGGASLDSTRDKGVPFCFKLGQG  83

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKG D GI TMKKGE   FT+PP L YGE+GSPP IP NATL FD+E+LSW +++D+ 
Sbjct  84   EVIKGLDDGIATMKKGERATFTVPPKLGYGEAGSPPLIPSNATLVFDIEMLSWSTIRDLT  143

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  P+D D+V VKYEARLE+G LV+KSD   EF V E +  PAL 
Sbjct  144  GDGGILKKIIKEGEGWATPRDGDKVLVKYEARLENGLLVSKSDQDAEFHVGESYLSPALG  203

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            KAVKTM++GEK +L VK  YGF
Sbjct  204  KAVKTMRRGEKAELAVKCSYGF  225


 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 105/207 (51%), Gaps = 11/207 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP  GD+V V Y   L +G     S       +F +G+  +  
Sbjct  144  GDGGILKKIIKEGEGWATPRDGDKVLVKYEARLENGLLVSKSDQDA---EFHVGESYLSP  200

Query  342  GWDQGIKTMKKGECCIFTIPPDLAY----GESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
               + +KTM++GE     +     +     E+G  P+I  ++ L   +EL+SW SV DI 
Sbjct  201  ALGKAVKTMRRGEKAELAVKCSYGFIQNGNEAGIDPSILSDSNLTIQLELVSWRSVIDIT  260

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIV----EFTVEEGHFCP  677
             D  + K ++  GE +E P +  +V V Y  +LEDG +V K   +    EF   EG    
Sbjct  261  GDKKVLKTIVKAGEGFERPNEGSQVKVTYIGKLEDGVVVEKKGTIEEPFEFKTLEGQVNE  320

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             L +AV +MK+GE   +TV  +Y  G 
Sbjct  321  GLDRAVMSMKRGEDALVTVSAEYLSGH  347


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 5/112 (4%)
 Frame = +3

Query  435  PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLED  614
             +I P+   +  +   +  + K I  DG + KK+L +G  W+ P   DEV V +   +E 
Sbjct  4    ASIKPSIETEIQIRKSTTFAEKKIGNDG-LRKKILKKGISWQTPFPGDEVEVHFSGHVEG  62

Query  615  G-TLVAKSDI---VEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            G +L +  D      F + +G     L   + TMKKGE+   TV P+ G+GE
Sbjct  63   GASLDSTRDKGVPFCFKLGQGEVIKGLDDGIATMKKGERATFTVPPKLGYGE  114



>ref|XP_010061642.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Eucalyptus 
grandis]
 gb|KCW68629.1| hypothetical protein EUGRSUZ_F02235 [Eucalyptus grandis]
Length=608

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 157/215 (73%), Gaps = 3/215 (1%)
 Frame = +3

Query  120  DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRG  299
            D  P MKVGEE+ +G  GL KKL++ G GWETPE GDE  VH+  TL DGT FDSSRDR 
Sbjct  27   DSAPPMKVGEERPLGRTGLAKKLLRHGRGWETPELGDEAAVHFVATLTDGTLFDSSRDRD  86

Query  300  TPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVEL  479
             P    LGQGQ++ G D GI TMK+GEC +FT+PP+L YG  G    +PPNA ++F+VEL
Sbjct  87   EPLTLKLGQGQLVSGLDHGIITMKEGECALFTVPPELGYGAVGR-EGVPPNAAVRFEVEL  145

Query  480  LSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFT  653
            +SW+ V DICKDGGI KK+L +GE+ E P D DEV VKY   L DGT++A++  +  EF 
Sbjct  146  ISWIRVVDICKDGGIVKKILVKGERNEQPSDLDEVLVKYRVALPDGTIIAEAPEEGFEFY  205

Query  654  VEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            V++GH CPA +KAV TMKKGE+V+L ++PQY FG+
Sbjct  206  VKDGHLCPAFSKAVMTMKKGERVKLLIQPQYAFGD  240


 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 107/207 (52%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++ +G   E P   DEV V Y   L DGT    + + G  F+F +  G +   
Sbjct  157  DGGIVKKILVKGERNEQPSDLDEVLVKYRVALPDGTIIAEAPEEG--FEFYVKDGHLCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGE-----SGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            + + + TMKKGE     I P  A+G+     S     +PPN+ L  D+EL+S+  V D+ 
Sbjct  215  FSKAVMTMKKGERVKLLIQPQYAFGDKKFGNSDQLHNVPPNSILDVDLELVSFKPVIDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             DG + KK+L EGE      +   V++ Y ARLEDGT+  K  +     + F  +E    
Sbjct  275  GDGKVLKKILKEGEGAFTANEGAAVTISYAARLEDGTVFEKKGLDGEQPLNFVTDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +A  TMKKGE   +T+  +YGFG
Sbjct  335  AGLDRASATMKKGELAMVTINHEYGFG  361


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 70/143 (49%), Gaps = 11/143 (8%)
 Frame = +3

Query  81   DMPPAEMDDLDLP--DDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTG  254
            ++PP  + D+DL      PV+ V      GD  + KK++KEG G  T   G  V + Y  
Sbjct  251  NVPPNSILDVDLELVSFKPVIDV-----TGDGKVLKKILKEGEGAFTANEGAAVTISYAA  305

Query  255  TLLDGTKFDSS-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGE---  422
             L DGT F+    D   P  F   + QVI G D+   TMKKGE  + TI  +  +G    
Sbjct  306  RLEDGTVFEKKGLDGEQPLNFVTDEEQVIAGLDRASATMKKGELAMVTINHEYGFGSVEV  365

Query  423  SGSPPTIPPNATLQFDVELLSWV  491
                  +PP + L ++VE+L ++
Sbjct  366  EQDLAIVPPCSDLIYEVEMLDFI  388



>ref|XP_011079092.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Sesamum 
indicum]
Length=531

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 156/202 (77%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL+KK+V++G  W+TP  GDEVEVHY   L +G  FDS+R++G PF+F LGQ 
Sbjct  26   ETVIGTRGLRKKIVRKGISWQTPVSGDEVEVHYNVKLQEGEYFDSTREKGAPFRFKLGQC  85

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VI+GWD+GI TM+KGE  +FTIPP+LAYG++GSPP IPPNATL FD+EL+SW  V+DIC
Sbjct  86   EVIEGWDEGIATMRKGERAVFTIPPELAYGKTGSPPIIPPNATLIFDIELISWCPVRDIC  145

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK+  EGE W  P D DEV VKY A+ E+G +++KS+  +EF++  GH CPA++
Sbjct  146  GDGGILKKITREGEGWATPNDADEVLVKYIAKNENGVVISKSEEGLEFSLTNGHLCPAMS  205

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            +AVKTM+KGEK +L VK  YG 
Sbjct  206  RAVKTMRKGEKAELCVKFSYGL  227


 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 98/200 (49%), Gaps = 10/200 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK+ +EG GW TP   DEV V Y     +G     S +     +F+L  G +  
Sbjct  146  GDGGILKKITREGEGWATPNDADEVLVKYIAKNENGVVISKSEE---GLEFSLTNGHLCP  202

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI-PPNATLQFDVELLSWVSVKDICKDG  518
               + +KTM+KGE     +    +YG       I PP   L   +EL+SW +V D+  D 
Sbjct  203  AMSRAVKTMRKGEKAELCV--KFSYGLRHCGDGIFPPYPDLIIHLELVSWKTVVDVRGDN  260

Query  519  GIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALT  686
             I KK++ +GE ++ P +     V Y  +LEDGT+  +     +  E+   E      L 
Sbjct  261  KILKKIMNKGEAFDRPNEGSIAKVVYVGKLEDGTVFERRGSEEEPFEYMCAEEQIHEGLD  320

Query  687  KAVKTMKKGEKVQLTVKPQY  746
            +AV TM+KGE+  + +  ++
Sbjct  321  RAVMTMRKGEEAVVKISSEF  340


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD  + KK++ +G  ++ P  G   +V Y G L DGT F+       PF++   + Q+ +
Sbjct  258  GDNKILKKIMNKGEAFDRPNEGSIAKVVYVGKLEDGTVFERRGSEEEPFEYMCAEEQIHE  317

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            G D+ + TM+KGE  +  I  +  +  +     +   +++ +D++L+ +V  K
Sbjct  318  GLDRAVMTMRKGEEAVVKISSE--FLNAPKDERLSSASSVLYDIKLIDFVKEK  368



>gb|KJB53362.1| hypothetical protein B456_009G2211001 [Gossypium raimondii]
Length=397

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 160/212 (75%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+E+G+ G+KKKL+  G  WETPE GDEV VH+ GTLL+G KF S+RD G P 
Sbjct  32   PPLKVGEERELGNSGIKKKLLNNGIHWETPEFGDEVTVHFVGTLLNGIKFCSTRDNGEPM  91

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
             F LG+G+V KG D GI TMKKGE  +FT+PPD  YG  G    +PP++ +QFDVELLSW
Sbjct  92   TFKLGEGKVAKGLDNGITTMKKGERVLFTLPPDFGYGAEGR-DGVPPDSIVQFDVELLSW  150

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTVEE  662
            ++V DICKDGGI KK++ +GE+ E P D DEV VKY+  L DGT+VAK+  +  EF V++
Sbjct  151  ITVVDICKDGGIIKKIMEKGERNERPSDLDEVLVKYQVALADGTIVAKASEEGYEFYVKD  210

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GH  PALTKA+ TMK+GEKV+L V+P+Y FG+
Sbjct  211  GHLFPALTKAIVTMKRGEKVKLIVQPKYAFGD  242


 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 112/207 (54%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++++G   E P   DEV V Y   L DGT    + + G  ++F +  G +   
Sbjct  159  DGGIIKKIMEKGERNERPSDLDEVLVKYQVALADGTIVAKASEEG--YEFYVKDGHLFPA  216

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  509
              + I TMK+GE     + P  A+G+ G       P+IPPN+ L  ++EL+S+  V D+ 
Sbjct  217  LTKAIVTMKRGEKVKLIVQPKYAFGDKGKEATDGFPSIPPNSVLNVELELVSFKPVIDVT  276

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  +FKK+L EGE      +   V++ Y A LEDGT+  +  +     +EF  +E    
Sbjct  277  GDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFERKGVDGGQPLEFITDEEQVI  336

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
            P L +A  TMKKGE+  LTV P+YGFG
Sbjct  337  PGLDRAAATMKKGEQALLTVSPEYGFG  363


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            +L+L    PV+ V      GD  + KK++KEG G      G  V + Y   L DGT F+ 
Sbjct  263  ELELVSFKPVIDV-----TGDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFER  317

Query  285  -SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D G P +F   + QVI G D+   TMKKGE  + T+ P+  +G   +      +PP+
Sbjct  318  KGVDGGQPLEFITDEEQVIPGLDRAAATMKKGEQALLTVSPEYGFGSVVAERDLAVVPPS  377

Query  453  ATLQFDVELLSWVSVKDIC  509
            + L ++VE+L +V V  + 
Sbjct  378  SNLVYEVEMLDFVKVTTVA  396



>gb|KJB53364.1| hypothetical protein B456_009G2211001, partial [Gossypium raimondii]
Length=391

 Score =   254 bits (650),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 160/212 (75%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+E+G+ G+KKKL+  G  WETPE GDEV VH+ GTLL+G KF S+RD G P 
Sbjct  32   PPLKVGEERELGNSGIKKKLLNNGIHWETPEFGDEVTVHFVGTLLNGIKFCSTRDNGEPM  91

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
             F LG+G+V KG D GI TMKKGE  +FT+PPD  YG  G    +PP++ +QFDVELLSW
Sbjct  92   TFKLGEGKVAKGLDNGITTMKKGERVLFTLPPDFGYGAEGR-DGVPPDSIVQFDVELLSW  150

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTVEE  662
            ++V DICKDGGI KK++ +GE+ E P D DEV VKY+  L DGT+VAK+  +  EF V++
Sbjct  151  ITVVDICKDGGIIKKIMEKGERNERPSDLDEVLVKYQVALADGTIVAKASEEGYEFYVKD  210

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GH  PALTKA+ TMK+GEKV+L V+P+Y FG+
Sbjct  211  GHLFPALTKAIVTMKRGEKVKLIVQPKYAFGD  242


 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 112/207 (54%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++++G   E P   DEV V Y   L DGT    + + G  ++F +  G +   
Sbjct  159  DGGIIKKIMEKGERNERPSDLDEVLVKYQVALADGTIVAKASEEG--YEFYVKDGHLFPA  216

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  509
              + I TMK+GE     + P  A+G+ G       P+IPPN+ L  ++EL+S+  V D+ 
Sbjct  217  LTKAIVTMKRGEKVKLIVQPKYAFGDKGKEATDGFPSIPPNSVLNVELELVSFKPVIDVT  276

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  +FKK+L EGE      +   V++ Y A LEDGT+  +  +     +EF  +E    
Sbjct  277  GDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFERKGVDGGQPLEFITDEEQVI  336

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
            P L +A  TMKKGE+  LTV P+YGFG
Sbjct  337  PGLDRAAATMKKGEQALLTVSPEYGFG  363


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 69/133 (52%), Gaps = 9/133 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            +L+L    PV+ V      GD  + KK++KEG G      G  V + Y   L DGT F+ 
Sbjct  263  ELELVSFKPVIDV-----TGDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFER  317

Query  285  -SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D G P +F   + QVI G D+   TMKKGE  + T+ P+  +G   +      +PP+
Sbjct  318  KGVDGGQPLEFITDEEQVIPGLDRAAATMKKGEQALLTVSPEYGFGSVVAERDLAVVPPS  377

Query  453  ATLQFDVELLSWV  491
            + L ++VE+L +V
Sbjct  378  SNLVYEVEMLDFV  390



>emb|CBI32825.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = +3

Query  156  EIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQV  335
            +IG QGL+K++++ G  W TP PGDEV+VHY+G +  G  FDSSRDRG PF F LGQ +V
Sbjct  10   DIGSQGLRKRILQMGHSWLTPFPGDEVQVHYSGRVEGGAYFDSSRDRGAPFWFKLGQCEV  69

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKD  515
            IKGW++G+ TMKKGE  IFTIPPDLAYGE+G PP IPPN+TL +D+E+LSW +++D+  D
Sbjct  70   IKGWEEGVATMKKGERAIFTIPPDLAYGETGLPPLIPPNSTLIYDIEMLSWNTIRDLTGD  129

Query  516  GGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALTKA  692
            GGI KK++ EGE W  PKD DEV VKYE RLE+GT V+K D   EF + +   CPA++KA
Sbjct  130  GGILKKIMTEGEGWATPKDGDEVLVKYEVRLENGTEVSKCDEGSEFHLGDDLPCPAISKA  189

Query  693  VKTMKKGEKVQLTVKPQYGF  752
            VKTM++GEK +L+V+  YGF
Sbjct  190  VKTMRRGEKAELSVRFSYGF  209


 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 108/201 (54%), Gaps = 12/201 (6%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG GW TP+ GDEV V Y   L +GT+  S  D G+  +F LG      
Sbjct  128  GDGGILKKIMTEGEGWATPKDGDEVLVKYEVRLENGTEV-SKCDEGS--EFHLGDDLPCP  184

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  506
               + +KTM++GE    ++     + + G+  T     IPPN+ L   +EL+SW SV DI
Sbjct  185  AISKAVKTMRRGEKAELSVRFSYGFKQIGNEVTRTDGAIPPNSNLIICLELISWKSVIDI  244

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEGHFC  674
              D  + KK++  GE ++ P +     V Y  +LE+GT+     ++ + +E    E    
Sbjct  245  MGDKKVLKKIMKVGEGFDRPSEGSLAKVAYIGKLENGTVFERKGSREEPLELLCFEEQIN  304

Query  675  PALTKAVKTMKKGEKVQLTVK  737
              L +A+ TM+KGE+  +T++
Sbjct  305  EGLDRAIMTMRKGEQALVTIQ  325


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            +GD+ + KK++K G G++ P  G   +V Y G L +GT F+    R  P +    + Q+ 
Sbjct  245  MGDKKVLKKIMKVGEGFDRPSEGSLAKVAYIGKLENGTVFERKGSREEPLELLCFEEQIN  304

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            +G D+ I TM+KGE  + TI  D  +  SG    +  N+   ++VEL+ + 
Sbjct  305  EGLDRAIMTMRKGEQALVTIQAD-GHEVSG---MVSANSLHHYEVELIDFT  351



>ref|XP_010111217.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
 gb|EXC30695.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Morus notabilis]
Length=524

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 156/204 (76%), Gaps = 0/204 (0%)
 Frame = +3

Query  147  EEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQ  326
            +EKEI  QGLKK++++ G+ W+TP  GDEV+VH++G +  G   D SRD GTPFKF LGQ
Sbjct  52   QEKEIRKQGLKKQILRNGSSWQTPSRGDEVQVHFSGRIKGGACLDQSRDIGTPFKFKLGQ  111

Query  327  GQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDI  506
             +VIKG D+G+ TMKKGE  IFTIPP+LAYGE G+PP IPPN+TL +D+E++SW +++DI
Sbjct  112  CEVIKGLDEGVATMKKGERAIFTIPPNLAYGEVGNPPLIPPNSTLVYDIEMISWRTIRDI  171

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALT  686
              DGGI KK++ EGE W  P+D DEV VKY++ LE+G LV++SD  EF + + + CPA++
Sbjct  172  TGDGGILKKIIKEGEGWATPRDGDEVLVKYKSSLENGMLVSESDNTEFYISDDYICPAIS  231

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
            + VKTM++GEK +L VK  Y F E
Sbjct  232  RTVKTMRRGEKAELAVKSSYSFKE  255


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 105/204 (51%), Gaps = 13/204 (6%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP  GDEV V Y  +L +G     S +     +F +    +  
Sbjct  173  GDGGILKKIIKEGEGWATPRDGDEVLVKYKSSLENGMLVSESDNT----EFYISDDYICP  228

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGE----SGSPPTIPPNAT-LQFDVELLSWVSVKDI  506
               + +KTM++GE     +    ++ E    + +   I P A+ L  ++EL+SW SV D+
Sbjct  229  AISRTVKTMRRGEKAELAVKSSYSFKEVVNGTATMGVIAPLASNLTIEIELISWKSVVDV  288

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEGHFC  674
              D  + KK++  GE +++P +   V V Y   LEDG+      ++ +  EF   E    
Sbjct  289  TGDKKVVKKIIKPGEGFDHPNEGAIVKVIYTGTLEDGSEFESKGSEEEPYEFVCLEEQVN  348

Query  675  PALTKAVKTMKKGEKVQLTVKPQY  746
              L +A+ TMKKGE+  +TV  ++
Sbjct  349  EGLDRAIMTMKKGEQALVTVGAEF  372



>ref|XP_012087707.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Jatropha curcas]
Length=561

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            EK+IG+ GL+KK++K+G  W+TP PGDEVEVH++G +  G   DS+RD+G PF F LGQG
Sbjct  24   EKKIGNDGLRKKILKKGISWQTPFPGDEVEVHFSGHVEGGASLDSTRDKGVPFCFKLGQG  83

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKG D GI TMKKGE   FT+PP L YGE+GSPP IP NATL FD+E+LSW +++D+ 
Sbjct  84   EVIKGLDDGIATMKKGERATFTVPPKLGYGEAGSPPLIPSNATLVFDIEMLSWSTIRDLT  143

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  P+D D+V VKYEARLE+G LV+KSD   EF V E +  PAL 
Sbjct  144  GDGGILKKIIKEGEGWATPRDGDKVLVKYEARLENGLLVSKSDQDAEFHVGESYLSPALG  203

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            KAVKTM++GEK +L VK  YGF
Sbjct  204  KAVKTMRRGEKAELAVKCSYGF  225


 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 105/207 (51%), Gaps = 11/207 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP  GD+V V Y   L +G     S       +F +G+  +  
Sbjct  144  GDGGILKKIIKEGEGWATPRDGDKVLVKYEARLENGLLVSKSDQDA---EFHVGESYLSP  200

Query  342  GWDQGIKTMKKGECCIFTIPPDLAY----GESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
               + +KTM++GE     +     +     E+G  P+I  ++ L   +EL+SW SV DI 
Sbjct  201  ALGKAVKTMRRGEKAELAVKCSYGFIQNGNEAGIDPSILSDSNLTIQLELVSWRSVIDIT  260

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIV----EFTVEEGHFCP  677
             D  + K ++  GE +E P +  +V V Y  +LEDG +V K   +    EF   EG    
Sbjct  261  GDKKVLKTIVKAGEGFERPNEGSQVKVTYIGKLEDGVVVEKKGTIEEPFEFKTLEGQVNE  320

Query  678  ALTKAVKTMKKGEKVQLTVKPQYGFGE  758
             L +AV +MK+GE   +TV  +Y  G 
Sbjct  321  GLDRAVMSMKRGEDALVTVSAEYLSGH  347


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 86/175 (49%), Gaps = 22/175 (13%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + K +VK G G+E P  G +V+V Y G L DG   +       PF+F   +GQV +
Sbjct  261  GDKKVLKTIVKAGEGFERPNEGSQVKVTYIGKLEDGVVVEKKGTIEEPFEFKTLEGQVNE  320

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK-----DI  506
            G D+ + +MK+GE  + T+  +   G   S   +P N+ + + V L+++V  K     D 
Sbjct  321  GLDRAVMSMKRGEDALVTVSAEYLSGHDIS-GMVPTNSVIHYQVHLINFVKEKPFWKMDT  379

Query  507  CK----------DGGIFKKVLAEGEKWENPKDPDEVS--VKYEARL-EDGTLVAK  632
            C+          DG +  K    G+ W   K  D+ +  ++Y+    +D  LVAK
Sbjct  380  CEKIEACERKKLDGNMLFKA---GKFWHASKKYDKATNCIEYDHSFTDDEKLVAK  431


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 5/112 (4%)
 Frame = +3

Query  435  PTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLED  614
             +I P+   +  +   +  + K I  DG + KK+L +G  W+ P   DEV V +   +E 
Sbjct  4    ASIKPSIETEIQIRKSTTFAEKKIGNDG-LRKKILKKGISWQTPFPGDEVEVHFSGHVEG  62

Query  615  G-TLVAKSDI---VEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            G +L +  D      F + +G     L   + TMKKGE+   TV P+ G+GE
Sbjct  63   GASLDSTRDKGVPFCFKLGQGEVIKGLDDGIATMKKGERATFTVPPKLGYGE  114



>ref|XP_006430496.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
 gb|ESR43736.1| hypothetical protein CICLE_v10011447mg [Citrus clementina]
Length=535

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 157/202 (78%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E+EIG QGL+K+++++G  W+TP  GDEV+VH++G +  G    SSRD GTPF F LGQG
Sbjct  23   EREIGKQGLRKQILRKGTSWQTPLLGDEVQVHFSGHIDGGACLASSRDTGTPFCFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+G+ TMKKGE  IF IP  LAYGE+GSPP IP N++L FD+ELLSW +++DI 
Sbjct  83   EVIKGWDEGVATMKKGERAIFFIPSVLAYGEAGSPPLIPSNSSLVFDIELLSWSTIRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  P+D DEV V++EARL++G LV++S+  VEF V +GH CPA++
Sbjct  143  GDGGILKKIIKEGEGWATPRDNDEVLVEFEARLQNGALVSESNEGVEFRVFDGHLCPAIS  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            KAV+TM++GEK +L VK  YG 
Sbjct  203  KAVRTMRRGEKAELAVKFSYGI  224


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 98/204 (48%), Gaps = 12/204 (6%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP   DEV V +   L +G     S +     +F +  G +  
Sbjct  143  GDGGILKKIIKEGEGWATPRDNDEVLVEFEARLQNGALVSESNE---GVEFRVFDGHLCP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  506
               + ++TM++GE     +         G   T     +   + L   +ELLSW SV D+
Sbjct  200  AISKAVRTMRRGEKAELAVKFSYGIENDGYEATNIEGGVSSFSNLTIQLELLSWKSVVDV  259

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEGHFC  674
              D  + KK+   G+ ++ P +   V V Y  RLEDGT+     +  +  EFT  E +  
Sbjct  260  TGDQKVLKKIKKAGQGFDRPNEGSLVKVIYIGRLEDGTVFETRGSNEEPFEFTTLEENVN  319

Query  675  PALTKAVKTMKKGEKVQLTVKPQY  746
              L +A+ TMKK E+  +T+  +Y
Sbjct  320  EGLERAIMTMKKEEQATVTISAEY  343


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 1/113 (1%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GDQ + KK+ K G G++ P  G  V+V Y G L DGT F++      PF+FT  +  V +
Sbjct  261  GDQKVLKKIKKAGQGFDRPNEGSLVKVIYIGRLEDGTVFETRGSNEEPFEFTTLEENVNE  320

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            G ++ I TMKK E    TI  +       S   +  ++ L ++V L+ +   K
Sbjct  321  GLERAIMTMKKEEQATVTISAEYLCSHEVS-ELVSADSVLHYEVTLIDFTKEK  372



>ref|XP_003520475.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X1 [Glycine max]
 gb|KHN12184.1| Peptidyl-prolyl cis-trans isomerase FKBP65 [Glycine soja]
Length=540

 Score =   256 bits (654),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  KEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ  332
            KEIG++GL K+++++G  W+TP  GDEVEVH+ G + +G   +SS D+G+PF+F LGQ +
Sbjct  27   KEIGNEGLTKRILRKGVTWQTPFSGDEVEVHFNGQVENGASLESSYDKGSPFRFKLGQCE  86

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  512
            VIKGWD+G+ TMKKGE  IF IPP+LAYGE GS P IPPNATL FD+E+LSW S++D+  
Sbjct  87   VIKGWDEGVATMKKGERAIFKIPPNLAYGEEGSLPLIPPNATLIFDIEMLSWSSIRDLTG  146

Query  513  DGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALTK  689
            DGG+ KK++ EGE W  P++ DEV VKYEARLE+G LV+KSD  VEF V +G+ CPA++ 
Sbjct  147  DGGVKKKIIREGEGWATPREADEVLVKYEARLENGMLVSKSDQGVEFNVSDGYLCPAMSI  206

Query  690  AVKTMKKGEKVQLTVKPQYGFGE  758
            AVKTM+KGE  +L ++  YG  +
Sbjct  207  AVKTMRKGEVAELAMRFCYGLSQ  229


 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 108/207 (52%), Gaps = 17/207 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+KKK+++EG GW TP   DEV V Y   L +G    S  D+G   +F +  G +  
Sbjct  146  GDGGVKKKIIREGEGWATPREADEVLVKYEARLENGM-LVSKSDQGV--EFNVSDGYLCP  202

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI-------PPNATL-QFDVELLSWVSV  497
                 +KTM+KGE  +  +     YG S +   I       PP++ L    +EL+SW  V
Sbjct  203  AMSIAVKTMRKGE--VAELAMRFCYGLSQNSSRITELEGVLPPDSNLTSIKLELVSWKIV  260

Query  498  KDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEG  665
             D+  D  I KK+   GE ++ P +  +V V Y  + EDGT++    ++ +  EFT +E 
Sbjct  261  ADVTGDKKILKKIKNLGEGFDRPNEGSQVKVIYLCKGEDGTIIESKGSEEEPFEFTTQEE  320

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQY  746
                 L +A+ TMKKGE+  +TV  +Y
Sbjct  321  QVPEGLERAIMTMKKGEQALVTVDAEY  347


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 0/113 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KK+   G G++ P  G +V+V Y     DGT  +S      PF+FT  + QV +
Sbjct  265  GDKKILKKIKNLGEGFDRPNEGSQVKVIYLCKGEDGTIIESKGSEEEPFEFTTQEEQVPE  324

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            G ++ I TMKKGE  + T+  +     + S      N  L ++VEL+ +V  K
Sbjct  325  GLERAIMTMKKGEQALVTVDAEYLCDYNNSKGNTANNKVLYYEVELVDFVKEK  377



>ref|XP_006472323.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Citrus sinensis]
Length=606

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 164/214 (77%), Gaps = 5/214 (2%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+E+G+ G+KKKL+K G GW+TPE GDEV +HY GTLLDGTKFDS+RDR  P 
Sbjct  33   PPLKVGEERELGNSGIKKKLLKNGVGWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPL  92

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCI--FTIPPDLAYGESGSPPTIPPNATLQFDVELL  482
             F LG GQV  G D GI TMKK EC +  FT+P +L +G  G   ++PPN+ +QF+VEL+
Sbjct  93   TFKLGTGQVATGLDNGIITMKKRECAVFTFTLPSELRFGVEGR-DSLPPNSVVQFEVELV  151

Query  483  SWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTV  656
            SW++V D+ KDGGI KK+L +GE+  +P D DEV VKY+  L DGT+VAK+  + VEF +
Sbjct  152  SWITVVDLSKDGGIVKKILEKGERDASPGDLDEVLVKYQVMLGDGTMVAKTPEEGVEFYL  211

Query  657  EEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            ++GHFCP L+KA+ TMKKGEKV+L ++PQY FGE
Sbjct  212  KDGHFCPVLSKAILTMKKGEKVKLVIQPQYAFGE  245


 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 103/207 (50%), Gaps = 13/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++++G    +P   DEV V Y   L DGT    + + G   +F L  G     
Sbjct  162  DGGIVKKILEKGERDASPGDLDEVLVKYQVMLGDGTMVAKTPEEGV--EFYLKDGHFCPV  219

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + I TMKKGE     I P  A+GE           IPPN+ L F++ELLS+  V D+ 
Sbjct  220  LSKAILTMKKGEKVKLVIQPQYAFGEERRDACDGFGAIPPNSALDFNLELLSFKHVVDVT  279

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  + KK+L EGE   +  +   V++ Y ARLEDGT+  K        +EF  +E    
Sbjct  280  GDSKVVKKILKEGE-GTSADEGATVTISYIARLEDGTVFEKKGYDGEQPLEFITDEEQVI  338

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +    MKKGE   +T+  +YGFG
Sbjct  339  AGLDRVAAMMKKGEWAIVTINHEYGFG  365


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 59/117 (50%), Gaps = 5/117 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  338
            GD  + KK++KEG G    E G  V + Y   L DGT F+    D   P +F   + QVI
Sbjct  280  GDSKVVKKILKEGEGTSADE-GATVTISYIARLEDGTVFEKKGYDGEQPLEFITDEEQVI  338

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
             G D+    MKKGE  I TI  +  +G   +     TIP  A L ++VE++ ++  K
Sbjct  339  AGLDRVAAMMKKGEWAIVTINHEYGFGNVEAKRDLATIPSCAKLYYEVEMMDFIKEK  395



>ref|XP_007018460.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
 gb|EOY15685.1| FKBP-type peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
Length=603

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 165/226 (73%), Gaps = 8/226 (4%)
 Frame = +3

Query  102  DDLD-----LPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLD  266
            DDLD     + +  P +KVGEE+E+G  G+KKKL+K G  WETPE GDEV VHY GTLLD
Sbjct  18   DDLDEEPGEVIESAPPLKVGEERELGSSGIKKKLLKNGISWETPEFGDEVTVHYVGTLLD  77

Query  267  GTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIP  446
            GTKF S+RD+  P  F LG+G V KG D GI TMKKGEC +FT+PPD  YG  G    +P
Sbjct  78   GTKFCSTRDKDEPLTFKLGEGLVAKGLDHGIVTMKKGECALFTLPPDFGYGAEGR-DGVP  136

Query  447  PNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV  626
            P++ +Q+++ELLSW++V DI KDGGI KK++ +GE+ E P D DEV VKY+  L DGT+V
Sbjct  137  PDSVIQYEMELLSWITVVDISKDGGIIKKIMKKGERNEWPSDLDEVLVKYQMALVDGTIV  196

Query  627  AK--SDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            AK  ++  EF V++GH C ALTKA+ TMK+GEKV L V+P+Y FGE
Sbjct  197  AKTPAEGNEFYVKDGHLCSALTKAILTMKRGEKVTLIVQPKYAFGE  242


 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 111/207 (54%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++K+G   E P   DEV V Y   L+DGT    +   G   +F +  G +   
Sbjct  159  DGGIIKKIMKKGERNEWPSDLDEVLVKYQMALVDGTIVAKTPAEGN--EFYVKDGHLCSA  216

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  509
              + I TMK+GE     + P  A+GE G       P +PPN+ L  ++EL+S+ SV D+ 
Sbjct  217  LTKAILTMKRGEKVTLIVQPKYAFGEKGRDATDGFPAVPPNSVLNIELELVSFKSVIDVT  276

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  +FKK+L EGE      +   V++ Y ARLED T+  K  +     +EF  +E    
Sbjct  277  GDSKVFKKILKEGEGAVVANEGAAVTISYTARLEDNTVFEKKGVDGEQPLEFITDEEQVI  336

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
            P L +A  TMKKGE+  LT+ P+YGFG
Sbjct  337  PGLDRAAATMKKGERALLTISPEYGFG  363


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 60/117 (51%), Gaps = 4/117 (3%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  338
            GD  + KK++KEG G      G  V + YT  L D T F+    D   P +F   + QVI
Sbjct  277  GDSKVFKKILKEGEGAVVANEGAAVTISYTARLEDNTVFEKKGVDGEQPLEFITDEEQVI  336

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
             G D+   TMKKGE  + TI P+  +G   +      +PP A L ++VE+L +V  K
Sbjct  337  PGLDRAAATMKKGERALLTISPEYGFGSVVAECDLAVVPPCANLFYEVEMLDFVKEK  393



>ref|XP_010653645.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Vitis vinifera]
Length=517

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = +3

Query  156  EIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQV  335
            +IG QGL+K++++ G  W TP PGDEV+VHY+G +  G  FDSSRDRG PF F LGQ +V
Sbjct  10   DIGSQGLRKRILQMGHSWLTPFPGDEVQVHYSGRVEGGAYFDSSRDRGAPFWFKLGQCEV  69

Query  336  IKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKD  515
            IKGW++G+ TMKKGE  IFTIPPDLAYGE+G PP IPPN+TL +D+E+LSW +++D+  D
Sbjct  70   IKGWEEGVATMKKGERAIFTIPPDLAYGETGLPPLIPPNSTLIYDIEMLSWNTIRDLTGD  129

Query  516  GGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALTKA  692
            GGI KK++ EGE W  PKD DEV VKYE RLE+GT V+K D   EF + +   CPA++KA
Sbjct  130  GGILKKIMTEGEGWATPKDGDEVLVKYEVRLENGTEVSKCDEGSEFHLGDDLPCPAISKA  189

Query  693  VKTMKKGEKVQLTVKPQYGF  752
            VKTM++GEK +L+V+  YGF
Sbjct  190  VKTMRRGEKAELSVRFSYGF  209


 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 108/201 (54%), Gaps = 12/201 (6%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG GW TP+ GDEV V Y   L +GT+  S  D G+  +F LG      
Sbjct  128  GDGGILKKIMTEGEGWATPKDGDEVLVKYEVRLENGTEV-SKCDEGS--EFHLGDDLPCP  184

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDI  506
               + +KTM++GE    ++     + + G+  T     IPPN+ L   +EL+SW SV DI
Sbjct  185  AISKAVKTMRRGEKAELSVRFSYGFKQIGNEVTRTDGAIPPNSNLIICLELISWKSVIDI  244

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEGHFC  674
              D  + KK++  GE ++ P +     V Y  +LE+GT+     ++ + +E    E    
Sbjct  245  MGDKKVLKKIMKVGEGFDRPSEGSLAKVAYIGKLENGTVFERKGSREEPLELLCFEEQIN  304

Query  675  PALTKAVKTMKKGEKVQLTVK  737
              L +A+ TM+KGE+  +T++
Sbjct  305  EGLDRAIMTMRKGEQALVTIQ  325


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            +GD+ + KK++K G G++ P  G   +V Y G L +GT F+    R  P +    + Q+ 
Sbjct  245  MGDKKVLKKIMKVGEGFDRPSEGSLAKVAYIGKLENGTVFERKGSREEPLELLCFEEQIN  304

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
            +G D+ I TM+KGE  + TI  D  +  SG    +  N+   ++VEL+ +
Sbjct  305  EGLDRAIMTMRKGEQALVTIQAD-GHEVSG---MVSANSLHHYEVELIDF  350



>ref|XP_011017099.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Populus euphratica]
Length=608

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 166/231 (72%), Gaps = 8/231 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            ED D  P E     + +  P +KVGEE+E+G+ G++KKL+K G GWETPE  DEV VHY 
Sbjct  16   EDLDEEPGE-----VIESAPPLKVGEERELGNSGIRKKLLKRGLGWETPEFNDEVTVHYV  70

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTL DGTKFDS+RDR +     LGQG+V+ G D GI TMKKGEC +FT+PP+L  G +G 
Sbjct  71   GTLPDGTKFDSTRDRDSSVIMKLGQGEVVAGLDHGIITMKKGECALFTLPPELGLGVAGR  130

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
               +P N+ ++++VEL+SW+ V D+ KDGGI KK++  GEK E P D DEV VKY+  L 
Sbjct  131  -DAVPTNSFVRYEVELVSWIKVVDVSKDGGIIKKIVENGEKHERPGDLDEVLVKYQVALA  189

Query  612  DGTLVAKS--DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DGT+VAK+  + +EF V++GH CPAL KA  TMK+GEKV+L V+PQY FG+
Sbjct  190  DGTIVAKTLEEGIEFYVKDGHLCPALPKATMTMKRGEKVKLVVQPQYAFGQ  240


 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 109/207 (53%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V+ G   E P   DEV V Y   L DGT    + + G   +F +  G +   
Sbjct  157  DGGIIKKIVENGEKHERPGDLDEVLVKYQVALADGTIVAKTLEEG--IEFYVKDGHLCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              +   TMK+GE     + P  A+G+ G   +     +PPN+TL  D+EL S+  V D+ 
Sbjct  215  LPKATMTMKRGEKVKLVVQPQYAFGQEGKDASDAICPVPPNSTLYIDLELTSFKPVIDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  +FKK+L EGE      +   V++ Y ARLEDGT+  +  I     ++F  +E    
Sbjct  275  GDAKVFKKILKEGEGSLVANEGATVTISYTARLEDGTVFERKGIDDRQPLQFITDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   LTVKP+YGFG
Sbjct  335  AGLDRAVATMKKGEHAILTVKPEYGFG  361


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 72/136 (53%), Gaps = 9/136 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L    PV+ V      GD  + KK++KEG G      G  V + YT  L DGT F+ 
Sbjct  261  DLELTSFKPVIDV-----TGDAKVFKKILKEGEGSLVANEGATVTISYTARLEDGTVFER  315

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D   P +F   + QVI G D+ + TMKKGE  I T+ P+  +G   +      +PP+
Sbjct  316  KGIDDRQPLQFITDEEQVIAGLDRAVATMKKGEHAILTVKPEYGFGNIETKRDLAIVPPS  375

Query  453  ATLQFDVELLSWVSVK  500
            ++L ++VE+L ++  K
Sbjct  376  SSLVYEVEMLDFIKEK  391



>ref|XP_009596526.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X3 [Nicotiana tomentosiformis]
Length=414

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL+KK++++G  W+TP PGDE++VHY   + DG   DSS D+G PF+F LGQG
Sbjct  24   ETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSHDKGKPFEFKLGQG  83

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMKK E  IFTIPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  84   EVIKGWDEGIATMKKSERAIFTIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  143

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDG-TLVAKSDIVEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DEV VKY A   DG TL +  D VEF++ +G+  PA+T
Sbjct  144  GDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSSSDDGVEFSLLDGYLYPAMT  203

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  204  KSVKTMRKGEIAELTVKPAYYF  225


 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 114/219 (52%), Gaps = 15/219 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D++L   N V  +      GD G+ KK++KEG GW TP+  DEV V Y  +  DG    S
Sbjct  130  DIELVSWNSVRDI-----TGDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSS  184

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            S D     +F+L  G +     + +KTM+KGE    T+ P  AY   G    + PN  L 
Sbjct  185  SDD---GVEFSLLDGYLYPAMTKSVKTMRKGEIAELTVKP--AYYFDGVENGMQPNLNLT  239

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTL-----VA  629
              +EL+SW +V D+  D  + KK++  GE ++ P +   V V Y  +L+DGT+     ++
Sbjct  240  IHLELISWKTVVDVTGDKKVLKKLIKAGEGYDRPNEGSLVKVVYIGKLQDGTVFERKGLS  299

Query  630  KSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQY  746
              D  E+   EG F   L +A+ TM+KGE+  +T+   Y
Sbjct  300  DEDPFEYVCLEGQFNEGLDRAIMTMRKGEEAIVTISSDY  338


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 51/104 (49%), Gaps = 5/104 (5%)
 Frame = +3

Query  459  LQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSD  638
            + F+ E+  W   + +    G+ KK+L +G  W+ P   DE+ V Y  ++EDG ++  S 
Sbjct  12   VNFETEI-HWELPETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSH  70

Query  639  I----VEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
                  EF + +G       + + TMKK E+   T+ P   +GE
Sbjct  71   DKGKPFEFKLGQGEVIKGWDEGIATMKKSERAIFTIPPNLAYGE  114



>gb|EYU20825.1| hypothetical protein MIMGU_mgv1a004220mg [Erythranthe guttata]
Length=538

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 155/203 (76%), Gaps = 2/203 (1%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL K+++++G  W+TP PGDEVEVHY+ +L     FDSSRD+GTPF+F LGQG
Sbjct  23   EAIIGPKGLSKRILEKGISWQTPTPGDEVEVHYSVSLQGAEYFDSSRDKGTPFRFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TM+K E  IFTIPP+L YGE GSPP +PPN+TL FDV+L+SW  ++DI 
Sbjct  83   EVIKGWDEGIATMRKNERAIFTIPPELGYGEIGSPPLVPPNSTLVFDVQLISWYPIRDIS  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI--VEFTVEEGHFCPAL  683
             DGGI KK+++EG+ W  P + DEV V Y A  E+G +++KSD   +EF++  GH CPA+
Sbjct  143  GDGGIIKKIISEGKGWATPNESDEVFVNYVAECENGVVISKSDEEGLEFSLISGHLCPAM  202

Query  684  TKAVKTMKKGEKVQLTVKPQYGF  752
            +KAVKTM+KGEK +L+VK  YG 
Sbjct  203  SKAVKTMRKGEKAELSVKFSYGL  225


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 101/204 (50%), Gaps = 11/204 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG GW TP   DEV V+Y     +G     S + G   +F+L  G +  
Sbjct  143  GDGGIIKKIISEGKGWATPNESDEVFVNYVAECENGVVISKSDEEG--LEFSLISGHLCP  200

Query  342  GWDQGIKTMKKGECCIFTIPPD--LAYGESGSPPT---IPPNATLQFDVELLSWVSVKDI  506
               + +KTM+KGE    ++     L Y E  +      +P    L   +EL++W +V DI
Sbjct  201  AMSKAVKTMRKGEKAELSVKFSYGLIYCEDETSKIDDLVPTCPNLIIHLELVNWRTVVDI  260

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFC  674
              D  I KK+   GE +++P +   V V Y  +LEDGT++ +     +  E+   E    
Sbjct  261  TGDKNILKKITKNGEAFDHPNEGSLVKVVYIGKLEDGTVLERRGSDEEPFEYICAEEKIH  320

Query  675  PALTKAVKTMKKGEKVQLTVKPQY  746
              L +AV TMKKGE+  + +   +
Sbjct  321  GGLDRAVMTMKKGEEAIVKISADF  344



>ref|XP_011013750.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Populus 
euphratica]
Length=608

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 166/231 (72%), Gaps = 8/231 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            ED D  P E     + +  P +KVGEE+E+G+ G++KKL+K G GWETPE  DEV VHY 
Sbjct  16   EDLDEEPGE-----VIESAPPLKVGEERELGNSGIRKKLLKRGLGWETPEFNDEVTVHYV  70

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTL DGTKFDS+RDR +     LGQG+V+ G D GI TMKKGEC +FT+PP+L  G +G 
Sbjct  71   GTLPDGTKFDSTRDRDSSVIMKLGQGEVVAGLDHGIITMKKGECALFTLPPELGLGVAGR  130

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
               +P N+ ++++VEL+SW+ V D+ KDGGI KK++  GEK E P D DEV VKY+  L 
Sbjct  131  -DAVPTNSFVRYEVELVSWIKVVDVSKDGGIIKKIVENGEKHERPGDLDEVLVKYQVALA  189

Query  612  DGTLVAKS--DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DGT+VAK+  + +EF V++GH CPAL KA  TMK+GEKV+L V+PQY FG+
Sbjct  190  DGTIVAKTLEEGIEFYVKDGHLCPALPKATMTMKRGEKVKLVVQPQYAFGQ  240


 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 109/207 (53%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V+ G   E P   DEV V Y   L DGT    + + G   +F +  G +   
Sbjct  157  DGGIIKKIVENGEKHERPGDLDEVLVKYQVALADGTIVAKTLEEG--IEFYVKDGHLCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              +   TMK+GE     + P  A+G+ G   +     +PPN+TL  D+EL S+  V D+ 
Sbjct  215  LPKATMTMKRGEKVKLVVQPQYAFGQEGKDASDAICPVPPNSTLYIDLELTSFKPVIDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  +FKK+L EGE      +   V++ Y ARLEDGT+  +  I     ++F  +E    
Sbjct  275  GDAKVFKKILKEGEGSLVANEGATVTISYTARLEDGTVFERKGIDDGQPLQFITDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   LTVKP+YGFG
Sbjct  335  AGLDRAVATMKKGEHAILTVKPEYGFG  361


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 9/136 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L    PV+ V      GD  + KK++KEG G      G  V + YT  L DGT F+ 
Sbjct  261  DLELTSFKPVIDV-----TGDAKVFKKILKEGEGSLVANEGATVTISYTARLEDGTVFER  315

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D G P +F   + QVI G D+ + TMKKGE  I T+ P+  +G   +      +PP+
Sbjct  316  KGIDDGQPLQFITDEEQVIAGLDRAVATMKKGEHAILTVKPEYGFGNIETKRDLAIVPPS  375

Query  453  ATLQFDVELLSWVSVK  500
            ++L ++VE+L ++  K
Sbjct  376  SSLVYEVEMLDFIKEK  391



>ref|XP_002302401.1| peptidyl-prolyl cis-trans isomerase FKBP-type family protein 
[Populus trichocarpa]
 gb|EEE81674.1| peptidyl-prolyl cis-trans isomerase FKBP-type family protein 
[Populus trichocarpa]
Length=573

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 168/231 (73%), Gaps = 8/231 (3%)
 Frame = +3

Query  72   EDFDMPPAEMDDLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYT  251
            ED D  P E     + +  P +KVGEE+E+G+ G+KKKL+K G GWETPE  DEV VHY 
Sbjct  16   EDLDEEPGE-----VIESAPPLKVGEERELGNSGIKKKLLKRGLGWETPEFNDEVTVHYV  70

Query  252  GTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
            GTLLDGTKFDS+RDR +     LGQG+V+ G D GI TMKKGE  +FT+PP+L +G +G 
Sbjct  71   GTLLDGTKFDSTRDRDSSVIMKLGQGEVVAGLDHGIITMKKGERALFTLPPELGFGVTGR  130

Query  432  PPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLE  611
               +P N+ ++++VEL+SW+ V D+ KDGGI KK++ +G+K + P D DEV VKY+  L 
Sbjct  131  -DAVPTNSFVRYEVELVSWIKVVDVSKDGGIIKKIVEKGDKHDRPGDLDEVLVKYQVALA  189

Query  612  DGTLVAKS--DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            DGT+VAK+  + +EF V++GH CPAL KA  TMK+GEKV+L V+PQY FG+
Sbjct  190  DGTIVAKTLEEGIEFYVKDGHLCPALPKATMTMKRGEKVKLVVQPQYAFGQ  240


 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK+V++G   + P   DEV V Y   L DGT    + + G   +F +  G +   
Sbjct  157  DGGIIKKIVEKGDKHDRPGDLDEVLVKYQVALADGTIVAKTLEEG--IEFYVKDGHLCPA  214

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPPT-----IPPNATLQFDVELLSWVSVKDIC  509
              +   TMK+GE     + P  A+G+ G   +     +PPN+TL  D+EL S+  V D+ 
Sbjct  215  LPKATMTMKRGEKVKLVVQPQYAFGQEGKDASDAICPVPPNSTLYIDLELTSFKPVIDVT  274

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  +FKK+L EGE      +   V++ Y ARLEDGT+  +  I     ++F  +E    
Sbjct  275  GDAKVFKKILKEGEGSLVANEGATVTISYTARLEDGTVFERKGIDDGQPLQFITDEEQVI  334

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +AV TMKKGE   LTVKP+YGFG
Sbjct  335  AGLDRAVATMKKGEYAILTVKPEYGFG  361


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            DL+L    PV+ V      GD  + KK++KEG G      G  V + YT  L DGT F+ 
Sbjct  261  DLELTSFKPVIDV-----TGDAKVFKKILKEGEGSLVANEGATVTISYTARLEDGTVFER  315

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D G P +F   + QVI G D+ + TMKKGE  I T+ P+  +G   +      +PP+
Sbjct  316  KGIDDGQPLQFITDEEQVIAGLDRAVATMKKGEYAILTVKPEYGFGNVETKRDLAIVPPS  375

Query  453  ATLQFDVELLSWVSVK  500
            + L ++VE+  ++  K
Sbjct  376  SILVYEVEMSDFIKEK  391



>ref|XP_010673091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Beta 
vulgaris subsp. vulgaris]
Length=538

 Score =   253 bits (647),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            EK IG+ GL K++++ G  W+TP PGDEVEVHY+G + DG+   SS ++G PFKF LGQ 
Sbjct  26   EKLIGNHGLTKRILRRGTTWQTPFPGDEVEVHYSGHVEDGSSLGSSLEKGAPFKFKLGQR  85

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VI+G D+G+ TMKKGE  IF +PP LAYGE+G PP IPP++TL FDVE++SW +++D+ 
Sbjct  86   EVIEGLDEGVATMKKGERAIFKVPPQLAYGEAGFPPLIPPHSTLIFDVEMISWSTIRDVT  145

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTK  689
             DGG+ KK++ EGE W  PKD DEVSVKYEA LE+GT ++ S+ VEF + +G  CPA+ K
Sbjct  146  GDGGVLKKIITEGEDWATPKDGDEVSVKYEAELENGTKLSSSESVEFHIGDGKLCPAIHK  205

Query  690  AVKTMKKGEKVQLTVKPQYGFGE  758
            AVKTM++ EK +L+V+  YGF E
Sbjct  206  AVKTMRRKEKAELSVRFSYGFEE  228


 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 105/202 (52%), Gaps = 17/202 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++ EG  W TP+ GDEV V Y   L +GTK  SS       +F +G G++  
Sbjct  146  GDGGVLKKIITEGEDWATPKDGDEVSVKYEAELENGTKLSSSES----VEFHIGDGKLCP  201

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYG---ESGSPPTIPPNAT----LQFDVELLSWVSVK  500
               + +KTM++ E    ++    +YG   + GS   I  +++    L   +ELLSW SV 
Sbjct  202  AIHKAVKTMRRKEKAELSV--RFSYGFEEQHGSVEAITSDSSCSNNLTIFLELLSWRSVV  259

Query  501  DICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEGH  668
            DI  D  IFKKV++ GE    P +   + V Y  + EDG +     +  +  E+   EG 
Sbjct  260  DIVGDKKIFKKVISAGEGLSYPNEGSLIKVIYVGKQEDGAIFERKGSNEEPFEYMCLEGQ  319

Query  669  FCPALTKAVKTMKKGEKVQLTV  734
                L KA+ TMKKGEK Q+ V
Sbjct  320  VNENLDKAIMTMKKGEKAQIFV  341


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 58/118 (49%), Gaps = 0/118 (0%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            +GD+ + KK++  G G   P  G  ++V Y G   DG  F+       PF++   +GQV 
Sbjct  262  VGDKKIFKKVISAGEGLSYPNEGSLIKVIYVGKQEDGAIFERKGSNEEPFEYMCLEGQVN  321

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  512
            +  D+ I TMKKGE     +  D   G+     T   ++ L ++V+LL +   K + K
Sbjct  322  ENLDKAIMTMKKGEKAQIFVSSDDMQGDHEVSETKISSSRLLYEVQLLDFTKEKPVWK  379



>ref|XP_009764948.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X6 [Nicotiana sylvestris]
Length=398

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DE  VKY A   DG  +++SD  VEF++ + + CPA+ 
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDDGVEFSLLDDYLCPAMK  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  203  KSVKTMRKGEIAELTVKPTYCF  224


 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 111/218 (51%), Gaps = 14/218 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D++L   N V  +      GD G+ KK++KEG GW TP+  DE  V Y  +  DG     
Sbjct  129  DIELVSWNSVRDI-----TGDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSR  183

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            S D     +F+L    +     + +KTM+KGE    T+ P   Y   G    + PN  L 
Sbjct  184  SDD---GVEFSLLDDYLCPAMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLN  238

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS---  635
              +EL+SW +V D+  D  + KK++  GE ++ P +   V V Y  +L+DGT+  +    
Sbjct  239  IHLELISWKTVVDVTGDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSD  298

Query  636  -DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQY  746
             + +E+   EG F  +L +A+ TM+KGE+  +T+   Y
Sbjct  299  DEPLEYACLEGKFSESLDRAIMTMRKGEEAIVTISSDY  336


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 41/84 (49%), Gaps = 4/84 (5%)
 Frame = +3

Query  519  GIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCPALT  686
            G+ KK+L +G  W+ P   DE+ V Y  +LEDG +   S       EF + +G       
Sbjct  30   GLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQGEVIKGWD  89

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
            + + TMK+ E+    + P   +GE
Sbjct  90   EGIATMKRSERAIFIIPPNLAYGE  113



>ref|XP_009596524.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=531

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL+KK++++G  W+TP PGDE++VHY   + DG   DSS D+G PF+F LGQG
Sbjct  24   ETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSHDKGKPFEFKLGQG  83

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMKK E  IFTIPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  84   EVIKGWDEGIATMKKSERAIFTIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  143

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDG-TLVAKSDIVEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DEV VKY A   DG TL +  D VEF++ +G+  PA+T
Sbjct  144  GDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSSSDDGVEFSLLDGYLYPAMT  203

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  204  KSVKTMRKGEIAELTVKPAYYF  225


 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 114/219 (52%), Gaps = 15/219 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D++L   N V  +      GD G+ KK++KEG GW TP+  DEV V Y  +  DG    S
Sbjct  130  DIELVSWNSVRDI-----TGDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSS  184

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            S D     +F+L  G +     + +KTM+KGE    T+ P  AY   G    + PN  L 
Sbjct  185  SDD---GVEFSLLDGYLYPAMTKSVKTMRKGEIAELTVKP--AYYFDGVENGMQPNLNLT  239

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTL-----VA  629
              +EL+SW +V D+  D  + KK++  GE ++ P +   V V Y  +L+DGT+     ++
Sbjct  240  IHLELISWKTVVDVTGDKKVLKKLIKAGEGYDRPNEGSLVKVVYIGKLQDGTVFERKGLS  299

Query  630  KSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQY  746
              D  E+   EG F   L +A+ TM+KGE+  +T+   Y
Sbjct  300  DEDPFEYVCLEGQFNEGLDRAIMTMRKGEEAIVTISSDY  338


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = +3

Query  519  GIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCPALT  686
            G+ KK+L +G  W+ P   DE+ V Y  ++EDG ++  S       EF + +G       
Sbjct  31   GLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSHDKGKPFEFKLGQGEVIKGWD  90

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
            + + TMKK E+   T+ P   +GE
Sbjct  91   EGIATMKKSERAIFTIPPNLAYGE  114



>ref|XP_009596525.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=530

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL+KK++++G  W+TP PGDE++VHY   + DG   DSS D+G PF+F LGQG
Sbjct  24   ETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSHDKGKPFEFKLGQG  83

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMKK E  IFTIPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  84   EVIKGWDEGIATMKKSERAIFTIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  143

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDG-TLVAKSDIVEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DEV VKY A   DG TL +  D VEF++ +G+  PA+T
Sbjct  144  GDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSSSDDGVEFSLLDGYLYPAMT  203

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  204  KSVKTMRKGEIAELTVKPAYYF  225


 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 114/219 (52%), Gaps = 15/219 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D++L   N V  +      GD G+ KK++KEG GW TP+  DEV V Y  +  DG    S
Sbjct  130  DIELVSWNSVRDI-----TGDGGILKKIIKEGEGWATPKDVDEVLVKYIASSADGKTLSS  184

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            S D     +F+L  G +     + +KTM+KGE    T+ P  AY   G    + PN  L 
Sbjct  185  SDD---GVEFSLLDGYLYPAMTKSVKTMRKGEIAELTVKP--AYYFDGVENGMQPNLNLT  239

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTL-----VA  629
              +EL+SW +V D+  D  + KK++  GE ++ P +   V V Y  +L+DGT+     ++
Sbjct  240  IHLELISWKTVVDVTGDKKVLKKLIKAGEGYDRPNEGSLVKVVYIGKLQDGTVFERKGLS  299

Query  630  KSDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQY  746
              D  E+   EG F   L +A+ TM+KGE+  +T+   Y
Sbjct  300  DEDPFEYVCLEGQFNEGLDRAIMTMRKGEEAIVTISSDY  338


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 51/104 (49%), Gaps = 5/104 (5%)
 Frame = +3

Query  459  LQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSD  638
            + F+ E+  W   + +    G+ KK+L +G  W+ P   DE+ V Y  ++EDG ++  S 
Sbjct  12   VNFETEI-HWELPETVIGKEGLRKKILQKGNSWKTPLPGDEIQVHYNVKIEDGEILDSSH  70

Query  639  I----VEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
                  EF + +G       + + TMKK E+   T+ P   +GE
Sbjct  71   DKGKPFEFKLGQGEVIKGWDEGIATMKKSERAIFTIPPNLAYGE  114



>ref|XP_009764947.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like isoform 
X5 [Nicotiana sylvestris]
Length=408

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DE  VKY A   DG  +++SD  VEF++ + + CPA+ 
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDDGVEFSLLDDYLCPAMK  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  203  KSVKTMRKGEIAELTVKPTYCF  224


 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 104/199 (52%), Gaps = 9/199 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGG  521
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+  D  
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDVTGDKK  257

Query  522  IFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALTK  689
            + KK++  GE ++ P +   V V Y  +L+DGT+  +     + +E+   EG F  +L +
Sbjct  258  VLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSESLDR  317

Query  690  AVKTMKKGEKVQLTVKPQY  746
            A+ TM+KGE+  +T+   Y
Sbjct  318  AIMTMRKGEEAIVTISSDY  336


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 41/84 (49%), Gaps = 4/84 (5%)
 Frame = +3

Query  519  GIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCPALT  686
            G+ KK+L +G  W+ P   DE+ V Y  +LEDG +   S       EF + +G       
Sbjct  30   GLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQGEVIKGWD  89

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
            + + TMK+ E+    + P   +GE
Sbjct  90   EGIATMKRSERAIFIIPPNLAYGE  113



>ref|XP_009764944.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X3 [Nicotiana 
sylvestris]
Length=531

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DE  VKY A   DG  +++SD  VEF++ + + CPA+ 
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDDGVEFSLLDDYLCPAMK  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  203  KSVKTMRKGEIAELTVKPTYCF  224


 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 111/218 (51%), Gaps = 14/218 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D++L   N V  +      GD G+ KK++KEG GW TP+  DE  V Y  +  DG     
Sbjct  129  DIELVSWNSVRDI-----TGDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSR  183

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            S D     +F+L    +     + +KTM+KGE    T+ P   Y   G    + PN  L 
Sbjct  184  SDD---GVEFSLLDDYLCPAMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLN  238

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS---  635
              +EL+SW +V D+  D  + KK++  GE ++ P +   V V Y  +L+DGT+  +    
Sbjct  239  IHLELISWKTVVDVTGDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSD  298

Query  636  -DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQY  746
             + +E+   EG F  +L +A+ TM+KGE+  +T+   Y
Sbjct  299  DEPLEYACLEGKFSESLDRAIMTMRKGEEAIVTISSDY  336


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009764942.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X1 [Nicotiana 
sylvestris]
Length=532

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DE  VKY A   DG  +++SD  VEF++ + + CPA+ 
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDDGVEFSLLDDYLCPAMK  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  203  KSVKTMRKGEIAELTVKPTYCF  224


 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 111/218 (51%), Gaps = 14/218 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D++L   N V  +      GD G+ KK++KEG GW TP+  DE  V Y  +  DG     
Sbjct  129  DIELVSWNSVRDI-----TGDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSR  183

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            S D     +F+L    +     + +KTM+KGE    T+ P   Y   G    + PN  L 
Sbjct  184  SDD---GVEFSLLDDYLCPAMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLN  238

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS---  635
              +EL+SW +V D+  D  + KK++  GE ++ P +   V V Y  +L+DGT+  +    
Sbjct  239  IHLELISWKTVVDVTGDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSD  298

Query  636  -DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQY  746
             + +E+   EG F  +L +A+ TM+KGE+  +T+   Y
Sbjct  299  DEPLEYACLEGKFSESLDRAIMTMRKGEEAIVTISSDY  336


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009764943.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Nicotiana 
sylvestris]
Length=532

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DE  VKY A   DG  +++SD  VEF++ + + CPA+ 
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDDGVEFSLLDDYLCPAMK  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  203  KSVKTMRKGEIAELTVKPTYCF  224


 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 111/218 (51%), Gaps = 14/218 (6%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            D++L   N V  +      GD G+ KK++KEG GW TP+  DE  V Y  +  DG     
Sbjct  129  DIELVSWNSVRDI-----TGDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSR  183

Query  285  SRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQ  464
            S D     +F+L    +     + +KTM+KGE    T+ P   Y   G    + PN  L 
Sbjct  184  SDD---GVEFSLLDDYLCPAMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLN  238

Query  465  FDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS---  635
              +EL+SW +V D+  D  + KK++  GE ++ P +   V V Y  +L+DGT+  +    
Sbjct  239  IHLELISWKTVVDVTGDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSD  298

Query  636  -DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQY  746
             + +E+   EG F  +L +A+ TM+KGE+  +T+   Y
Sbjct  299  DEPLEYACLEGKFSESLDRAIMTMRKGEEAIVTISSDY  336


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_004493326.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cicer arietinum]
Length=527

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 150/202 (74%), Gaps = 0/202 (0%)
 Frame = +3

Query  153  KEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ  332
            +EIG+QGL K++++ G  W+TP  GD+VEVH+ G + +G   +SS D+G+ F F LG G+
Sbjct  17   REIGNQGLTKRILRNGITWQTPFSGDQVEVHFRGQVENGPSLESSYDKGSSFHFKLGHGE  76

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  512
            VIKGWD+G+ TMKKGE  I  IPP+LAYGE GSPP IPPNATL FD+E+LSW +++D+  
Sbjct  77   VIKGWDEGVATMKKGERAILKIPPNLAYGEVGSPPLIPPNATLIFDIEMLSWSTIRDLTS  136

Query  513  DGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALTKA  692
            DGGI KK++ +GE W  PK+ DEV VKYEARLE+G L+     VEF V +G+ CPA++ A
Sbjct  137  DGGIMKKIIKDGEGWATPKELDEVLVKYEARLENGKLMKSDKCVEFNVSDGYLCPAMSIA  196

Query  693  VKTMKKGEKVQLTVKPQYGFGE  758
            VKTM+KGE  +L +K  YG  +
Sbjct  197  VKTMRKGEVAELALKLSYGLTQ  218


 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 100/205 (49%), Gaps = 16/205 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
             D G+ KK++K+G GW TP+  DEV V Y   L +G    S +      +F +  G +  
Sbjct  136  SDGGIMKKIIKDGEGWATPKELDEVLVKYEARLENGKLMKSDK----CVEFNVSDGYLCP  191

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPT------IPPNATLQFDVELLSWVSVKD  503
                 +KTM+KGE     +   L+YG + +         +P    +   +EL+SW  V D
Sbjct  192  AMSIAVKTMRKGEVAELALK--LSYGLTQNSNRAIELDGLPDPNLISIKLELVSWKVVTD  249

Query  504  ICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEGHF  671
            I  D  I KK+   GE ++ P +  +V V Y  + EDG ++    +K +  EFT +E   
Sbjct  250  IVGDKKILKKINIAGEGFDRPNEGSQVKVIYFCKGEDGNIIETKGSKEEPFEFTTQEEQV  309

Query  672  CPALTKAVKTMKKGEKVQLTVKPQY  746
               L +A+ TMKK E   +TV  +Y
Sbjct  310  NEGLERAIMTMKKAEHALVTVNAEY  334


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 72/157 (46%), Gaps = 11/157 (7%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            +GD+ + KK+   G G++ P  G +V+V Y     DG   ++   +  PF+FT  + QV 
Sbjct  251  VGDKKILKKINIAGEGFDRPNEGSQVKVIYFCKGEDGNIIETKGSKEEPFEFTTQEEQVN  310

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK------  500
            +G ++ I TMKK E  + T+  +     S        N  L ++VEL+ ++  K      
Sbjct  311  EGLERAIMTMKKAEHALVTVNAEYFRDHSNLQGNKTNNKILHYEVELVDFIKEKPFWKMD  370

Query  501  -----DICKDGGIFKKVLAEGEKWENPKDPDEVSVKY  596
                 + C+ G     +L + + +       E +VKY
Sbjct  371  TIEKLEACEQGKHDGNLLFKAQNFRRASQKYEKAVKY  407



>ref|XP_009764945.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X4 [Nicotiana 
sylvestris]
Length=525

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DE  VKY A   DG  +++SD  VEF++ + + CPA+ 
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDDGVEFSLLDDYLCPAMK  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  203  KSVKTMRKGEIAELTVKPTYCF  224


 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 104/199 (52%), Gaps = 9/199 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGG  521
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+  D  
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDVTGDKK  257

Query  522  IFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALTK  689
            + KK++  GE ++ P +   V V Y  +L+DGT+  +     + +E+   EG F  +L +
Sbjct  258  VLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSESLDR  317

Query  690  AVKTMKKGEKVQLTVKPQY  746
            A+ TM+KGE+  +T+   Y
Sbjct  318  AIMTMRKGEEAIVTISSDY  336


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_009764949.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X7 [Nicotiana 
sylvestris]
Length=524

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 153/202 (76%), Gaps = 1/202 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            E  IG +GL KK++++G  W+TP PGDE++VHY+  L DG  FDSS D+G PF+F LGQG
Sbjct  23   ETVIGKEGLTKKILQKGNSWKTPLPGDEIQVHYSVKLEDGEIFDSSHDKGKPFEFKLGQG  82

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKGWD+GI TMK+ E  IF IPP+LAYGE+GSPP IPPN+TL FD+EL+SW SV+DI 
Sbjct  83   EVIKGWDEGIATMKRSERAIFIIPPNLAYGETGSPPLIPPNSTLVFDIELVSWNSVRDIT  142

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALT  686
             DGGI KK++ EGE W  PKD DE  VKY A   DG  +++SD  VEF++ + + CPA+ 
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDDGVEFSLLDDYLCPAMK  202

Query  687  KAVKTMKKGEKVQLTVKPQYGF  752
            K+VKTM+KGE  +LTVKP Y F
Sbjct  203  KSVKTMRKGEIAELTVKPTYCF  224


 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 104/199 (52%), Gaps = 9/199 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP+  DE  V Y  +  DG     S D     +F+L    +  
Sbjct  143  GDGGILKKIIKEGEGWATPKDVDEALVKYVASSADGKTLSRSDD---GVEFSLLDDYLCP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGG  521
               + +KTM+KGE    T+ P   Y   G    + PN  L   +EL+SW +V D+  D  
Sbjct  200  AMKKSVKTMRKGEIAELTVKP--TYCFDGVENGMQPNLNLNIHLELISWKTVVDVTGDKK  257

Query  522  IFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALTK  689
            + KK++  GE ++ P +   V V Y  +L+DGT+  +     + +E+   EG F  +L +
Sbjct  258  VLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSESLDR  317

Query  690  AVKTMKKGEKVQLTVKPQY  746
            A+ TM+KGE+  +T+   Y
Sbjct  318  AIMTMRKGEEAIVTISSDY  336


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KKL+K G G++ P  G  V+V Y G L DGT FD       P ++   +G+  +
Sbjct  254  GDKKVLKKLIKVGEGYDRPNEGSLVKVVYIGKLQDGTVFDRKGSDDEPLEYACLEGKFSE  313

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGS  431
              D+ I TM+KGE  I TI  D    E  S
Sbjct  314  SLDRAIMTMRKGEEAIVTISSDYCQVEEVS  343



>ref|XP_007162035.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
 gb|ESW34029.1| hypothetical protein PHAVU_001G118200g [Phaseolus vulgaris]
Length=610

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  KEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQ  332
            KEIG++GL K+++++G  W+TP  GDEVEVH+ G + +G   +SS D+G+ F+F LGQ +
Sbjct  97   KEIGNEGLTKRILRKGVTWQTPLSGDEVEVHFRGHVENGASLESSYDKGSTFRFKLGQCE  156

Query  333  VIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICK  512
            VIKGWD+G+ TMKKGE  IF IPP+LAYGE GSPP IPPNATL +D+E+L+W +++D+  
Sbjct  157  VIKGWDEGVATMKKGERAIFKIPPNLAYGEEGSPPLIPPNATLIYDIEMLTWSTIRDLTG  216

Query  513  DGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-VEFTVEEGHFCPALTK  689
            DGGI KK+  EGE W  P++ DEV VKYEARLE+G LV+KSD  VEF V +G+ CPA++ 
Sbjct  217  DGGIMKKLTREGEGWATPREADEVLVKYEARLENGMLVSKSDQGVEFNVSDGYLCPAMSI  276

Query  690  AVKTMKKGEKVQLTVKPQYGFGE  758
            AVKTM+KGE   L V+  YG  +
Sbjct  277  AVKTMRKGEVADLAVRLFYGHSQ  299


 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 106/210 (50%), Gaps = 17/210 (8%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KKL +EG GW TP   DEV V Y   L +G    S  D+G   +F +  G +  
Sbjct  216  GDGGIMKKLTREGEGWATPREADEVLVKYEARLENGM-LVSKSDQGV--EFNVSDGYLCP  272

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI-------PPNATL-QFDVELLSWVSV  497
                 +KTM+KGE  +  +   L YG S +   I       PP++ L    +EL+SW  V
Sbjct  273  AMSIAVKTMRKGE--VADLAVRLFYGHSQNSNMITELDGVPPPDSNLTSIKLELVSWKIV  330

Query  498  KDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLV----AKSDIVEFTVEEG  665
             D+  D  I KK+   GE ++ P +  +V V Y  + ED T++    ++ +  EFT +E 
Sbjct  331  TDVTGDKKIMKKIKKVGEGFDRPNEGSQVKVIYLCKGEDDTIIERKGSEEEPFEFTTQEE  390

Query  666  HFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
                 L +A+ TMKK E+  +TV  +Y  G
Sbjct  391  QVPEGLERAIMTMKKAEQALVTVDAEYLCG  420


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 50/101 (50%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKG  377
            G G++ P  G +V+V Y     D T  +       PF+FT  + QV +G ++ I TMKK 
Sbjct  347  GEGFDRPNEGSQVKVIYLCKGEDDTIIERKGSEEEPFEFTTQEEQVPEGLERAIMTMKKA  406

Query  378  ECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVK  500
            E  + T+  +   G + S      +  L ++VEL+ +V  K
Sbjct  407  EQALVTVDAEYLCGCNNSQGNTENHKVLYYEVELVDFVKEK  447



>ref|XP_006364803.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum 
tuberosum]
Length=536

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 161/224 (72%), Gaps = 6/224 (3%)
 Frame = +3

Query  99   MDDLDLPDDNPV---MKVGEEKEI--GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            M D +    N V    K+ E +EI  G +GL+KK++++G  W+TP  GDE++VHY   L 
Sbjct  1    MGDFNSKKSNKVNFETKIQELQEIVIGKEGLRKKILQKGNSWKTPFHGDEIQVHYRVKLQ  60

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  443
            DG  FDSS DRG PF F LGQG+VIKGWD+GI TMKK E  IFTIPP+LAYGE GSPP I
Sbjct  61   DGEFFDSSYDRGKPFTFKLGQGEVIKGWDEGIATMKKSERAIFTIPPNLAYGEIGSPPLI  120

Query  444  PPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTL  623
            PPN+TL F++EL+SW S++DI  DGGI KK++ EG+ W  P+D DEV VKY A   DG +
Sbjct  121  PPNSTLIFEIELISWNSIRDISGDGGILKKIIKEGQGWATPRDVDEVLVKYVASSADGII  180

Query  624  VAK-SDIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGF  752
            +++  D VEF++ EGH  PA+ K++KTM+KGE V+LTVKP   F
Sbjct  181  LSQYDDAVEFSLMEGHLYPAMKKSLKTMRKGEIVELTVKPACNF  224


 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 102/203 (50%), Gaps = 7/203 (3%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP   DEV V Y  +  DG       D     +F+L +G +  
Sbjct  143  GDGGILKKIIKEGQGWATPRDVDEVLVKYVASSADGIILSQYDD---AVEFSLMEGHLYP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGG  521
               + +KTM+KGE    T+ P   +   G       N+ L   +EL+SW SV D+  D  
Sbjct  200  AMKKSLKTMRKGEIVELTVKPACNFDGDGIGILQSSNSNLIIHLELISWKSVVDVIGDNK  259

Query  522  IFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALTK  689
            + KK++  GE +++P +     V Y  +L+DGT+  +     +  E+   EG     L +
Sbjct  260  VLKKLIKAGEGYDHPNEGSLAKVIYIGKLQDGTIFERKGSDEEPFEYVCLEGQLNENLDR  319

Query  690  AVKTMKKGEKVQLTVKPQYGFGE  758
            A+ TMKKGE+  +T+     F E
Sbjct  320  AIMTMKKGEEAIVTINSDSMFYE  342


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +3

Query  159  IGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVI  338
            IGD  + KKL+K G G++ P  G   +V Y G L DGT F+       PF++   +GQ+ 
Sbjct  255  IGDNKVLKKLIKAGEGYDHPNEGSLAKVIYIGKLQDGTIFERKGSDEEPFEYVCLEGQLN  314

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGE  422
            +  D+ I TMKKGE  I TI  D  + E
Sbjct  315  ENLDRAIMTMKKGEEAIVTINSDSMFYE  342



>ref|XP_006433656.1| hypothetical protein CICLE_v10003372mg [Citrus clementina]
 gb|ESR46896.1| hypothetical protein CICLE_v10003372mg [Citrus clementina]
Length=606

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 161/212 (76%), Gaps = 5/212 (2%)
 Frame = +3

Query  135  MKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKF  314
            +KVGEE+ +G+ G+KKKL+K G  W+TPE GDEV +HY GTLLDGTKFDS+RDR  P  F
Sbjct  35   LKVGEERGLGNSGIKKKLLKNGVDWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPLTF  94

Query  315  TLGQGQVIKGWDQGIKTMKKGECCI--FTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
             LG GQV  G D GI TMKK EC +  FT+P +L +G  G   ++PPN+ +QF+VEL+SW
Sbjct  95   KLGTGQVATGLDNGIITMKKRECAVFTFTLPSELRFGVEGR-DSLPPNSVVQFEVELVSW  153

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTVEE  662
            ++V D+ KDGGI KK+L +GE+  +P D DEV VKY+  L DGT+VAK+  + VEF +++
Sbjct  154  ITVVDLSKDGGIVKKILEKGERDASPGDLDEVLVKYQVMLGDGTMVAKTPEEGVEFYLKD  213

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GHFCP L+KA+ TMKKGEKV+L ++PQY FGE
Sbjct  214  GHFCPVLSKAILTMKKGEKVKLVIQPQYAFGE  245


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 103/207 (50%), Gaps = 13/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++++G    +P   DEV V Y   L DGT    + + G   +F L  G     
Sbjct  162  DGGIVKKILEKGERDASPGDLDEVLVKYQVMLGDGTMVAKTPEEGV--EFYLKDGHFCPV  219

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSPP-----TIPPNATLQFDVELLSWVSVKDIC  509
              + I TMKKGE     I P  A+GE          TIP N+ L F++ELLS+  V D+ 
Sbjct  220  LSKAILTMKKGEKVKLVIQPQYAFGEQRRDACDGFGTIPRNSALDFNLELLSFKHVVDVT  279

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  + KK+L EGE   +  +   V++ Y ARLEDGT+  K        +EF  +E    
Sbjct  280  GDSKVVKKILKEGE-GTSADEGATVTISYIARLEDGTVFEKKGYDGEQPLEFITDEEQGI  338

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
              L +   TMKK E   +T+  +YGFG
Sbjct  339  AGLDRVAATMKKEEWAIVTINHEYGFG  365


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (50%), Gaps = 5/117 (4%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSS-RDRGTPFKFTLGQGQVI  338
            GD  + KK++KEG G    E G  V + Y   L DGT F+    D   P +F   + Q I
Sbjct  280  GDSKVVKKILKEGEGTSADE-GATVTISYIARLEDGTVFEKKGYDGEQPLEFITDEEQGI  338

Query  339  KGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPNATLQFDVELLSWVSVK  500
             G D+   TMKK E  I TI  +  +G   +     T+P  A L ++VE++ ++  K
Sbjct  339  AGLDRVAATMKKEEWAIVTINHEYGFGNVEAKRDLATVPSCAKLYYEVEMMDFIKEK  395



>ref|XP_002526205.1| peptidylprolyl isomerase, putative [Ricinus communis]
 gb|EEF36184.1| peptidylprolyl isomerase, putative [Ricinus communis]
Length=523

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 152/203 (75%), Gaps = 1/203 (0%)
 Frame = +3

Query  150  EKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQG  329
            EK IG  GL+K+++K G  W+TP PGDEVEVH+ G +  G   DS+RD+G PF F L QG
Sbjct  18   EKIIGTHGLRKRILKRGISWQTPFPGDEVEVHFNGHVEGGACLDSTRDKGAPFVFKLDQG  77

Query  330  QVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDIC  509
            +VIKG D+GI TMKKGE  IF +PP+L YGE+GSPP +P NA+L FDVE++SW S+ D+ 
Sbjct  78   EVIKGLDEGIATMKKGERAIFKVPPNLGYGEAGSPPLVPSNASLVFDVEMISWSSIMDLT  137

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS-DIVEFTVEEGHFCPALT  686
             DGGI KK+  +GE W  P+D DEV VKYE RLE+G ++++S +IVEF + +G+ CPAL 
Sbjct  138  GDGGILKKITKDGEGWATPRDGDEVLVKYEVRLENGLVLSRSEEIVEFHIGDGYLCPALG  197

Query  687  KAVKTMKKGEKVQLTVKPQYGFG  755
            KAVKTM++GE+ ++ VK  YGF 
Sbjct  198  KAVKTMRRGEQAEVAVKSSYGFN  220


 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 102/199 (51%), Gaps = 9/199 (5%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK+ K+G GW TP  GDEV V Y   L +G     S +     +F +G G +  
Sbjct  138  GDGGILKKITKDGEGWATPRDGDEVLVKYEVRLENGLVLSRSEE---IVEFHIGDGYLCP  194

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGG  521
               + +KTM++GE     +     +  +G+      N T+Q  +EL++W S+ DI  D  
Sbjct  195  ALGKAVKTMRRGEQAEVAVKSSYGFNPNGNEVPTVSNFTIQ--LELVTWRSIIDITGDRK  252

Query  522  IFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI----VEFTVEEGHFCPALTK  689
            + KK+   G+ +E+P +  +V V Y  +LEDGT++ K        E+   E      L +
Sbjct  253  VLKKITKAGDGFEHPNEGSKVKVVYTGKLEDGTVLEKRGTNEEPFEYITLEEQINEGLDR  312

Query  690  AVKTMKKGEKVQLTVKPQY  746
            A+ TMK+GE   +TV  +Y
Sbjct  313  AIMTMKRGEHCLVTVTAEY  331


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 64/110 (58%), Gaps = 1/110 (1%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD+ + KK+ K G G+E P  G +V+V YTG L DGT  +       PF++   + Q+ +
Sbjct  249  GDRKVLKKITKAGDGFEHPNEGSKVKVVYTGKLEDGTVLEKRGTNEEPFEYITLEEQINE  308

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSWV  491
            G D+ I TMK+GE C+ T+  +    +  S   +P N+ L ++V+L+ ++
Sbjct  309  GLDRAIMTMKRGEHCLVTVTAEY-LSDHDSSDVLPANSVLHYEVQLIDFI  357



>gb|KHG02788.1| Peptidyl-prolyl cis-trans isomerase FKBP65 -like protein [Gossypium 
arboreum]
Length=603

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 159/212 (75%), Gaps = 3/212 (1%)
 Frame = +3

Query  129  PVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPF  308
            P +KVGEE+E+G+ G+KKKL+  G  WETPE GDEV VH+ GTLL+G KF S+RD G P 
Sbjct  32   PPLKVGEERELGNSGIKKKLLNNGIHWETPEFGDEVTVHFVGTLLNGIKFCSTRDNGEPI  91

Query  309  KFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTIPPNATLQFDVELLSW  488
             F LG+G+V KG D GI TMKKGE  +FT+PPD  YG  G    +PP++ +QF+VELLSW
Sbjct  92   TFKLGEGKVAKGLDNGITTMKKGERVLFTLPPDFGYGAEGR-DGVPPDSIVQFEVELLSW  150

Query  489  VSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS--DIVEFTVEE  662
            ++V DICKDGGI KK++ +GE+ E P D DEV VKY+  L  GT+VAK+  +  EF V++
Sbjct  151  ITVVDICKDGGIIKKIMEKGERNERPSDLDEVLVKYQVTLAGGTIVAKTPEEGYEFYVKD  210

Query  663  GHFCPALTKAVKTMKKGEKVQLTVKPQYGFGE  758
            GH  PALTKA+ TMK+GEKV+L V+P+Y FG+
Sbjct  211  GHLFPALTKAIITMKRGEKVKLIVQPKYAFGD  242


 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 112/207 (54%), Gaps = 12/207 (6%)
 Frame = +3

Query  165  DQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIKG  344
            D G+ KK++++G   E P   DEV V Y  TL  GT    + + G  ++F +  G +   
Sbjct  159  DGGIIKKIMEKGERNERPSDLDEVLVKYQVTLAGGTIVAKTPEEG--YEFYVKDGHLFPA  216

Query  345  WDQGIKTMKKGECCIFTIPPDLAYGESGSP-----PTIPPNATLQFDVELLSWVSVKDIC  509
              + I TMK+GE     + P  A+G+ G       P+IPPN+ L  ++EL+S+  V D+ 
Sbjct  217  LTKAIITMKRGEKVKLIVQPKYAFGDKGKEATDGFPSIPPNSVLNVELELVSFKPVIDVT  276

Query  510  KDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDI-----VEFTVEEGHFC  674
             D  +FKK+L EGE      +   V++ Y A LEDGT+  +  +     +EF  +E    
Sbjct  277  GDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFERKGVDGGQPLEFITDEEQVI  336

Query  675  PALTKAVKTMKKGEKVQLTVKPQYGFG  755
            P L +A  TMKKGE+  LT+ P+YGFG
Sbjct  337  PGLDRAAATMKKGEQALLTICPEYGFG  363


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 70/136 (51%), Gaps = 9/136 (7%)
 Frame = +3

Query  105  DLDLPDDNPVMKVGEEKEIGDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDS  284
            +L+L    PV+ V      GD  + KK++KEG G      G  V + Y   L DGT F+ 
Sbjct  263  ELELVSFKPVIDV-----TGDSKVFKKILKEGEGALVANEGAAVTISYIAWLEDGTVFER  317

Query  285  S-RDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSP---PTIPPN  452
               D G P +F   + QVI G D+   TMKKGE  + TI P+  +G   +      +PP+
Sbjct  318  KGVDGGQPLEFITDEEQVIPGLDRAAATMKKGEQALLTICPEYGFGSVVAERDLAVVPPS  377

Query  453  ATLQFDVELLSWVSVK  500
            + L ++VE+L +V  K
Sbjct  378  SNLVYEVEMLDFVKEK  393



>ref|XP_010327744.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like isoform X2 [Solanum 
lycopersicum]
Length=494

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 160/225 (71%), Gaps = 6/225 (3%)
 Frame = +3

Query  99   MDDLDLPDDNPV---MKVGEEKEI--GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLL  263
            M D +    N V    K+ + +EI  G +GL+KK++++G  W+TP  GDE++VHY   L 
Sbjct  1    MGDFNSKKSNKVNFETKIQDSQEIVIGKEGLRKKILQKGNSWKTPFHGDEIQVHYRVKLQ  60

Query  264  DGTKFDSSRDRGTPFKFTLGQGQVIKGWDQGIKTMKKGECCIFTIPPDLAYGESGSPPTI  443
            DG  FDSS DRG  F F LGQG+VIKGWD+GI TMKK E  I TIPP+LAYGE GSPP I
Sbjct  61   DGEFFDSSYDRGKTFTFKLGQGEVIKGWDEGIATMKKSERAILTIPPNLAYGEIGSPPLI  120

Query  444  PPNATLQFDVELLSWVSVKDICKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTL  623
            PPN+ L F++EL+SW S++DI  DGGI KK++ EG+ W  P+D DEV VKY A   DG +
Sbjct  121  PPNSILIFEIELISWNSIRDISGDGGILKKIIKEGQGWATPRDVDEVLVKYVASSADGKI  180

Query  624  VAKS-DIVEFTVEEGHFCPALTKAVKTMKKGEKVQLTVKPQYGFG  755
            +++S D VEF++ EGH  PA+ K++KTM+KGE V+L VKP Y FG
Sbjct  181  LSQSDDAVEFSLMEGHLYPAMKKSLKTMRKGEIVELIVKPPYYFG  225


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 93/204 (46%), Gaps = 33/204 (16%)
 Frame = +3

Query  162  GDQGLKKKLVKEGAGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGQVIK  341
            GD G+ KK++KEG GW TP   DEV V Y  +  DG     S D     +F+L +G +  
Sbjct  143  GDGGILKKIIKEGQGWATPRDVDEVLVKYVASSADGKILSQSDD---AVEFSLMEGHLYP  199

Query  342  GWDQGIKTMKKGECCIFTIPPDLAYGES-----GSPPTIPPNATLQFDVELLSWVSVKDI  506
               + +KTM+KGE     + P   +G S     G       N+ L   +EL+SW SV D+
Sbjct  200  AMKKSLKTMRKGEIVELIVKPPYYFGNSSFDGDGIGILQSSNSNLIIHLELISWKSVVDV  259

Query  507  CKDGGIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKSDIVEFTVEEGHFCPALT  686
              D  + KK++  GE +++P                          E ++ +G     + 
Sbjct  260  IGDNKVLKKLIKAGEGYDHPN-------------------------EGSLAKGQLNEYVD  294

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
            +A+ TMKKGE+  +T+     F E
Sbjct  295  RAIMTMKKGEEAIVTINSHSMFYE  318


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (49%), Gaps = 4/84 (5%)
 Frame = +3

Query  519  GIFKKVLAEGEKWENPKDPDEVSVKYEARLEDGTLVAKS----DIVEFTVEEGHFCPALT  686
            G+ KK+L +G  W+ P   DE+ V Y  +L+DG     S        F + +G       
Sbjct  30   GLRKKILQKGNSWKTPFHGDEIQVHYRVKLQDGEFFDSSYDRGKTFTFKLGQGEVIKGWD  89

Query  687  KAVKTMKKGEKVQLTVKPQYGFGE  758
            + + TMKK E+  LT+ P   +GE
Sbjct  90   EGIATMKKSERAILTIPPNLAYGE  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1469386858550