BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11470

Length=990
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609918.1|  PREDICTED: probable folate-biopterin transpo...    301   1e-94   Nicotiana tomentosiformis
ref|XP_006366264.1|  PREDICTED: probable folate-biopterin transpo...    300   7e-94   Solanum tuberosum [potatoes]
ref|XP_009774529.1|  PREDICTED: probable folate-biopterin transpo...    297   6e-93   Nicotiana sylvestris
ref|XP_009615688.1|  PREDICTED: probable folate-biopterin transpo...    285   3e-88   Nicotiana tomentosiformis
ref|XP_004241672.1|  PREDICTED: probable folate-biopterin transpo...    281   1e-86   Solanum lycopersicum
ref|XP_011082613.1|  PREDICTED: probable folate-biopterin transpo...    280   3e-86   Sesamum indicum [beniseed]
ref|XP_004305470.2|  PREDICTED: probable folate-biopterin transpo...    272   3e-83   Fragaria vesca subsp. vesca
ref|XP_002272239.1|  PREDICTED: probable folate-biopterin transpo...    270   3e-82   
ref|XP_010687327.1|  PREDICTED: probable folate-biopterin transpo...    264   5e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008365736.1|  PREDICTED: LOW QUALITY PROTEIN: probable fol...    262   3e-79   
ref|XP_002512755.1|  transporter, putative                              258   3e-78   
ref|XP_009609917.1|  PREDICTED: probable folate-biopterin transpo...    257   5e-77   Nicotiana tomentosiformis
ref|XP_007023526.1|  Major facilitator superfamily protein              253   5e-76   
ref|XP_009354223.1|  PREDICTED: probable folate-biopterin transpo...    251   6e-75   Pyrus x bretschneideri [bai li]
ref|XP_009375475.1|  PREDICTED: probable folate-biopterin transpo...    250   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_008342828.1|  PREDICTED: probable folate-biopterin transpo...    249   1e-74   
ref|XP_007215269.1|  hypothetical protein PRUPE_ppa004652mg             249   2e-74   
gb|EYU24569.1|  hypothetical protein MIMGU_mgv1a005024mg                248   5e-74   Erythranthe guttata [common monkey flower]
emb|CAN74675.1|  hypothetical protein VITISV_038367                     246   2e-73   Vitis vinifera
ref|XP_008228849.1|  PREDICTED: probable folate-biopterin transpo...    246   2e-73   Prunus mume [ume]
ref|XP_002299158.2|  integral membrane transporter family protein       243   4e-72   
gb|KDP41941.1|  hypothetical protein JCGZ_26959                         239   5e-71   Jatropha curcas
ref|XP_012067460.1|  PREDICTED: probable folate-biopterin transpo...    239   9e-71   Jatropha curcas
ref|XP_011034592.1|  PREDICTED: probable folate-biopterin transpo...    239   2e-70   Populus euphratica
ref|XP_006357077.1|  PREDICTED: probable folate-biopterin transpo...    238   7e-70   Solanum tuberosum [potatoes]
ref|XP_010265508.1|  PREDICTED: probable folate-biopterin transpo...    236   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_004244510.1|  PREDICTED: probable folate-biopterin transpo...    236   2e-69   Solanum lycopersicum
ref|XP_008220649.1|  PREDICTED: LOW QUALITY PROTEIN: probable fol...    236   2e-69   Prunus mume [ume]
ref|XP_007222125.1|  hypothetical protein PRUPE_ppa004658mg             234   9e-69   Prunus persica
ref|XP_009106695.1|  PREDICTED: probable folate-biopterin transpo...    233   2e-68   
emb|CDX87359.1|  BnaA07g35140D                                          233   2e-68   
ref|XP_011081988.1|  PREDICTED: probable folate-biopterin transpo...    233   2e-68   Sesamum indicum [beniseed]
ref|XP_010914026.1|  PREDICTED: probable folate-biopterin transpo...    233   4e-68   Elaeis guineensis
ref|XP_002887801.1|  integral membrane transporter family protein       233   4e-68   Arabidopsis lyrata subsp. lyrata
ref|NP_178089.1|  probable folate-biopterin transporter 3               233   5e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265507.1|  PREDICTED: probable folate-biopterin transpo...    231   1e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007011686.1|  Major facilitator superfamily protein              230   4e-67   
gb|KFK42482.1|  hypothetical protein AALP_AA2G262800                    228   4e-67   Arabis alpina [alpine rockcress]
ref|XP_009394927.1|  PREDICTED: probable folate-biopterin transpo...    230   6e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324921.1|  hypothetical protein POPTR_0018s02750g             229   8e-67   Populus trichocarpa [western balsam poplar]
dbj|BAK07100.1|  predicted protein                                      226   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002283372.1|  PREDICTED: probable folate-biopterin transpo...    229   1e-66   Vitis vinifera
ref|XP_011036709.1|  PREDICTED: probable folate-biopterin transpo...    228   1e-66   Populus euphratica
ref|XP_009390541.1|  PREDICTED: probable folate-biopterin transpo...    229   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008377495.1|  PREDICTED: probable folate-biopterin transpo...    227   2e-66   
ref|XP_010104513.1|  hypothetical protein L484_025485                   228   3e-66   
ref|XP_002515410.1|  transporter, putative                              228   3e-66   Ricinus communis
ref|XP_009359139.1|  PREDICTED: probable folate-biopterin transpo...    228   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_009359096.1|  PREDICTED: probable folate-biopterin transpo...    228   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_004291974.1|  PREDICTED: probable folate-biopterin transpo...    226   1e-65   Fragaria vesca subsp. vesca
ref|XP_006450260.1|  hypothetical protein CICLE_v10008084mg             225   3e-65   Citrus clementina [clementine]
ref|XP_012076403.1|  PREDICTED: probable folate-biopterin transpo...    224   8e-65   Jatropha curcas
ref|XP_007011687.1|  Major facilitator superfamily protein isoform 1    224   1e-64   
ref|XP_010929183.1|  PREDICTED: probable folate-biopterin transpo...    224   1e-64   Elaeis guineensis
ref|XP_010417642.1|  PREDICTED: probable folate-biopterin transpo...    221   6e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010474503.1|  PREDICTED: probable folate-biopterin transpo...    215   6e-64   Camelina sativa [gold-of-pleasure]
emb|CDX88152.1|  BnaA06g27430D                                          221   9e-64   
gb|KJB55121.1|  hypothetical protein B456_009G063900                    221   1e-63   Gossypium raimondii
ref|XP_006301270.1|  hypothetical protein CARUB_v10021670mg             221   1e-63   Capsella rubella
ref|NP_001057012.1|  Os06g0186700                                       221   2e-63   
ref|XP_003560977.1|  PREDICTED: probable folate-biopterin transpo...    221   2e-63   Brachypodium distachyon [annual false brome]
ref|XP_009151029.1|  PREDICTED: probable folate-biopterin transpo...    220   3e-63   Brassica rapa
gb|KFK27767.1|  hypothetical protein AALP_AA8G426300                    219   4e-63   Arabis alpina [alpine rockcress]
ref|XP_010429876.1|  PREDICTED: probable folate-biopterin transpo...    219   4e-63   Camelina sativa [gold-of-pleasure]
emb|CDX80483.1|  BnaC07g29610D                                          219   4e-63   
gb|AAO64142.1|  putative membrane protein                               219   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197887.1|  probable folate-biopterin transporter 2               219   5e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KHG17661.1|  Shikimate kinase                                        218   6e-63   Gossypium arboreum [tree cotton]
ref|XP_010421353.1|  PREDICTED: probable folate-biopterin transpo...    218   1e-62   
ref|XP_009129989.1|  PREDICTED: probable folate-biopterin transpo...    218   2e-62   Brassica rapa
emb|CDY05381.1|  BnaC02g40890D                                          218   2e-62   
ref|XP_006289494.1|  hypothetical protein CARUB_v10003028mg             218   2e-62   Capsella rubella
ref|XP_007161137.1|  hypothetical protein PHAVU_001G045500g             217   3e-62   Phaseolus vulgaris [French bean]
ref|XP_010454828.1|  PREDICTED: probable folate-biopterin transpo...    217   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_011031425.1|  PREDICTED: probable folate-biopterin transpo...    217   5e-62   Populus euphratica
emb|CDP07891.1|  unnamed protein product                                216   5e-62   Coffea canephora [robusta coffee]
gb|EEC80148.1|  hypothetical protein OsI_21953                          219   6e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_009615878.1|  PREDICTED: probable folate-biopterin transpo...    216   6e-62   Nicotiana tomentosiformis
ref|XP_010927961.1|  PREDICTED: probable folate-biopterin transpo...    216   8e-62   
ref|XP_006394753.1|  hypothetical protein EUTSA_v10004061mg             216   8e-62   Eutrema salsugineum [saltwater cress]
ref|XP_008794379.1|  PREDICTED: probable folate-biopterin transpo...    216   8e-62   Phoenix dactylifera
ref|XP_002872136.1|  integral membrane transporter family protein       216   1e-61   
ref|XP_010495476.1|  PREDICTED: probable folate-biopterin transpo...    220   1e-61   
ref|XP_009790825.1|  PREDICTED: probable folate-biopterin transpo...    215   2e-61   Nicotiana sylvestris
ref|XP_002309684.1|  hypothetical protein POPTR_0006s28180g             215   2e-61   
gb|EEE65228.1|  hypothetical protein OsJ_20385                          216   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004498793.1|  PREDICTED: probable folate-biopterin transpo...    215   2e-61   Cicer arietinum [garbanzo]
ref|XP_004498792.1|  PREDICTED: probable folate-biopterin transpo...    215   3e-61   
ref|XP_010541554.1|  PREDICTED: probable folate-biopterin transpo...    214   4e-61   Tarenaya hassleriana [spider flower]
ref|XP_008789895.1|  PREDICTED: probable folate-biopterin transpo...    214   5e-61   
ref|XP_008790123.1|  PREDICTED: probable folate-biopterin transpo...    214   5e-61   Phoenix dactylifera
ref|XP_008445272.1|  PREDICTED: probable folate-biopterin transpo...    214   6e-61   Cucumis melo [Oriental melon]
ref|XP_008789896.1|  PREDICTED: probable folate-biopterin transpo...    214   7e-61   Phoenix dactylifera
gb|ERN07070.1|  hypothetical protein AMTR_s00019p00060350               212   2e-60   Amborella trichopoda
gb|KJB55119.1|  hypothetical protein B456_009G063800                    218   3e-60   Gossypium raimondii
ref|XP_006845395.2|  PREDICTED: probable folate-biopterin transpo...    211   3e-60   Amborella trichopoda
ref|XP_011623772.1|  PREDICTED: probable folate-biopterin transpo...    211   3e-60   
gb|KJB55120.1|  hypothetical protein B456_009G063800                    218   9e-60   Gossypium raimondii
ref|XP_010048291.1|  PREDICTED: probable folate-biopterin transpo...    210   2e-59   Eucalyptus grandis [rose gum]
emb|CAC09501.2|  H0711G06.7                                             207   3e-59   Oryza sativa [red rice]
ref|XP_004138696.1|  PREDICTED: probable folate-biopterin transpo...    208   7e-59   Cucumis sativus [cucumbers]
ref|XP_002437984.1|  hypothetical protein SORBIDRAFT_10g005900          208   2e-58   Sorghum bicolor [broomcorn]
gb|EPS69234.1|  hypothetical protein M569_05531                         207   2e-58   Genlisea aurea
ref|NP_001053217.1|  Os04g0499100                                       207   5e-58   
ref|XP_006653566.1|  PREDICTED: probable folate-biopterin transpo...    206   1e-57   Oryza brachyantha
gb|EAY94725.1|  hypothetical protein OsI_16503                          206   2e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_009359095.1|  PREDICTED: probable folate-biopterin transpo...    204   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_004964643.1|  PREDICTED: probable folate-biopterin transpo...    205   3e-57   Setaria italica
ref|XP_004976116.1|  PREDICTED: probable folate-biopterin transpo...    205   3e-57   Setaria italica
ref|XP_003588878.1|  hypothetical protein MTR_1g014250                  204   5e-57   Medicago truncatula
dbj|BAK01020.1|  predicted protein                                      204   5e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008377493.1|  PREDICTED: probable folate-biopterin transpo...    203   8e-57   
gb|EYU22001.1|  hypothetical protein MIMGU_mgv1a005007mg                199   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_003550212.2|  PREDICTED: probable folate-biopterin transpo...    199   3e-55   Glycine max [soybeans]
gb|EMT28403.1|  hypothetical protein F775_17337                         199   4e-55   
gb|AFK35303.1|  unknown                                                 198   6e-55   Lotus japonicus
gb|EMT29625.1|  hypothetical protein F775_06957                         198   9e-55   
dbj|BAK05889.1|  predicted protein                                      197   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003581391.1|  PREDICTED: probable folate-biopterin transpo...    197   2e-54   
ref|XP_003544591.2|  PREDICTED: probable folate-biopterin transpo...    196   4e-54   Glycine max [soybeans]
ref|XP_010532070.1|  PREDICTED: probable folate-biopterin transpo...    196   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_006287981.1|  hypothetical protein CARUB_v10001216mg             191   1e-53   Capsella rubella
ref|XP_002446742.1|  hypothetical protein SORBIDRAFT_06g021580          194   2e-53   Sorghum bicolor [broomcorn]
ref|XP_008790139.1|  PREDICTED: probable folate-biopterin transpo...    188   2e-52   
ref|XP_007224944.1|  hypothetical protein PRUPE_ppa021444mg             186   2e-52   
ref|XP_010905038.1|  PREDICTED: probable folate-biopterin transpo...    190   4e-52   Elaeis guineensis
ref|NP_001190391.1|  probable folate-biopterin transporter 5            189   5e-52   
dbj|BAD44281.1|  putative membrane protein                              188   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197886.3|  probable folate-biopterin transporter 5               189   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265723.1|  PREDICTED: probable folate-biopterin transpo...    189   1e-51   
sp|F4KIL8.2|FBT5_ARATH  RecName: Full=Probable folate-biopterin t...    188   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790138.1|  PREDICTED: probable folate-biopterin transpo...    189   2e-51   Phoenix dactylifera
gb|KCW80541.1|  hypothetical protein EUGRSUZ_C01893                     187   2e-51   Eucalyptus grandis [rose gum]
ref|NP_001190390.1|  probable folate-biopterin transporter 5            189   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006495335.1|  PREDICTED: probable folate-biopterin transpo...    184   6e-51   Citrus sinensis [apfelsine]
ref|XP_011081396.1|  PREDICTED: probable folate-biopterin transpo...    187   8e-51   Sesamum indicum [beniseed]
ref|XP_010048290.1|  PREDICTED: probable folate-biopterin transpo...    186   1e-50   Eucalyptus grandis [rose gum]
ref|XP_010048832.1|  PREDICTED: probable folate-biopterin transpo...    186   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006450267.1|  hypothetical protein CICLE_v10008109mg             183   1e-49   Citrus clementina [clementine]
ref|XP_006483535.1|  PREDICTED: probable folate-biopterin transpo...    183   2e-49   Citrus sinensis [apfelsine]
gb|EMT16404.1|  hypothetical protein F775_14916                         177   3e-49   
ref|XP_008220654.1|  PREDICTED: probable folate-biopterin transpo...    182   3e-49   Prunus mume [ume]
emb|CBI25262.3|  unnamed protein product                                180   6e-49   Vitis vinifera
ref|XP_010104519.1|  hypothetical protein L484_025493                   181   1e-48   Morus notabilis
gb|EMS50413.1|  hypothetical protein TRIUR3_11905                       179   3e-48   Triticum urartu
ref|XP_008347488.1|  PREDICTED: probable folate-biopterin transpo...    175   7e-48   
ref|XP_007223112.1|  hypothetical protein PRUPE_ppa005422mg             178   9e-48   
ref|XP_008377627.1|  PREDICTED: probable folate-biopterin transpo...    178   1e-47   
gb|EAZ31237.1|  hypothetical protein OsJ_15337                          178   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010670827.1|  PREDICTED: probable folate-biopterin transpo...    177   4e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB55110.1|  hypothetical protein B456_009G063700                    177   4e-47   Gossypium raimondii
ref|XP_011649848.1|  PREDICTED: probable folate-biopterin transpo...    176   8e-47   Cucumis sativus [cucumbers]
gb|EEE69726.1|  hypothetical protein OsJ_29410                          174   8e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011031432.1|  PREDICTED: probable folate-biopterin transpo...    176   2e-46   Populus euphratica
ref|XP_007011697.1|  Major facilitator superfamily protein              175   2e-46   
gb|KGN62998.1|  hypothetical protein Csa_2G382710                       176   2e-46   Cucumis sativus [cucumbers]
ref|XP_010670825.1|  PREDICTED: probable folate-biopterin transpo...    175   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009359177.1|  PREDICTED: probable folate-biopterin transpo...    174   3e-46   Pyrus x bretschneideri [bai li]
gb|EMS49312.1|  hypothetical protein TRIUR3_08956                       173   4e-46   Triticum urartu
ref|XP_010273712.1|  PREDICTED: probable folate-biopterin transpo...    174   5e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009359104.1|  PREDICTED: probable folate-biopterin transpo...    174   6e-46   Pyrus x bretschneideri [bai li]
ref|XP_011031431.1|  PREDICTED: probable folate-biopterin transpo...    174   6e-46   Populus euphratica
ref|NP_001063211.1|  Os09g0423400                                       173   8e-46   
emb|CDX85743.1|  BnaA02g00700D                                          175   9e-46   
ref|XP_008445270.1|  PREDICTED: probable folate-biopterin transpo...    173   1e-45   Cucumis melo [Oriental melon]
ref|XP_002460232.1|  hypothetical protein SORBIDRAFT_02g025050          173   1e-45   
ref|XP_007161078.1|  hypothetical protein PHAVU_001G041000g             172   2e-45   Phaseolus vulgaris [French bean]
gb|AES59126.2|  folate/biopterin transporter                            171   2e-45   Medicago truncatula
ref|XP_008652737.1|  PREDICTED: probable folate-biopterin transpo...    172   3e-45   
ref|XP_003588875.1|  Folate-Biopterin Transporter (FBT) family          171   3e-45   
ref|XP_006661247.1|  PREDICTED: LOW QUALITY PROTEIN: probable fol...    172   3e-45   Oryza brachyantha
gb|KDO67414.1|  hypothetical protein CISIN_1g037870mg                   171   5e-45   Citrus sinensis [apfelsine]
ref|XP_006450268.1|  hypothetical protein CICLE_v10010366mg             171   5e-45   Citrus clementina [clementine]
ref|XP_006483723.1|  PREDICTED: probable folate-biopterin transpo...    171   5e-45   Citrus sinensis [apfelsine]
ref|XP_002283360.2|  PREDICTED: probable folate-biopterin transpo...    171   6e-45   Vitis vinifera
ref|XP_002308712.2|  hypothetical protein POPTR_0006s28130g             171   7e-45   
ref|XP_006601217.1|  PREDICTED: probable folate-biopterin transpo...    170   1e-44   Glycine max [soybeans]
tpg|DAA37101.1|  TPA: hypothetical protein ZEAMMB73_089511              171   2e-44   
gb|EPS73522.1|  hypothetical protein M569_01230                         166   1e-43   Genlisea aurea
ref|XP_003545404.1|  PREDICTED: probable folate-biopterin transpo...    167   2e-43   Glycine max [soybeans]
ref|XP_008347489.1|  PREDICTED: probable folate-biopterin transpo...    162   2e-43   
ref|XP_003576536.1|  PREDICTED: probable folate-biopterin transpo...    167   2e-43   
ref|XP_002324339.2|  hypothetical protein POPTR_0018s02720g             166   6e-43   
ref|XP_004498797.1|  PREDICTED: probable folate-biopterin transpo...    165   1e-42   
ref|XP_004498796.1|  PREDICTED: probable folate-biopterin transpo...    164   2e-42   Cicer arietinum [garbanzo]
ref|XP_008377626.1|  PREDICTED: probable folate-biopterin transpo...    162   6e-42   
ref|XP_008377625.1|  PREDICTED: probable folate-biopterin transpo...    162   1e-41   
ref|XP_006450266.1|  hypothetical protein CICLE_v10008109mg             160   2e-41   
gb|KFK42483.1|  hypothetical protein AALP_AA2G262800                    157   4e-41   Arabis alpina [alpine rockcress]
gb|KFK25363.1|  hypothetical protein AALP_AA8G103600                    160   5e-41   Arabis alpina [alpine rockcress]
ref|XP_009125269.1|  PREDICTED: probable folate-biopterin transpo...    157   4e-40   Brassica rapa
gb|EYU29205.1|  hypothetical protein MIMGU_mgv1a018953mg                155   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_006399579.1|  hypothetical protein EUTSA_v10013335mg             154   5e-39   
gb|EMS68051.1|  hypothetical protein TRIUR3_09644                       151   7e-38   Triticum urartu
emb|CDX88561.1|  BnaC06g40050D                                          146   4e-36   
ref|XP_001761713.1|  predicted protein                                  145   2e-35   
emb|CDP07869.1|  unnamed protein product                                144   2e-35   Coffea canephora [robusta coffee]
ref|XP_002873479.1|  integral membrane transporter family protein       143   6e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_010453115.1|  PREDICTED: probable folate-biopterin transpo...    142   1e-34   Camelina sativa [gold-of-pleasure]
ref|NP_196643.1|  probable folate-biopterin transporter 6               142   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06656.1|  hypothetical protein F775_20552                         141   3e-34   
ref|XP_010491768.1|  PREDICTED: probable folate-biopterin transpo...    140   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008348559.1|  PREDICTED: LOW QUALITY PROTEIN: probable fol...    129   4e-30   
ref|XP_009774795.1|  PREDICTED: probable folate-biopterin transpo...    125   3e-29   Nicotiana sylvestris
ref|XP_006289087.1|  hypothetical protein CARUB_v10002493mg             123   4e-28   
gb|EEE63522.1|  hypothetical protein OsJ_18338                          120   9e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005854302.1|  hypothetical protein NGA_0170910                   122   3e-27   Nannochloropsis gaditana CCMP526
gb|EWM24710.1|  Major facilitator superfamily domain, general sub...    122   3e-27   Nannochloropsis gaditana
gb|EWM25378.1|  folate biopterin transporter                            120   5e-27   Nannochloropsis gaditana
ref|WP_013193199.1|  folate/biopterin transporter                       119   6e-27   Trichormus azollae
ref|WP_009556865.1|  folate/biopterin transporter                       118   2e-26   Oscillatoriales cyanobacterium JSC-12
ref|XP_008796776.1|  PREDICTED: folate-biopterin transporter 1, c...    117   5e-26   
gb|KJB72219.1|  hypothetical protein B456_011G165800                    115   6e-26   Gossypium raimondii
ref|WP_017319625.1|  folate/biopterin transporter                       117   6e-26   cyanobacterium PCC 7702
ref|XP_008796775.1|  PREDICTED: folate-biopterin transporter 1, c...    117   6e-26   
ref|WP_015139724.1|  folate/biopterin transporter                       116   7e-26   Nostoc sp. PCC 7524
gb|KJB72217.1|  hypothetical protein B456_011G165800                    115   7e-26   Gossypium raimondii
ref|XP_003536528.1|  PREDICTED: folate-biopterin transporter 1, c...    117   9e-26   Glycine max [soybeans]
gb|KHN02722.1|  hypothetical protein glysoja_015964                     116   9e-26   Glycine soja [wild soybean]
ref|WP_036006254.1|  folate-biopterin transporter                       116   9e-26   
gb|KCW84213.1|  hypothetical protein EUGRSUZ_B01079                     115   9e-26   Eucalyptus grandis [rose gum]
ref|WP_006278630.1|  Biopterin transport-related protein BT1            116   9e-26   Cylindrospermopsis raciborskii
ref|XP_006589593.1|  PREDICTED: folate-biopterin transporter 1, c...    117   1e-25   Glycine max [soybeans]
ref|WP_045874458.1|  folate-biopterin transporter                       116   1e-25   Nostocales
ref|WP_044207339.1|  folate-biopterin transporter                       116   1e-25   
ref|WP_036021064.1|  folate-biopterin transporter                       115   1e-25   
gb|KJB72218.1|  hypothetical protein B456_011G165800                    115   1e-25   Gossypium raimondii
gb|EKV02548.1|  folate/biopterin transporter                            115   1e-25   Leptolyngbya sp. PCC 7375
ref|XP_010045835.1|  PREDICTED: folate-biopterin transporter 1, c...    115   1e-25   
ref|WP_039895397.1|  folate-biopterin transporter                       115   1e-25   Lyngbya sp. PCC 8106
gb|KCW80542.1|  hypothetical protein EUGRSUZ_C01894                     115   1e-25   Eucalyptus grandis [rose gum]
ref|XP_002953783.1|  hypothetical protein VOLCADRAFT_64019              116   1e-25   Volvox carteri f. nagariensis
gb|EDX75389.1|  folate/biopterin transporter subfamily                  116   1e-25   Coleofasciculus chthonoplastes PCC 7420
ref|XP_007034792.1|  Major facilitator superfamily protein isoform 4    115   1e-25   
gb|KCW45779.1|  hypothetical protein EUGRSUZ_L003921                    115   2e-25   Eucalyptus grandis [rose gum]
ref|XP_007034791.1|  Major facilitator superfamily protein isoform 3    115   2e-25   
ref|XP_009409836.1|  PREDICTED: folate-biopterin transporter 1, c...    116   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001051544.1|  Os03g0795000                                       115   2e-25   
ref|XP_011071603.1|  PREDICTED: folate-biopterin transporter 1, c...    115   2e-25   
ref|WP_023071720.1|  folate biopterin transporter                       115   2e-25   Leptolyngbya sp. Heron Island J
ref|XP_011071602.1|  PREDICTED: folate-biopterin transporter 1, c...    116   2e-25   Sesamum indicum [beniseed]
ref|WP_036485304.1|  folate-biopterin transporter                       115   2e-25   Myxosarcina sp. GI1
gb|KJB38164.1|  hypothetical protein B456_006G240100                    114   3e-25   Gossypium raimondii
gb|KJB38166.1|  hypothetical protein B456_006G240100                    114   3e-25   Gossypium raimondii
ref|WP_033336585.1|  folate-biopterin transporter                       114   3e-25   
ref|XP_010322256.1|  PREDICTED: folate-biopterin transporter 1, c...    114   3e-25   
gb|KCW84212.1|  hypothetical protein EUGRSUZ_B01079                     115   3e-25   Eucalyptus grandis [rose gum]
ref|WP_015209880.1|  folate/biopterin transporter                       114   3e-25   Cylindrospermum stagnale
ref|WP_040483765.1|  folate-biopterin transporter                       114   3e-25   Lyngbya aestuarii
gb|KJB72220.1|  hypothetical protein B456_011G165800                    114   3e-25   Gossypium raimondii
gb|KJB56497.1|  hypothetical protein B456_009G122100                    114   4e-25   Gossypium raimondii
gb|KJB38165.1|  hypothetical protein B456_006G240100                    113   4e-25   Gossypium raimondii
ref|WP_009343161.1|  Biopterin transport-related protein BT1            114   4e-25   Aphanizomenonaceae
ref|XP_006350643.1|  PREDICTED: folate-biopterin transporter 1, c...    114   4e-25   Solanum tuberosum [potatoes]
ref|XP_010039707.1|  PREDICTED: folate-biopterin transporter 1, c...    115   5e-25   Eucalyptus grandis [rose gum]
ref|XP_004241047.1|  PREDICTED: folate-biopterin transporter 1, c...    114   5e-25   Solanum lycopersicum
ref|XP_002314687.1|  integral membrane transporter family protein       115   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_007143269.1|  hypothetical protein PHAVU_007G058300g             115   6e-25   Phaseolus vulgaris [French bean]
gb|KFK31161.1|  hypothetical protein AALP_AA6G076600                    114   7e-25   Arabis alpina [alpine rockcress]
gb|KHG30661.1|  hypothetical protein F383_12052                         114   7e-25   Gossypium arboreum [tree cotton]
ref|WP_041237288.1|  folate-biopterin transporter                       113   7e-25   
ref|WP_016870457.1|  folate/biopterin transporter                       114   7e-25   Fischerella muscicola
ref|WP_015118592.1|  folate/biopterin transporter                       114   7e-25   Rivularia sp. PCC 7116
gb|ACL46536.1|  folate/biopterin transporter                            113   7e-25   Cyanothece sp. PCC 7425
ref|WP_009634424.1|  folate/biopterin transporter                       113   8e-25   Synechocystis sp. PCC 7509
gb|KDO74543.1|  hypothetical protein CISIN_1g008417mg                   113   8e-25   Citrus sinensis [apfelsine]
ref|WP_035989773.1|  folate-biopterin transporter                       113   9e-25   
ref|XP_011030674.1|  PREDICTED: folate-biopterin transporter 1, c...    114   9e-25   Populus euphratica
ref|WP_015114708.1|  folate/biopterin transporter                       113   9e-25   Nostoc sp. PCC 7107
gb|KJB72216.1|  hypothetical protein B456_011G165800                    114   9e-25   Gossypium raimondii
ref|WP_015188603.1|  folate/biopterin transporter                       113   9e-25   Gloeocapsa sp. PCC 7428
ref|XP_004496712.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   Cicer arietinum [garbanzo]
emb|CBI26274.3|  unnamed protein product                                114   1e-24   Vitis vinifera
ref|XP_004496713.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   Cicer arietinum [garbanzo]
ref|XP_007034790.1|  Major facilitator superfamily protein isoform 2    113   1e-24   Theobroma cacao [chocolate]
ref|XP_003555342.2|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   
ref|XP_010907329.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   Elaeis guineensis
ref|XP_006606061.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   
ref|WP_015199415.1|  folate/biopterin transporter                       113   1e-24   Calothrix parietina
ref|XP_006606060.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   
ref|XP_010693761.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   
ref|WP_006621291.1|  MULTISPECIES: folate/biopterin transporter         113   1e-24   
ref|XP_006606059.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   
ref|XP_007034789.1|  Major facilitator superfamily protein isoform 1    114   1e-24   
ref|XP_002879362.1|  integral membrane transporter family protein       114   1e-24   
ref|WP_012407108.1|  folate/biopterin transporter                       113   1e-24   
ref|XP_010649920.1|  PREDICTED: folate-biopterin transporter 1, c...    114   1e-24   
ref|WP_010998423.1|  hypothetical protein                               113   1e-24   
gb|KJB38162.1|  hypothetical protein B456_006G240100                    113   1e-24   
ref|XP_012069656.1|  PREDICTED: folate-biopterin transporter 1, c...    113   2e-24   
ref|XP_008390972.1|  PREDICTED: folate-biopterin transporter 1, c...    114   2e-24   
gb|KJB38163.1|  hypothetical protein B456_006G240100                    112   2e-24   
ref|XP_006651903.1|  PREDICTED: folate-biopterin transporter 1, c...    112   2e-24   
gb|KIJ81916.1|  folate-biopterin transporter                            112   2e-24   
gb|KJB38161.1|  hypothetical protein B456_006G240100                    113   2e-24   
ref|XP_006419964.1|  hypothetical protein CICLE_v10004656mg             113   2e-24   
gb|KHN15760.1|  hypothetical protein glysoja_012552                     112   2e-24   
ref|XP_009627974.1|  PREDICTED: folate-biopterin transporter 1, c...    113   2e-24   
ref|XP_010256093.1|  PREDICTED: folate-biopterin transporter 1, c...    113   2e-24   
gb|KEH43860.1|  folate/biopterin transporter                            114   2e-24   
ref|WP_015151930.1|  folate/biopterin transporter                       112   2e-24   
ref|WP_017662386.1|  hypothetical protein                               112   2e-24   
dbj|BAJ99785.1|  predicted protein                                      113   2e-24   
ref|XP_006489414.1|  PREDICTED: folate-biopterin transporter 1, c...    113   2e-24   
ref|XP_010096149.1|  hypothetical protein L484_005428                   113   3e-24   
gb|KHG19762.1|  Uracil phosphoribosyltransferase                        112   3e-24   
gb|EPS67298.1|  hypothetical protein M569_07475                         112   3e-24   
ref|WP_044304616.1|  folate-biopterin transporter                       112   3e-24   
ref|WP_016878061.1|  folate/biopterin transporter                       112   3e-24   
ref|WP_045056892.1|  folate-biopterin transporter                       112   3e-24   
ref|XP_009774584.1|  PREDICTED: folate-biopterin transporter 1, c...    112   3e-24   
emb|CDO99076.1|  unnamed protein product                                112   3e-24   
ref|XP_010510106.1|  PREDICTED: folate-biopterin transporter 1, c...    113   3e-24   
ref|WP_017299145.1|  hypothetical protein                               112   3e-24   
emb|CCH67134.1|  Folate transporter 3                                   111   3e-24   
ref|XP_002517117.1|  transporter, putative                              112   3e-24   
gb|EYU41473.1|  hypothetical protein MIMGU_mgv1a005686mg                112   3e-24   
ref|WP_041036230.1|  folate-biopterin transporter                       112   4e-24   
ref|XP_009335324.1|  PREDICTED: folate-biopterin transporter 1, c...    112   4e-24   
ref|XP_002501584.1|  folate-biopterin transporter family                112   4e-24   
ref|WP_006617232.1|  hypothetical protein                               111   4e-24   
ref|WP_044107413.1|  folate-biopterin transporter                       111   4e-24   
ref|XP_011650970.1|  PREDICTED: folate-biopterin transporter 1, c...    111   4e-24   
ref|XP_008438657.1|  PREDICTED: folate-biopterin transporter 1, c...    111   5e-24   
ref|WP_039725687.1|  MULTISPECIES: folate-biopterin transporter         111   5e-24   
ref|WP_006194690.1|  hypothetical protein                               111   5e-24   
ref|XP_007221809.1|  hypothetical protein PRUPE_ppa003527mg             112   5e-24   
ref|WP_036268006.1|  folate-biopterin transporter                       111   5e-24   
gb|KIE09021.1|  folate-biopterin transporter                            111   5e-24   
ref|XP_009627973.1|  PREDICTED: folate-biopterin transporter 1, c...    112   5e-24   
ref|WP_038332695.1|  folate-biopterin transporter                       111   5e-24   
ref|WP_019509395.1|  hypothetical protein                               111   5e-24   
ref|XP_006350644.1|  PREDICTED: folate-biopterin transporter 1, c...    111   5e-24   
ref|WP_035173693.1|  folate-biopterin transporter                       111   6e-24   
ref|XP_009369860.1|  PREDICTED: folate-biopterin transporter 1, c...    111   6e-24   
ref|XP_003557515.1|  PREDICTED: folate-biopterin transporter 1, c...    112   6e-24   
ref|WP_015131146.1|  folate/biopterin transporter                       111   6e-24   
ref|WP_015202665.1|  folate/biopterin transporter                       111   6e-24   
ref|XP_010469637.1|  PREDICTED: folate-biopterin transporter 1, c...    112   7e-24   
ref|WP_041781467.1|  folate-biopterin transporter                       111   7e-24   
ref|WP_039716812.1|  folate-biopterin transporter                       111   7e-24   
ref|NP_565734.1|  folate-biopterin transporter 1                        112   7e-24   
ref|WP_009459901.1|  MULTISPECIES: folate/biopterin transporter         110   7e-24   
ref|XP_011090705.1|  PREDICTED: folate-biopterin transporter 1, c...    111   7e-24   
tpg|DAA51881.1|  TPA: hypothetical protein ZEAMMB73_898817              110   7e-24   
gb|AFZ21941.1|  folate/biopterin transporter                            111   7e-24   
ref|NP_001059000.1|  Os07g0172900                                       111   7e-24   
ref|XP_010543022.1|  PREDICTED: LOW QUALITY PROTEIN: folate-biopt...    111   7e-24   
ref|XP_008224296.1|  PREDICTED: folate-biopterin transporter 1, c...    112   8e-24   
ref|XP_009791423.1|  PREDICTED: folate-biopterin transporter 1, c...    111   8e-24   
ref|XP_010326673.1|  PREDICTED: folate-biopterin transporter 1, c...    111   8e-24   
ref|XP_009774583.1|  PREDICTED: folate-biopterin transporter 1, c...    111   8e-24   
ref|WP_044446982.1|  folate-biopterin transporter                       110   9e-24   
ref|XP_006293929.1|  hypothetical protein CARUB_v10022920mg             111   9e-24   
ref|XP_004134440.1|  PREDICTED: folate-biopterin transporter 1, c...    111   9e-24   
ref|XP_006658317.1|  PREDICTED: folate-biopterin transporter 1, c...    111   9e-24   
ref|XP_010414036.1|  PREDICTED: folate-biopterin transporter 1, c...    111   1e-23   
ref|XP_001778772.1|  predicted protein                                  111   1e-23   
ref|WP_015154763.1|  folate/biopterin transporter                       110   1e-23   
ref|XP_008438656.1|  PREDICTED: folate-biopterin transporter 1, c...    111   1e-23   
gb|EEE66651.1|  hypothetical protein OsJ_23271                          110   1e-23   
gb|EEC81596.1|  hypothetical protein OsI_25071                          110   1e-23   
emb|CCQ62948.1|  Folate transporter 3                                   108   1e-23   
ref|XP_011462651.1|  PREDICTED: folate-biopterin transporter 1, c...    111   1e-23   
ref|WP_011318080.1|  biopterin transport-like protein BT1               110   1e-23   
ref|XP_009369858.1|  PREDICTED: folate-biopterin transporter 1, c...    111   1e-23   
ref|XP_009369859.1|  PREDICTED: folate-biopterin transporter 1, c...    110   1e-23   
ref|WP_015225941.1|  folate/biopterin transporter                       109   2e-23   
ref|XP_003557518.1|  PREDICTED: folate-biopterin transporter 1, c...    110   2e-23   
emb|CDY64915.1|  BnaA05g35270D                                          110   2e-23   
ref|XP_004981443.1|  PREDICTED: folate-biopterin transporter 1, c...    110   2e-23   
ref|WP_012597861.1|  folate/biopterin transporter                       109   2e-23   
gb|EYU45663.1|  hypothetical protein MIMGU_mgv1a004040mg                110   2e-23   
ref|XP_006360777.1|  PREDICTED: folate-biopterin transporter 1, c...    110   2e-23   
ref|WP_041431702.1|  folate-biopterin transporter                       109   2e-23   
ref|XP_009144034.1|  PREDICTED: folate-biopterin transporter 1, c...    110   2e-23   
ref|WP_015170985.1|  folate/biopterin transporter                       109   2e-23   
ref|XP_008447156.1|  PREDICTED: folate-biopterin transporter 1, c...    109   2e-23   
ref|XP_003062514.1|  folate-biopterin transporter family                109   2e-23   
ref|WP_008315120.1|  folate/biopterin transporter                       109   2e-23   
ref|XP_006410341.1|  hypothetical protein EUTSA_v10016461mg             110   2e-23   
ref|WP_036533130.1|  folate-biopterin transporter                       109   2e-23   
ref|XP_009590007.1|  PREDICTED: folate-biopterin transporter 1, c...    109   3e-23   
ref|XP_002463748.1|  hypothetical protein SORBIDRAFT_01g005330          110   3e-23   
ref|WP_026732140.1|  folate-biopterin transporter                       109   3e-23   
ref|XP_009345876.1|  PREDICTED: folate-biopterin transporter 1, c...    110   3e-23   
ref|XP_008665587.1|  PREDICTED: folate-biopterin transporter 1, c...    110   3e-23   
ref|WP_026720927.1|  folate-biopterin transporter                       109   3e-23   
ref|XP_002459398.1|  hypothetical protein SORBIDRAFT_02g004070          109   3e-23   
ref|XP_009345877.1|  PREDICTED: folate-biopterin transporter 1, c...    110   4e-23   
ref|XP_009407732.1|  PREDICTED: folate-biopterin transporter 1, c...    110   4e-23   
ref|XP_008362005.1|  PREDICTED: folate-biopterin transporter 1, c...    109   4e-23   
gb|AFY62399.1|  folate/biopterin transporter                            108   4e-23   
ref|XP_008362004.1|  PREDICTED: folate-biopterin transporter 1, c...    109   4e-23   
ref|WP_017310901.1|  folate/biopterin transporter                       108   5e-23   
ref|NP_001141433.1|  hypothetical protein                               108   5e-23   
ref|WP_007308250.1|  Biopterin transport-related protein BT1            108   5e-23   
emb|CDY12237.1|  BnaC04g12670D                                          109   5e-23   
gb|ACL52905.1|  unknown                                                 109   5e-23   
emb|CCW28754.1|  putative transmembrane BT1 family protein              108   5e-23   
ref|XP_002987546.1|  hypothetical protein SELMODRAFT_43338              108   5e-23   
ref|WP_015160634.1|  folate/biopterin transporter                       108   5e-23   
emb|CCW28819.1|  putative transmembrane BT1 family protein              108   6e-23   
emb|CCQ70507.1|  Folate transporter 3                                   108   6e-23   
ref|XP_001781346.1|  predicted protein                                  107   7e-23   
ref|WP_016858647.1|  folate/biopterin transporter                       108   7e-23   
ref|XP_004955592.1|  PREDICTED: folate-biopterin transporter 1, c...    108   7e-23   
dbj|BAJ96523.1|  predicted protein                                      108   7e-23   
ref|XP_002969547.1|  hypothetical protein SELMODRAFT_91871              108   7e-23   
ref|WP_017714279.1|  hypothetical protein                               108   8e-23   
ref|NP_001151432.1|  biopterin transport-related protein BT1            108   8e-23   
ref|XP_002970816.1|  hypothetical protein SELMODRAFT_94530              107   8e-23   
ref|XP_004955591.1|  PREDICTED: folate-biopterin transporter 1, c...    108   9e-23   
ref|WP_017314236.1|  folate/biopterin transporter                       107   1e-22   
ref|XP_006826249.1|  PREDICTED: folate-biopterin transporter 1, c...    108   1e-22   
ref|WP_040654571.1|  folate-biopterin transporter                       107   1e-22   
emb|CBN78031.1|  conserved unknown protein                              107   1e-22   
ref|XP_002987717.1|  hypothetical protein SELMODRAFT_43342              107   1e-22   
gb|ERN43130.1|  folate/biopterin transporter                            107   1e-22   
ref|WP_015193560.1|  folate/biopterin transporter                       107   1e-22   
gb|ACN40663.1|  unknown                                                 108   1e-22   
ref|WP_011377487.1|  MULTISPECIES: folate/biopterin transporter         107   1e-22   
ref|WP_015212290.1|  folate/biopterin transporter                       107   1e-22   
gb|AFZ49161.1|  folate/biopterin transporter                            106   2e-22   
ref|WP_041235632.1|  folate-biopterin transporter                       106   2e-22   
ref|WP_036045855.1|  folate-biopterin transporter                       105   3e-22   
ref|XP_005718642.1|  unnamed protein product                            107   3e-22   
ref|XP_004139817.1|  PREDICTED: folate-biopterin transporter 1, c...    106   3e-22   
ref|WP_035156966.1|  folate-biopterin transporter                       105   3e-22   
gb|ACF82925.1|  unknown                                                 106   3e-22   
ref|WP_038297271.1|  folate-biopterin transporter, partial [            105   4e-22   
ref|WP_013324930.1|  folate/biopterin transporter                       105   4e-22   
dbj|BAD79504.1|  hypothetical protein                                   105   4e-22   
ref|WP_002766796.1|  hypothetical protein                               105   4e-22   
ref|WP_002763616.1|  hypothetical protein                               105   5e-22   
ref|WP_021829898.1|  Folate transporter 3                               105   5e-22   
ref|WP_002785809.1|  hypothetical protein                               105   5e-22   
ref|WP_024970003.1|  folate-biopterin transporter                       105   5e-22   
ref|WP_021833003.1|  Folate transporter 3                               105   5e-22   
ref|WP_002741782.1|  folate/biopterin transporter family protein        105   5e-22   
ref|WP_002773683.1|  hypothetical protein                               105   7e-22   
ref|WP_006528902.1|  folate/biopterin transporter                       105   8e-22   
ref|WP_045356232.1|  folate-biopterin transporter                       104   1e-21   
ref|WP_002782568.1|  Biopterin transport-related protein BT1 homolog    104   1e-21   
ref|WP_004163284.1|  Biopterin transport-related protein BT1 homolog    104   1e-21   
ref|WP_016516819.1|  putative symporter YagG                            104   1e-21   
ref|WP_012264436.1|  biopterin transport-related protein BT1-like...    104   1e-21   
ref|WP_008199556.1|  hypothetical protein                               104   1e-21   
ref|WP_002733856.1|  folate/biopterin transporter family protein        104   1e-21   
ref|XP_009520820.1|  hypothetical protein PHYSODRAFT_257742             105   1e-21   
ref|WP_002803540.1|  hypothetical protein                               104   2e-21   
ref|WP_002753459.1|  hypothetical protein                               104   2e-21   
ref|WP_002791252.1|  hypothetical protein                               104   2e-21   
emb|CEF98576.1|  Biopterin transport-related protein BT1                105   2e-21   
gb|KEH39874.1|  folate/biopterin transporter                            103   2e-21   
gb|KJB56496.1|  hypothetical protein B456_009G122100                    102   2e-21   
ref|WP_039748026.1|  folate-biopterin transporter                       103   2e-21   
ref|XP_005537423.1|  folate monoglutamate transporter                   104   4e-21   
gb|KEI66620.1|  hypothetical protein A19Y_1605                          102   4e-21   
ref|WP_017653050.1|  folate/biopterin transporter                       102   5e-21   
ref|XP_002286929.1|  hypothetical protein THAPSDRAFT_31372              102   5e-21   
ref|WP_036832372.1|  MULTISPECIES: folate-biopterin transporter         102   5e-21   
ref|XP_002182346.1|  predicted protein                                  102   9e-21   
ref|WP_015167193.1|  folate/biopterin transporter                       101   1e-20   
ref|XP_010495474.1|  PREDICTED: probable folate-biopterin transpo...  97.4    1e-20   
ref|WP_033375409.1|  folate-biopterin transporter                       100   1e-20   
ref|WP_009544646.1|  MULTISPECIES: folate/biopterin transporter         101   2e-20   
ref|WP_006455241.1|  folate/biopterin transporter subfamily             101   2e-20   
ref|XP_005644500.1|  Biopterin transport-related protein BT1            100   2e-20   
ref|XP_005647082.1|  Biopterin transport-related protein BT1            100   2e-20   
ref|WP_016949504.1|  folate/biopterin transporter                       100   2e-20   
gb|EMT08737.1|  hypothetical protein F775_11220                       99.4    2e-20   
ref|XP_009537270.1|  hypothetical protein PHYSODRAFT_253930             100   3e-20   
gb|EMT26219.1|  hypothetical protein F775_13979                         100   3e-20   
ref|WP_015785284.1|  folate/biopterin transporter                       100   3e-20   
ref|WP_011612675.1|  folate/biopterin transporter                       100   3e-20   
ref|WP_015175905.1|  folate/biopterin transporter                       100   3e-20   
ref|WP_007358266.1|  MULTISPECIES: folate/biopterin transporter         100   3e-20   
ref|WP_015957370.1|  folate/biopterin transporter                       100   3e-20   
ref|WP_015078415.1|  folate/biopterin transporter                     99.8    4e-20   
ref|XP_001418597.1|  FBT family transporter: folate/pteridine         99.8    4e-20   
ref|WP_017715883.1|  hypothetical protein                               100   5e-20   
ref|XP_002904818.1|  folate-Biopterin Transporter (FBT) family          100   5e-20   
ref|WP_015143961.1|  folate/biopterin transporter                     99.8    6e-20   
ref|WP_012308152.1|  integral membrane protein                        99.4    7e-20   
ref|WP_030007789.1|  folate-biopterin transporter                     99.4    7e-20   
ref|XP_008907100.1|  hypothetical protein PPTG_13119                    100   8e-20   
gb|ETM44074.1|  hypothetical protein L914_10680                         100   8e-20   
gb|ETP42060.1|  hypothetical protein F442_11022                       99.8    8e-20   
ref|XP_001773424.1|  predicted protein                                99.4    8e-20   
gb|ETI44160.1|  hypothetical protein F443_11120                       99.8    9e-20   
ref|WP_015218113.1|  folate/biopterin transporter                     98.2    2e-19   
ref|WP_029681955.1|  folate-biopterin transporter                     98.2    2e-19   
ref|WP_009629361.1|  folate/biopterin transporter                     98.6    2e-19   
ref|WP_008274346.1|  Biopterin transport-related protein BT1          98.2    2e-19   
ref|WP_015134711.1|  folate/biopterin transporter                     97.8    3e-19   
ref|XP_010522292.1|  PREDICTED: folate-biopterin transporter 1, c...  97.8    4e-19   
ref|WP_006631370.1|  folate/biopterin transporter                     97.4    5e-19   
ref|WP_035083064.1|  folate-biopterin transporter                     96.7    5e-19   
ref|WP_017328002.1|  hypothetical protein                             97.1    5e-19   



>ref|XP_009609918.1| PREDICTED: probable folate-biopterin transporter 3 isoform X2 
[Nicotiana tomentosiformis]
Length=500

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 196/231 (85%), Gaps = 1/231 (0%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            MGQ+   LL+GQ Q+E+K+ +       RPF W  KLS+ LHWSFV +VVIVYGINQG+S
Sbjct  1    MGQEGTLLLDGQLQREKKTKNRILGLILRPFYWLGKLSEELHWSFVSAVVIVYGINQGMS  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
            LGLS+IS QYYMKDEQKLQPSEAQI+ GII LPW+VKPLWGLLTD LPI GYRRRPYF+L
Sbjct  61   LGLSKISTQYYMKDEQKLQPSEAQIYFGIIQLPWVVKPLWGLLTDTLPILGYRRRPYFML  120

Query  654  AGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
             G +GV+AML+LS+NQ L +  ALLCLMAGSAGVAIADV IDACVTENSISHPSLA DMQ
Sbjct  121  GGFIGVVAMLSLSINQNLHLAFALLCLMAGSAGVAIADVTIDACVTENSISHPSLASDMQ  180

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            SLCG SSSVGQLIG+ ISGFLVHLIGSKGVFGILS+P  LV+LVG+M RE+
Sbjct  181  SLCGLSSSVGQLIGFGISGFLVHLIGSKGVFGILSIPAGLVILVGMMSRET  231



>ref|XP_006366264.1| PREDICTED: probable folate-biopterin transporter 3-like [Solanum 
tuberosum]
Length=500

 Score =   300 bits (767),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 193/231 (84%), Gaps = 1/231 (0%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            MGQ++A   EGQ  +++K  D       R F W RKL+D LHWSFV SVVI+YGINQG+S
Sbjct  1    MGQEDAVSFEGQLHRDKKPKDRILDLISRQFYWLRKLTDELHWSFVSSVVILYGINQGMS  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
            LG+SRIS QYYMKDEQKLQPSEAQ++ G+I LPW+VKPLWGLLTD LPI GYRRRPYFIL
Sbjct  61   LGMSRISTQYYMKDEQKLQPSEAQVYFGLIQLPWVVKPLWGLLTDTLPILGYRRRPYFIL  120

Query  654  AGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
             G +GV+AML+LS+NQ L +  ALLCLMAGSAGVAIADV IDACVTENSISHPSLA DMQ
Sbjct  121  GGFIGVVAMLSLSINQNLHLAFALLCLMAGSAGVAIADVTIDACVTENSISHPSLASDMQ  180

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            SLCG SSSVGQLIGY ISG LVHLIGSKGVFG+LS+P  LV+LVG+M RE+
Sbjct  181  SLCGLSSSVGQLIGYAISGVLVHLIGSKGVFGVLSIPAGLVILVGMMTREA  231



>ref|XP_009774529.1| PREDICTED: probable folate-biopterin transporter 3 [Nicotiana 
sylvestris]
Length=500

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 194/231 (84%), Gaps = 1/231 (0%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            MGQ+   LL+GQ  +++K  +       RPF W  KLS+ LHWSFV +VVIVYGINQG+S
Sbjct  1    MGQEGTILLDGQLHRDKKPKNRILGLILRPFYWLGKLSEELHWSFVSAVVIVYGINQGMS  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
            LGLS+IS QYYMKDEQKLQPSEAQI+ GII LPWIVKPLWGLLTD LPI GYRRRPYF+L
Sbjct  61   LGLSKISTQYYMKDEQKLQPSEAQIYFGIIQLPWIVKPLWGLLTDTLPILGYRRRPYFML  120

Query  654  AGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
             G +GV+AML+LS+NQ L +  ALLCLMAGSAGVAIADV IDACVTENSISHPSLA DMQ
Sbjct  121  GGFIGVVAMLSLSINQNLHLAFALLCLMAGSAGVAIADVTIDACVTENSISHPSLASDMQ  180

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            SLCG SSSVGQLIG+ ISGFLVHLIGSKGVFGILS+P  LV+LVG+M RE+
Sbjct  181  SLCGLSSSVGQLIGFGISGFLVHLIGSKGVFGILSIPAGLVILVGMMSRET  231



>ref|XP_009615688.1| PREDICTED: probable folate-biopterin transporter 3 [Nicotiana 
tomentosiformis]
Length=500

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 184/230 (80%), Gaps = 1/230 (0%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            M +++   LEGQ  KE+   +       +P+ WFR L D  HWSFV  VVI+YGINQGLS
Sbjct  1    MREEDELPLEGQLHKEKSQKNKMLGLILKPYYWFRMLCDEFHWSFVSGVVIIYGINQGLS  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
             GLS+IS QYYMKDEQKLQPSEAQI++GII LPWIVKP+WGLLTD LPI GYRRRPYFIL
Sbjct  61   TGLSKISTQYYMKDEQKLQPSEAQIYSGIIQLPWIVKPIWGLLTDTLPIRGYRRRPYFIL  120

Query  654  AGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
            AG LG  AML LS  + L++  ALLCLM GSA  A+ADV IDACVTENSISHPSLA DMQ
Sbjct  121  AGFLGAFAMLNLSFGHNLQLASALLCLMGGSAAQAVADVTIDACVTENSISHPSLASDMQ  180

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            SLCG SSSVGQLIGY ISGFLVHLIGSKGVFG+LS+P +LV+LVG+M+ E
Sbjct  181  SLCGVSSSVGQLIGYTISGFLVHLIGSKGVFGVLSIPAALVILVGMMLHE  230



>ref|XP_004241672.1| PREDICTED: probable folate-biopterin transporter 3 [Solanum lycopersicum]
Length=500

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 193/231 (84%), Gaps = 1/231 (0%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            MGQ++A   EGQ +++ K  D       R F W RKL + LHWSFV SVVI+YGINQG+S
Sbjct  1    MGQEDAVSFEGQLRRDEKPKDRISGLISRQFYWLRKLIEELHWSFVSSVVILYGINQGMS  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
            LGLSRIS QYYMKDEQKLQPSEAQ++ GII LPW+VKPLWGLLTD LPI GYRRRPYFIL
Sbjct  61   LGLSRISTQYYMKDEQKLQPSEAQVYVGIIQLPWVVKPLWGLLTDTLPILGYRRRPYFIL  120

Query  654  AGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
             G +GV+AML+LS+NQ L + LALLCLMAGSAGVAIADV IDACVTENSISHPSLA DMQ
Sbjct  121  GGFIGVVAMLSLSINQNLHLALALLCLMAGSAGVAIADVTIDACVTENSISHPSLASDMQ  180

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            SLCG SSSVGQL GY ISGFLVHLIGSKGVFG+LS+P  LV+LVG+M RE+
Sbjct  181  SLCGLSSSVGQLFGYAISGFLVHLIGSKGVFGVLSIPAGLVILVGMMTREA  231



>ref|XP_011082613.1| PREDICTED: probable folate-biopterin transporter 3 [Sesamum indicum]
Length=498

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 184/232 (79%), Gaps = 3/232 (1%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            M QDE F L+G+ +K  K+           +    KLSD LHWSFVL VVIVYGINQGL 
Sbjct  1    MDQDEKFSLQGKQEKLPKNGVLGMIVSPFKWVK--KLSDELHWSFVLGVVIVYGINQGLC  58

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
            LGLS+IS QYYMKDEQKLQPSEAQ++ G+I +PWIVKPLWGLLTD +PIAG RRRPYFIL
Sbjct  59   LGLSKISTQYYMKDEQKLQPSEAQVYHGMIMIPWIVKPLWGLLTDTVPIAGRRRRPYFIL  118

Query  654  AGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
            AG +G ++M+TLS+ N + +  ALL L+ GSAG A+ADV IDACVTENSI HPSLAG+MQ
Sbjct  119  AGIIGAVSMITLSLENNIYLGFALLLLVCGSAGAAVADVTIDACVTENSIGHPSLAGEMQ  178

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRESL  986
            SLCG  SSVGQLIGY ISGFLVHLIGSKGVFG+LS+P  LV+LVG+ I+E L
Sbjct  179  SLCGLCSSVGQLIGYTISGFLVHLIGSKGVFGVLSIPSGLVILVGMTIQEPL  230



>ref|XP_004305470.2| PREDICTED: probable folate-biopterin transporter 3 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467002.1| PREDICTED: probable folate-biopterin transporter 3 [Fragaria 
vesca subsp. vesca]
Length=498

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 190/229 (83%), Gaps = 1/229 (0%)
 Frame = +3

Query  300  QDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLG  479
            + EA   E Q++KE+ S    W   W P +W + LS  LHWSFV+SVV+VYGI+QGLS+G
Sbjct  9    EREALHHEAQNKKEKFSVKGLWDLLWSPINWVKMLSRELHWSFVISVVMVYGISQGLSMG  68

Query  480  LSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAG  659
            LSRISIQYY+KDEQK+QPSEAQ++ GII +PW+VKPLWGL TD LPI GYRR+PYF+ AG
Sbjct  69   LSRISIQYYLKDEQKVQPSEAQVYLGIIQIPWMVKPLWGLFTDALPILGYRRKPYFVFAG  128

Query  660  SLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSL  836
             +GV++ML LS++ +L + ++LL LM GSAGVAIADV IDACVTENSISHPSLAGDMQSL
Sbjct  129  LIGVVSMLVLSLDKKLDLTMSLLSLMVGSAGVAIADVTIDACVTENSISHPSLAGDMQSL  188

Query  837  CGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            CG +SSVG L+G+ +SGF VHL+G KGVFG+LS+PP+LV+ VG+M+RES
Sbjct  189  CGLTSSVGALVGFSVSGFFVHLLGPKGVFGLLSIPPALVIFVGMMLRES  237



>ref|XP_002272239.1| PREDICTED: probable folate-biopterin transporter 3 [Vitis vinifera]
 ref|XP_010655138.1| PREDICTED: probable folate-biopterin transporter 3 [Vitis vinifera]
Length=496

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 171/194 (88%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L D LHWSFVLSVVIVYG+NQGLS+GLSR+S QYYMKDEQK+QPSEAQ+F G+I LPW++
Sbjct  40   LGDELHWSFVLSVVIVYGMNQGLSVGLSRVSTQYYMKDEQKVQPSEAQVFFGMIQLPWVI  99

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTD+LPI GYRRRPYFI AG LGVI+ML+L+++ ++ + LALL LM GSAGVAI
Sbjct  100  KPLWGLLTDILPIIGYRRRPYFIFAGFLGVISMLSLALHKKMHLVLALLSLMTGSAGVAI  159

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSISHPSLAGDMQSLCG SSS+G L+GY +SGFLVH +G KGVFG+LS+
Sbjct  160  ADVTIDACVAQNSISHPSLAGDMQSLCGLSSSIGALVGYSLSGFLVHFVGPKGVFGVLSV  219

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVG+ +RE
Sbjct  220  PAGLVILVGMFLRE  233



>ref|XP_010687327.1| PREDICTED: probable folate-biopterin transporter 3 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 186/232 (80%), Gaps = 2/232 (1%)
 Frame = +3

Query  294  MGQDEA-FLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGL  470
            M ++E  F ++ Q+ K ++           P  W  KL + LHW+FV+ V+ VYGI+QGL
Sbjct  1    MEEEEGNFPIQEQTHKHKREKSGILGLIMSPIHWISKLCNELHWTFVMGVIAVYGISQGL  60

Query  471  SLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFI  650
            S+GLSR+++QYYMKDEQK+QPSEAQI  G++  PW+VKPLWGLLTDVLP++GYRRRPYFI
Sbjct  61   SMGLSRVTMQYYMKDEQKVQPSEAQISMGVVRFPWVVKPLWGLLTDVLPLSGYRRRPYFI  120

Query  651  LAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDM  827
             AG LGV +ML LS+ + L +  A+L LMAGSAGVAIADV IDAC+TENS SHPSLAGDM
Sbjct  121  FAGFLGVTSMLVLSIVDGLHLVPAVLSLMAGSAGVAIADVTIDACITENSSSHPSLAGDM  180

Query  828  QSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            QSLCG SSS+G L G++ISGFLVHLIGSKGVFG+L++PP+LVVLVG+ I++S
Sbjct  181  QSLCGLSSSIGALAGFIISGFLVHLIGSKGVFGLLAIPPALVVLVGLTIKDS  232



>ref|XP_008365736.1| PREDICTED: LOW QUALITY PROTEIN: probable folate-biopterin transporter 
3 [Malus domestica]
Length=499

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV+ V+IVYGI+QGLS+GLSRISIQYY+KD+QK+QPSEAQ++ GII   WIV
Sbjct  43   LSSELHWSFVVGVLIVYGISQGLSMGLSRISIQYYLKDDQKVQPSEAQVYFGIIQXSWIV  102

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KP WGLLTD LP+ GYRR+PYF+ AG LGVI+ML LS+++ L + ++LL LMAGSAGVAI
Sbjct  103  KPFWGLLTDTLPVLGYRRKPYFVFAGLLGVISMLVLSLDKNLNLTMSLLALMAGSAGVAI  162

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+NSI HPSLAGDMQSLCG SSSVG L+G+ +SGFLVHL+G KGVFG+LS+
Sbjct  163  ADVTIDACVTQNSIRHPSLAGDMQSLCGLSSSVGALVGFSLSGFLVHLVGPKGVFGLLSI  222

Query  939  PPSLVVLVGIMIRES  983
            PP LV+LVGIM RES
Sbjct  223  PPGLVILVGIMHRES  237



>ref|XP_002512755.1| transporter, putative [Ricinus communis]
 gb|EEF49258.1| transporter, putative [Ricinus communis]
Length=467

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS+ LHWSFVL VV VYGI+QG+ +GLS++S QYYMKDEQK+QPSEAQ++ G++ +PWIV
Sbjct  11   LSEELHWSFVLGVVTVYGISQGVGVGLSKVSTQYYMKDEQKVQPSEAQVYLGLLQIPWIV  70

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGL TD LP+ GYRRRPYF+ AG+L +IAML LS+ + L +  ALL LMAGSAGVAI
Sbjct  71   KPLWGLFTDTLPVLGYRRRPYFVFAGALSIIAMLMLSVQKNLHLAFALLSLMAGSAGVAI  130

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+NSISHPSLAGDMQSLCG SSSVG L+G+ +SGFLVH++G KGVFG+LS+
Sbjct  131  ADVTIDACVTQNSISHPSLAGDMQSLCGISSSVGALVGFTLSGFLVHIVGPKGVFGLLSI  190

Query  939  PPSLVVLVGIMIRES  983
            P  LV++VGI++RES
Sbjct  191  PAGLVIVVGIILRES  205



>ref|XP_009609917.1| PREDICTED: probable folate-biopterin transporter 3 isoform X1 
[Nicotiana tomentosiformis]
Length=548

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 161/279 (58%), Positives = 184/279 (66%), Gaps = 49/279 (18%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            MGQ+   LL+GQ Q+E+K+ +       RPF W  KLS+ LHWSFV +VVIVYGINQG+S
Sbjct  1    MGQEGTLLLDGQLQREKKTKNRILGLILRPFYWLGKLSEELHWSFVSAVVIVYGINQGMS  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
            LGLS+IS QYYMKDEQKLQPSEAQI+ GII LPW+VKPLWGLLTD LPI GYRRRPYF+L
Sbjct  61   LGLSKISTQYYMKDEQKLQPSEAQIYFGIIQLPWVVKPLWGLLTDTLPILGYRRRPYFML  120

Query  654  AGSLGV------------------------------------------------IAMLTL  689
             G L +                                                +  L+ 
Sbjct  121  GGPLNIQWRMGKTKFCEVSKAWRETLKWADLVALWSNYVKPSVKDEIDKHKEPHLLFLSY  180

Query  690  SMNQLRIEL-ALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQL  866
              NQ +  L A  C  +  AGVAIADV IDACVTENSISHPSLA DMQSLCG SSSVGQL
Sbjct  181  MGNQKKTILCAFSCFFSSCAGVAIADVTIDACVTENSISHPSLASDMQSLCGLSSSVGQL  240

Query  867  IGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            IG+ ISGFLVHLIGSKGVFGILS+P  LV+LVG+M RE+
Sbjct  241  IGFGISGFLVHLIGSKGVFGILSIPAGLVILVGMMSRET  279



>ref|XP_007023526.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY26148.1| Major facilitator superfamily protein [Theobroma cacao]
Length=502

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 167/195 (86%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSFVL VVIVYGI+QG  +GLSR+S QYYMKD QK+QPS+AQ+  G+I  PWIV
Sbjct  45   LGEELHWSFVLGVVIVYGISQGFGVGLSRVSTQYYMKDVQKVQPSQAQVLIGVIHFPWIV  104

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDV+PI GYRRRPYFI AG LGVI+ML LS+++ L +  ALL L+AGSAG+AI
Sbjct  105  KPLWGLLTDVVPIFGYRRRPYFIFAGLLGVISMLVLSLHKSLHLAFALLSLVAGSAGIAI  164

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+++ISHPSLAGDMQSLCG SSS+  LIG+ +SGF VHL G+KGVFG+LS+
Sbjct  165  ADVAIDACVTQHTISHPSLAGDMQSLCGLSSSIRALIGFSLSGFFVHLAGAKGVFGLLSI  224

Query  939  PPSLVVLVGIMIRES  983
            P SLVVLVGI++RES
Sbjct  225  PASLVVLVGILLRES  239



>ref|XP_009354223.1| PREDICTED: probable folate-biopterin transporter 3 [Pyrus x bretschneideri]
Length=501

 Score =   251 bits (640),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 172/195 (88%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV+ VVIVYGI+QGLS+GLSRISIQYY+KDE+K+QPSEAQI+ GII +PWIV
Sbjct  45   LSSELHWSFVVGVVIVYGISQGLSMGLSRISIQYYLKDEEKVQPSEAQIYFGIIQIPWIV  104

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTD LP+ GYRR+PYF+ AG LGV +ML LS+++ L + ++LL LMAGSAGVAI
Sbjct  105  KPLWGLLTDTLPVLGYRRKPYFVFAGLLGVTSMLVLSLDKNLNLTMSLLALMAGSAGVAI  164

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+NSI HPSLAGDMQSLCG SSSVG L+G+ +SGFLVHL+G KGVFG+LS+
Sbjct  165  ADVTIDACVTQNSIRHPSLAGDMQSLCGLSSSVGALVGFSLSGFLVHLVGPKGVFGLLSI  224

Query  939  PPSLVVLVGIMIRES  983
            PP LVVLVGIM RES
Sbjct  225  PPGLVVLVGIMHRES  239



>ref|XP_009375475.1| PREDICTED: probable folate-biopterin transporter 3 [Pyrus x bretschneideri]
Length=499

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 185/222 (83%), Gaps = 1/222 (0%)
 Frame = +3

Query  321  EGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQ  500
            E ++QK++          W P +WFR LS  LHWSFV+ VVIVYGI+QGLS+GLSRISIQ
Sbjct  16   ESENQKQKTPVKGVRDLLWTPINWFRMLSSELHWSFVVGVVIVYGISQGLSMGLSRISIQ  75

Query  501  YYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAM  680
            YY+KD+QK+QPSEAQ++ GII +PWIVKP WGLLTD LP+ GYRR+PYF+ AG LGVI+M
Sbjct  76   YYLKDDQKVQPSEAQVYFGIIQIPWIVKPFWGLLTDTLPVLGYRRKPYFVFAGLLGVISM  135

Query  681  LTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSSV  857
            L LS+++ L + ++LL LMAGSAGVAIADV IDACVT+NSI HPSLAGDMQSLCG SSSV
Sbjct  136  LVLSLDKNLNLTMSLLALMAGSAGVAIADVTIDACVTQNSIRHPSLAGDMQSLCGLSSSV  195

Query  858  GQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            G L+G+ +SGFLVHL+G KGVFG+LS+PP LV+LVGIM RES
Sbjct  196  GALVGFALSGFLVHLVGPKGVFGLLSIPPGLVILVGIMHRES  237



>ref|XP_008342828.1| PREDICTED: probable folate-biopterin transporter 3 [Malus domestica]
Length=499

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 172/195 (88%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV+ VVIVYGI+QGLS+GLSRISIQYY+KDE+K+QPSEAQI+ GII +PWIV
Sbjct  43   LSSELHWSFVVGVVIVYGISQGLSMGLSRISIQYYLKDEEKVQPSEAQIYFGIIQIPWIV  102

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTD LP+ GYRR+PYF+ AG LGV +ML LS+++ L + ++LL LMAGSAGVAI
Sbjct  103  KPLWGLLTDTLPVLGYRRKPYFVFAGLLGVTSMLVLSLDKNLNLTMSLLALMAGSAGVAI  162

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+NSISHPSLAGD QSLCG SSSVG L+G+ +SGFLVHL+G KGVFG+LS+
Sbjct  163  ADVTIDACVTQNSISHPSLAGDXQSLCGLSSSVGALVGFSLSGFLVHLVGPKGVFGLLSI  222

Query  939  PPSLVVLVGIMIRES  983
            PP LVVLVGIM RES
Sbjct  223  PPGLVVLVGIMHRES  237



>ref|XP_007215269.1| hypothetical protein PRUPE_ppa004652mg [Prunus persica]
 gb|EMJ16468.1| hypothetical protein PRUPE_ppa004652mg [Prunus persica]
Length=497

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 188/228 (82%), Gaps = 1/228 (0%)
 Frame = +3

Query  300  QDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLG  479
            + E+  LE ++QK++ S        W P +WF+ LS  LHWSFV+ VVIVYGI+QGLS+G
Sbjct  7    EKESLHLEAENQKQKTSVKGVRDLLWTPMNWFKMLSSELHWSFVVGVVIVYGISQGLSMG  66

Query  480  LSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAG  659
            LSRI IQYY+KD+QK+QPSEAQ++ GII +PW+VKP WGLLTD LPI GYRR+PYF+ AG
Sbjct  67   LSRIGIQYYLKDDQKVQPSEAQVYFGIIQIPWMVKPFWGLLTDTLPILGYRRKPYFVFAG  126

Query  660  SLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSL  836
             +G+I+ML LS++ +L + ++LL LM GSAGVAIADV IDACVT+NSISHPSLAGDMQSL
Sbjct  127  VIGMISMLVLSLDKKLDLTISLLSLMMGSAGVAIADVTIDACVTQNSISHPSLAGDMQSL  186

Query  837  CGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            CG +SS+G L+G+ +SGFLVHL+G KGVFG+LS+PP LV+LVG+M RE
Sbjct  187  CGLTSSIGALVGFSLSGFLVHLLGPKGVFGLLSIPPGLVILVGVMHRE  234



>gb|EYU24569.1| hypothetical protein MIMGU_mgv1a005024mg [Erythranthe guttata]
Length=500

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 167/197 (85%), Gaps = 1/197 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LSD LHWSFVL VVIVYGINQGL LGLS+++ QYYMKD QKLQPSEAQI+ G+I +PWI
Sbjct  39   RLSDELHWSFVLGVVIVYGINQGLCLGLSKVNTQYYMKDVQKLQPSEAQIYHGMIMIPWI  98

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
            VKPLWG+LTD +P+AG RRRPYF  AG +G ++M+ LS+   L + LALL L+ GSAG A
Sbjct  99   VKPLWGILTDTVPVAGRRRRPYFFFAGIIGAVSMIILSIETNLILGLALLLLICGSAGAA  158

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV IDACVTENSISHPSLAG+MQSLCG  SS+GQLIGY ISGFLVHLIGSKGVFG+LS
Sbjct  159  IADVTIDACVTENSISHPSLAGEMQSLCGLCSSIGQLIGYTISGFLVHLIGSKGVFGVLS  218

Query  936  MPPSLVVLVGIMIRESL  986
            +P  LV+ VG++I+E L
Sbjct  219  VPAGLVIFVGLIIQEPL  235



>emb|CAN74675.1| hypothetical protein VITISV_038367 [Vitis vinifera]
Length=468

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 146/194 (75%), Gaps = 29/194 (15%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L D LHWSFVLSVVIVYG+NQGLS+GLSR+S QYYMKDEQK+QPSEAQ+F G+I LPW++
Sbjct  40   LGDELHWSFVLSVVIVYGMNQGLSVGLSRVSTQYYMKDEQKVQPSEAQVFFGMIQLPWVI  99

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGV-IAMLTLSMNQLRIELALLCLMagsagvai  758
            KPLWGLLTD+LPI GYRRRPYFI AGS GV IA +T+                       
Sbjct  100  KPLWGLLTDILPIIGYRRRPYFIFAGSAGVAIADVTID----------------------  137

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
                  ACV +NSISHPSLAGDMQSLCG SSS+G L+GY +SGFLVH +G KGVFG+LS+
Sbjct  138  ------ACVAQNSISHPSLAGDMQSLCGLSSSIGALVGYSLSGFLVHFVGPKGVFGVLSV  191

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVG+ +RE
Sbjct  192  PAGLVILVGMFLRE  205



>ref|XP_008228849.1| PREDICTED: probable folate-biopterin transporter 3 [Prunus mume]
Length=500

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 184/222 (83%), Gaps = 1/222 (0%)
 Frame = +3

Query  318  LEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLGLSRISI  497
            LE ++QK + S        W P +WF+ LS  LHWSFV+ VVIVYGI+QGLS+GLSRI I
Sbjct  16   LEAENQKHQNSVKGVRDLLWTPMNWFKMLSSELHWSFVVGVVIVYGISQGLSMGLSRIGI  75

Query  498  QYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIA  677
            QYY+KD+QK+QPSEAQ++ GII +PW+VKP WGLLTD LPI GYRR+PYF+ AG +GVI+
Sbjct  76   QYYLKDDQKVQPSEAQVYFGIIQIPWMVKPFWGLLTDTLPILGYRRKPYFVFAGVIGVIS  135

Query  678  MLTLSMN-QLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSS  854
            ML LS++ +L + ++LL LM GSAGVAIADV IDACVT+NSISHPSLAGDMQSLCG +SS
Sbjct  136  MLVLSLDKKLDLTISLLSLMVGSAGVAIADVTIDACVTQNSISHPSLAGDMQSLCGLASS  195

Query  855  VGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            +G L+G+ +SGFLVHL+G KGVFG+LS+PP LV+LVG+M RE
Sbjct  196  IGALVGFSLSGFLVHLLGPKGVFGLLSIPPGLVILVGVMHRE  237



>ref|XP_002299158.2| integral membrane transporter family protein [Populus trichocarpa]
 gb|EEE83963.2| integral membrane transporter family protein [Populus trichocarpa]
Length=484

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 176/220 (80%), Gaps = 1/220 (0%)
 Frame = +3

Query  327  QSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYY  506
            +SQ ER   +       RP +W + L + LHWSFVL V+IVYGI+QG ++G+S++S +YY
Sbjct  3    ESQLERNPRNGFLALVLRPINWLKMLGEELHWSFVLGVMIVYGISQGFAVGMSKVSTKYY  62

Query  507  MKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLT  686
            MKDEQK+QPSE Q++ G++ LPW++KPLWGLLTD LP+ GYRRRPYFI AG L V +ML 
Sbjct  63   MKDEQKVQPSELQVYLGLLQLPWVIKPLWGLLTDTLPVLGYRRRPYFIFAGFLSVTSMLA  122

Query  687  LSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQ  863
            LS+ + L +  +LL LM  SAG+AIADV IDACVT+NSISHPSLAGDMQSLCG SSS+G 
Sbjct  123  LSIQRNLSLAFSLLSLMGVSAGIAIADVAIDACVTQNSISHPSLAGDMQSLCGFSSSIGA  182

Query  864  LIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            L+GY +SGFLVHL+G KGVFG+LS+P  LV+LVG+M++ES
Sbjct  183  LVGYSLSGFLVHLVGPKGVFGLLSVPAGLVILVGMMLKES  222



>gb|KDP41941.1| hypothetical protein JCGZ_26959 [Jatropha curcas]
Length=458

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L D LHWSFVL VVIVYGI+QG  +GLS++S QYYMKDEQK+QPSEAQ+++G++  PWIV
Sbjct  2    LIDELHWSFVLGVVIVYGISQGFGVGLSKVSTQYYMKDEQKVQPSEAQVYSGLLQFPWIV  61

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTD LPI GYRRRPYF+ AG L ++AML LS+ + L +  ALL LMAGSAG+AI
Sbjct  62   KPLWGLLTDTLPILGYRRRPYFVFAGVLSMVAMLVLSLKKNLHLAFALLSLMAGSAGIAI  121

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+NSISHPSLAGDMQSLCG SSS+G L+G+ +SG LV ++G KGVFG+LS+
Sbjct  122  ADVTIDACVTQNSISHPSLAGDMQSLCGLSSSIGALLGFSLSGLLVRIVGPKGVFGMLSI  181

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVGIM+RE
Sbjct  182  PAGLVLLVGIMLRE  195



>ref|XP_012067460.1| PREDICTED: probable folate-biopterin transporter 3 [Jatropha 
curcas]
Length=485

 Score =   239 bits (610),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L D LHWSFVL VVIVYGI+QG  +GLS++S QYYMKDEQK+QPSEAQ+++G++  PWIV
Sbjct  29   LIDELHWSFVLGVVIVYGISQGFGVGLSKVSTQYYMKDEQKVQPSEAQVYSGLLQFPWIV  88

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTD LPI GYRRRPYF+ AG L ++AML LS+ + L +  ALL LMAGSAG+AI
Sbjct  89   KPLWGLLTDTLPILGYRRRPYFVFAGVLSMVAMLVLSLKKNLHLAFALLSLMAGSAGIAI  148

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+NSISHPSLAGDMQSLCG SSS+G L+G+ +SG LV ++G KGVFG+LS+
Sbjct  149  ADVTIDACVTQNSISHPSLAGDMQSLCGLSSSIGALLGFSLSGLLVRIVGPKGVFGMLSI  208

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVGIM+RE
Sbjct  209  PAGLVLLVGIMLRE  222



>ref|XP_011034592.1| PREDICTED: probable folate-biopterin transporter 3 [Populus euphratica]
Length=487

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 164/195 (84%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSFVL V+IVYGI+QG ++G+S++S +YYMKDEQK+QPSE Q++ G++ LPW++
Sbjct  31   LGEELHWSFVLGVMIVYGISQGFAVGMSKVSTKYYMKDEQKVQPSELQVYLGLLQLPWVI  90

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTD +P+ GYRRRPYFI AG L V +ML LS+ + L +  +LL LM  SAG+AI
Sbjct  91   KPLWGLLTDTIPVLGYRRRPYFIFAGFLSVTSMLALSIRRNLSLAFSLLSLMGVSAGIAI  150

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+NSISHPSLAGDMQSLCG SSS+G L+GY +SGFLVHL+G KGVFG+LS+
Sbjct  151  ADVAIDACVTQNSISHPSLAGDMQSLCGFSSSIGALVGYSLSGFLVHLVGPKGVFGLLSV  210

Query  939  PPSLVVLVGIMIRES  983
            P  LV+ VG+M++ES
Sbjct  211  PAGLVISVGMMLKES  225



>ref|XP_006357077.1| PREDICTED: probable folate-biopterin transporter 2-like [Solanum 
tuberosum]
Length=513

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHW+FV SVVIVYG++QGL    SRIS +YYMKD QK+QPSE+Q+++GI S+PW+VKPLW
Sbjct  56   LHWNFVFSVVIVYGVSQGLGGAFSRISTEYYMKDVQKVQPSESQVYSGITSIPWMVKPLW  115

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTD +PI GYRRRPYF+ AGSLGV++ML LS+++ L I LALL L AGSA VAIADV 
Sbjct  116  GLLTDAVPILGYRRRPYFLFAGSLGVVSMLFLSLHKNLHIVLALLSLTAGSAAVAIADVT  175

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            +DACV +NS SHPSLA DMQSLC  SSS+G L+G+ +SG LVHL+G  GV+G+LS+P  L
Sbjct  176  VDACVAQNSGSHPSLAADMQSLCALSSSIGALVGFSLSGILVHLLGPMGVYGLLSIPAGL  235

Query  951  VVLVGIMIRES  983
            V+LVG++++ES
Sbjct  236  VILVGVLLKES  246



>ref|XP_010265508.1| PREDICTED: probable folate-biopterin transporter 2 isoform X2 
[Nelumbo nucifera]
Length=490

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 171/217 (79%), Gaps = 1/217 (0%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            M ++E+  L   + ++ K     W + W P  WF+ LSD +HWSFV  VV+ YGINQGL 
Sbjct  1    MMEEESLSLSNGADEKTKREKGFWDFIWVPLYWFKMLSDEMHWSFVFGVVVTYGINQGLG  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
              LSR+  +YYMKD QK+QPSEAQ+++GI S+PWIVKPLWGLLTDVLP+AGYRRRPYF+L
Sbjct  61   GSLSRVGTEYYMKDVQKVQPSEAQVYSGITSIPWIVKPLWGLLTDVLPVAGYRRRPYFVL  120

Query  654  AGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
            AG LGVI+M+ LS++ +L I  AL+ L AGSAGVAIADV IDACV +NSI+HPSLA DMQ
Sbjct  121  AGFLGVISMVFLSLHRKLHIVPALMSLTAGSAGVAIADVTIDACVAQNSINHPSLAADMQ  180

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMP  941
            SLCG SSS+G L+G+ ISGFLVHLIG  GVFG+LS+P
Sbjct  181  SLCGLSSSIGSLLGFFISGFLVHLIGPLGVFGLLSIP  217



>ref|XP_004244510.1| PREDICTED: probable folate-biopterin transporter 2 [Solanum lycopersicum]
Length=513

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = +3

Query  321  EGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQ  500
            E +  +E K N+        P +WF+ L+  LHW+FV SVVIVYG++QGL    SRIS +
Sbjct  25   EDEEVQESKHNNGICSSICAPVNWFKMLTMELHWNFVFSVVIVYGVSQGLGGAFSRISTE  84

Query  501  YYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAM  680
            YYMKD QK+QPSE+Q+++GI S+PW+VKPLWGL TD +PI GYRRRPYF+ AGSLGV +M
Sbjct  85   YYMKDVQKVQPSESQVYSGITSIPWMVKPLWGLFTDAVPILGYRRRPYFLFAGSLGVFSM  144

Query  681  LTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSSV  857
            L LS+++ L I LALL L AGSA VAIADV +DACV +NS SHPSLA DMQSLC  SSS+
Sbjct  145  LFLSLHKNLHIVLALLSLTAGSAAVAIADVTVDACVAQNSGSHPSLAADMQSLCALSSSI  204

Query  858  GQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            G L+G+ +SG LVHL+G  GV+G+LS+P  LV+LVG++++ES
Sbjct  205  GALVGFSLSGILVHLLGPMGVYGLLSIPAGLVILVGVLLKES  246



>ref|XP_008220649.1| PREDICTED: LOW QUALITY PROTEIN: probable folate-biopterin transporter 
2 [Prunus mume]
Length=504

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSFV+ VV+VYGINQGL   L R+  +YYMKD QK+QPSEAQ + GI S+PW+VKPLW
Sbjct  42   MHWSFVMGVVVVYGINQGLGGALYRVGTEYYMKDVQKVQPSEAQFYQGITSIPWLVKPLW  101

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFI+AGS+GVI+ML LS ++ L I LALL L+AGSAGVA+ADV 
Sbjct  102  GLLTDVLPIFGYRRRPYFIVAGSIGVISMLVLSFHEKLHIALALLSLIAGSAGVAVADVT  161

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NSI+HPSLA DMQSLC  SSS+G L+G+ +SG  VHLIG KGV+G+L++P  L
Sbjct  162  IDACVAQNSINHPSLAADMQSLCALSSSIGALLGFSVSGIFVHLIGPKGVYGLLAIPFGL  221

Query  951  VVLVGIMIRE  980
            V L+G +++E
Sbjct  222  VFLIGTLLKE  231



>ref|XP_007222125.1| hypothetical protein PRUPE_ppa004658mg [Prunus persica]
 gb|EMJ23324.1| hypothetical protein PRUPE_ppa004658mg [Prunus persica]
Length=497

 Score =   234 bits (597),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSFV+ V++VYGINQGL   L R+  +YYMKD QK+QPSEAQ + GI S+PW+VKPLW
Sbjct  42   MHWSFVMGVLVVYGINQGLGGALYRVGTEYYMKDVQKVQPSEAQFYQGITSIPWLVKPLW  101

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFI+AGS+GVI+ML LS ++ L I LALL L AGSAGVA+ADV 
Sbjct  102  GLLTDVLPIFGYRRRPYFIVAGSIGVISMLVLSFHEKLHIALALLSLTAGSAGVAVADVT  161

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NSI+HPSLA DMQSLC  SSS+G L+G+ +SG  VHLIG KGV+G+L++P  L
Sbjct  162  IDACVAQNSINHPSLAADMQSLCALSSSIGALLGFSVSGIFVHLIGPKGVYGLLAIPFGL  221

Query  951  VVLVGIMIRE  980
            V L+G +++E
Sbjct  222  VFLIGTLLKE  231



>ref|XP_009106695.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106696.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106697.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106698.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
 ref|XP_009106699.1| PREDICTED: probable folate-biopterin transporter 3 [Brassica 
rapa]
Length=495

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 163/195 (84%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY KDEQ +QPSEAQ++ G+I +PWI+
Sbjct  38   LVEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQMIQPSEAQVYVGLIQVPWII  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KP+WGLLTDV+P+ GYRRRPYFI AG L +++M+ LS+++ L++ LAL CL+AGSAGVAI
Sbjct  98   KPVWGLLTDVVPVLGYRRRPYFIFAGVLSMVSMMVLSLHKNLQLGLALSCLVAGSAGVAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHL GSKGV+G+L M
Sbjct  158  ADVTIDACVTQLSISHPTLAADMQSLCGMSSSIGSLVGFSLSGVLVHLFGSKGVYGLLGM  217

Query  939  PPSLVVLVGIMIRES  983
               L+V+VG++++ES
Sbjct  218  TAGLIVVVGLILKES  232



>emb|CDX87359.1| BnaA07g35140D [Brassica napus]
Length=495

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 163/195 (84%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY KDEQ +QPSEAQ++ G+I +PWI+
Sbjct  38   LVEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQMIQPSEAQVYVGLIQVPWII  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KP+WGLLTDV+P+ GYRRRPYFI AG L +++M+ LS+++ L++ LAL CL+AGSAGVAI
Sbjct  98   KPVWGLLTDVVPVLGYRRRPYFIFAGVLSMVSMMVLSLHKNLQLGLALSCLVAGSAGVAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHL GSKGV+G+L M
Sbjct  158  ADVTIDACVTQLSISHPTLAADMQSLCGMSSSIGSLVGFSLSGVLVHLFGSKGVYGLLGM  217

Query  939  PPSLVVLVGIMIRES  983
               L+V+VG++++ES
Sbjct  218  TAGLIVVVGLILKES  232



>ref|XP_011081988.1| PREDICTED: probable folate-biopterin transporter 2 [Sesamum indicum]
Length=499

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  V+IVYG++QGL   L+R+  +YYMKD QK+QPSEAQ+++GI S+PWIV
Sbjct  40   LAKELHWSFVFGVIIVYGMSQGLGGALARVGTEYYMKDVQKVQPSEAQVYSGITSIPWIV  99

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDV+PI+GY+RRPYF+ AGSLGVIAML LS++ +L I LALL L AGSA VAI
Sbjct  100  KPLWGLLTDVVPISGYQRRPYFVFAGSLGVIAMLFLSLHKELHIVLALLALTAGSASVAI  159

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV +DACV + S SHPSLA DMQSLC  SSS+G L+G+  SG  VHLIG +GV+G+L++
Sbjct  160  ADVTVDACVAQKSGSHPSLAADMQSLCALSSSIGALVGFSFSGIFVHLIGPQGVYGLLTI  219

Query  939  PPSLVVLVGIMIRE  980
            P  LV +VGI+++E
Sbjct  220  PAGLVFIVGILLKE  233



>ref|XP_010914026.1| PREDICTED: probable folate-biopterin transporter 2 [Elaeis guineensis]
Length=508

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 177/227 (78%), Gaps = 1/227 (0%)
 Frame = +3

Query  303  DEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLGL  482
            +E   L G + KE+++ +   R RW P  WFR L+D +HWSFV  VV VYGI+QGL   +
Sbjct  17   EETIGLTGDAPKEKEAIEVEPRCRWSPLSWFRMLADEMHWSFVFGVVTVYGISQGLGGAI  76

Query  483  SRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGS  662
             R++  YY KD QK+QPS AQ++ GIISLPWIVKPLWGLLTDVLP+AGYRRRPY ILAG 
Sbjct  77   WRVASDYYWKDVQKVQPSAAQVYHGIISLPWIVKPLWGLLTDVLPMAGYRRRPYLILAGL  136

Query  663  LGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLC  839
            LGV +MLTLS++Q L +  ALL + AGSAGVAIADV IDACV +NSI+HP+LA DMQSLC
Sbjct  137  LGVTSMLTLSLHQKLHVVFALLAMTAGSAGVAIADVTIDACVAQNSINHPALAADMQSLC  196

Query  840  GGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            G SSS+G+L+G+ ISG LVH IGS+GV G++ +P +LV  VGI+++E
Sbjct  197  GLSSSIGRLLGFSISGLLVHAIGSQGVLGLMGIPFALVFSVGIVLKE  243



>ref|XP_002887801.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64060.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY KDEQK+QPS+AQI+ G+I +PWI+
Sbjct  41   LIEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQKIQPSQAQIYVGLIQIPWII  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDV+P+ GYRRRPYF+ AG L +I+M+ L ++  L + LAL CL+AGSAGVAI
Sbjct  101  KPLWGLLTDVVPVWGYRRRPYFVFAGVLAMISMMVLWLHTNLHLALALSCLVAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHL+GSKGV+G+L +
Sbjct  161  ADVTIDACVTQCSISHPTLAADMQSLCGLSSSIGSLVGFSLSGLLVHLVGSKGVYGLLGV  220

Query  939  PPSLVVLVGIMIRES  983
               L+V+VG++++ES
Sbjct  221  TAGLLVVVGMVLKES  235



>ref|NP_178089.1| probable folate-biopterin transporter 3 [Arabidopsis thaliana]
 sp|Q9SQN2.1|FBT3_ARATH RecName: Full=Probable folate-biopterin transporter 3 [Arabidopsis 
thaliana]
 gb|AAF68109.1|AC010793_4 F20B17.13 [Arabidopsis thaliana]
 gb|AAG52252.1|AC011717_20 hypothetical protein; 109043-107192 [Arabidopsis thaliana]
 gb|AEE36290.1| probable folate-biopterin transporter 3 [Arabidopsis thaliana]
Length=497

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V+IVYG++QGL  GLS++S QYY KDEQK+QPS+AQI+ G+I +PWI+
Sbjct  41   LIEELHWSFFFGVIIVYGVSQGLGKGLSKVSTQYYFKDEQKIQPSQAQIYVGLIQIPWII  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDV+P+ GYRRRPYFILAG L +I+M+ L ++  L + LAL CL+AGSAGVAI
Sbjct  101  KPLWGLLTDVVPVLGYRRRPYFILAGFLAMISMMVLWLHTNLHLALALSCLVAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG  SS+G L+G+ +SG LVHL+GSKGV+G+L +
Sbjct  161  ADVTIDACVTQCSISHPTLAADMQSLCGLCSSIGSLVGFSLSGVLVHLVGSKGVYGLLGV  220

Query  939  PPSLVVLVGIMIRES  983
               L+V+VG++++ES
Sbjct  221  TAGLLVVVGMVLKES  235



>ref|XP_010265507.1| PREDICTED: probable folate-biopterin transporter 2 isoform X1 
[Nelumbo nucifera]
Length=492

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 171/219 (78%), Gaps = 3/219 (1%)
 Frame = +3

Query  294  MGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLS  473
            M ++E+  L   + ++ K     W + W P  WF+ LSD +HWSFV  VV+ YGINQGL 
Sbjct  1    MMEEESLSLSNGADEKTKREKGFWDFIWVPLYWFKMLSDEMHWSFVFGVVVTYGINQGLG  60

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
              LSR+  +YYMKD QK+QPSEAQ+++GI S+PWIVKPLWGLLTDVLP+AGYRRRPYF+L
Sbjct  61   GSLSRVGTEYYMKDVQKVQPSEAQVYSGITSIPWIVKPLWGLLTDVLPVAGYRRRPYFVL  120

Query  654  A--GSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGD  824
            A  G LGVI+M+ LS++ +L I  AL+ L AGSAGVAIADV IDACV +NSI+HPSLA D
Sbjct  121  AVSGFLGVISMVFLSLHRKLHIVPALMSLTAGSAGVAIADVTIDACVAQNSINHPSLAAD  180

Query  825  MQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMP  941
            MQSLCG SSS+G L+G+ ISGFLVHLIG  GVFG+LS+P
Sbjct  181  MQSLCGLSSSIGSLLGFFISGFLVHLIGPLGVFGLLSIP  219



>ref|XP_007011686.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY29305.1| Major facilitator superfamily protein [Theobroma cacao]
Length=497

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSFV  VV VYGINQG    L+RI  +YYMKD QK+QPSEAQ++ GI S+PW++KP+W
Sbjct  42   MHWSFVFGVVSVYGINQGFGGALARIGTEYYMKDVQKVQPSEAQVYAGITSIPWMIKPIW  101

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFIL+G LGV++ML +S +++L +  ALL L AG+  VA+ADV 
Sbjct  102  GLLTDVLPIMGYRRRPYFILSGLLGVVSMLLISLLSKLHLVFALLALTAGNTAVAVADVT  161

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            +DACV +NSI+HPS A DMQSLC  S SVG L+G+ ISG  VHLIG KGVFG+L++P +L
Sbjct  162  VDACVAQNSITHPSRAADMQSLCASSYSVGGLLGFSISGVFVHLIGPKGVFGLLTVPAAL  221

Query  951  VVLVGIMIRE  980
            V LVGI++ E
Sbjct  222  VSLVGILLSE  231



>gb|KFK42482.1| hypothetical protein AALP_AA2G262800 [Arabis alpina]
Length=432

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY+KDEQ +QPSEAQ++ G+I +PWI+
Sbjct  34   LIEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYLKDEQMVQPSEAQVYVGLIQIPWII  93

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KP+WGLLTDV+P+ GYRRRPYFI AG + ++AM+ LS+++ L + LAL  L+AGSAGVAI
Sbjct  94   KPVWGLLTDVVPVMGYRRRPYFIFAGVVTMVAMMVLSLHKNLHLGLALTSLVAGSAGVAI  153

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHPSLA DMQSLCG SSS+G L+G+ +SG LVH  G+KGV+G+L M
Sbjct  154  ADVTIDACVTQCSISHPSLAADMQSLCGMSSSIGSLVGFSLSGVLVHWFGAKGVYGLLGM  213

Query  939  PPSLVVLVGIMIRES  983
               L V+VG++++ES
Sbjct  214  TSGLTVVVGLLLKES  228



>ref|XP_009394927.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS+ +HWSFV  V+ VYGI+QG+   +SR++  YY KD Q + PS AQ++ GI S+PWIV
Sbjct  58   LSEEMHWSFVFGVIAVYGISQGMGGSISRVATDYYWKDVQMVHPSAAQVYQGITSIPWIV  117

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDVLP+AGYRRRPYFIL+G LG+++MLTLS++ +L +  ALL +  GSAGVAI
Sbjct  118  KPLWGLLTDVLPVAGYRRRPYFILSGLLGILSMLTLSLHSKLHVIFALLAMTIGSAGVAI  177

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV +DACV +NSI+HPSLA DMQSLCG SSS+G+L+G+ ISG LVH IGS+GV G+LS+
Sbjct  178  ADVTVDACVAQNSINHPSLAADMQSLCGLSSSIGRLLGFSISGLLVHAIGSQGVLGLLSI  237

Query  939  PPSLVVLVGIMIRE  980
            P  LV+ VGIM++E
Sbjct  238  PSVLVLSVGIMLKE  251



>ref|XP_002324921.1| hypothetical protein POPTR_0018s02750g [Populus trichocarpa]
 gb|EEF03486.1| hypothetical protein POPTR_0018s02750g [Populus trichocarpa]
Length=494

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 153/194 (79%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++  HWSFV  V++VYGINQGL    +R+   YYMKD QK+QPSE+QI+ GIIS+PW+V
Sbjct  38   LANETHWSFVFGVLVVYGINQGLGGAFNRVGTDYYMKDVQKVQPSESQIYQGIISIPWLV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLPI GYRRRPYFI AG LGV++ML LS ++ L I  ALL L AGSAG AI
Sbjct  98   KPLWGLLTDVLPILGYRRRPYFIFAGLLGVVSMLLLSFHENLHIAFALLSLTAGSAGAAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NS + PSLA DMQSLC  SSS+G L+G+ +SG  VHLIG KGVFG+LS+
Sbjct  158  ADVTIDACVAQNSNTRPSLAADMQSLCALSSSIGALMGFSLSGIFVHLIGPKGVFGLLSI  217

Query  939  PPSLVVLVGIMIRE  980
            P  LV LVGI++ E
Sbjct  218  PAGLVFLVGILLDE  231



>dbj|BAK07100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFVL VV  YGI+QGL  G+SR++  YY KD QK+QPS AQ++ G+ S+PW+VKP+W
Sbjct  53   LHWSFVLGVVATYGISQGLGGGISRVASDYYWKDVQKVQPSAAQVYHGVTSIPWLVKPVW  112

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDVLP+AGYRRRPYF+LAG +GVIAML +S++ +L +  ALL LM+GSA VAIADV 
Sbjct  113  GLLTDVLPVAGYRRRPYFVLAGIMGVIAMLIVSLHSKLHVMFALLALMSGSASVAIADVT  172

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV ENS+ HP LA DM SL G  SSVG LIG+ ISGFLVH IGS+G  GIL++P +L
Sbjct  173  IDACVAENSLIHPHLAADMMSLNGFCSSVGGLIGFSISGFLVHAIGSQGTLGILTIPSAL  232

Query  951  VVLVGIMIRE  980
            V+L GI++++
Sbjct  233  VILAGILLKD  242



>ref|XP_002283372.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 ref|XP_010648766.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 ref|XP_010648767.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 ref|XP_010648768.1| PREDICTED: probable folate-biopterin transporter 2 [Vitis vinifera]
 emb|CBI21157.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VV VYGI+QGL   L+R+  +YYMKD QK+QPSEAQI+ GI S+PW+VKPLW
Sbjct  42   LHWSFVFGVVAVYGISQGLGGALARVGTEYYMKDVQKVQPSEAQIYGGITSIPWLVKPLW  101

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GY RRPYFILAG LGVI+ML LS ++ L + LAL  L AGSAGVAIADV 
Sbjct  102  GLLTDVLPIVGYHRRPYFILAGLLGVISMLVLSFHKDLHLVLALFSLTAGSAGVAIADVT  161

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NS  HPSLA DMQSLC  SSSVG L+G+ ISG  VHLIG  GVFG+L++P +L
Sbjct  162  IDACVAQNSNLHPSLAADMQSLCALSSSVGALVGFSISGIFVHLIGPTGVFGLLTIPATL  221

Query  951  VVLVGIMIRE  980
            V+LVGI++ E
Sbjct  222  VLLVGIVLSE  231



>ref|XP_011036709.1| PREDICTED: probable folate-biopterin transporter 2 [Populus euphratica]
Length=497

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 153/194 (79%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++  HWSFV  V++VYGINQGL    +R+   YYMKD QK+QPSE+QI+ GIIS+PW+V
Sbjct  38   LANETHWSFVFGVLVVYGINQGLGGAFNRVGTDYYMKDVQKVQPSESQIYQGIISIPWLV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLPI GYRRRPYFI AG LGV++ML LS ++ L I  ALL L AGSAG AI
Sbjct  98   KPLWGLLTDVLPILGYRRRPYFIFAGLLGVVSMLLLSFHENLHIAFALLSLTAGSAGAAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NS + PSLA DMQSLC  SSS+G L+G+ +SG  VHLIG KGVFG+LS+
Sbjct  158  ADVTIDACVAQNSNTRPSLAADMQSLCALSSSIGALMGFSLSGIFVHLIGPKGVFGLLSI  217

Query  939  PPSLVVLVGIMIRE  980
            P  LV LVGI++ E
Sbjct  218  PAVLVFLVGILLDE  231



>ref|XP_009390541.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390542.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390543.1| PREDICTED: probable folate-biopterin transporter 2 [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++ +HWSFV  V+ VYGI+QG    +++++  YY KD Q +QPS AQ++ GIIS+PWIV
Sbjct  58   LAEEMHWSFVFGVITVYGISQGFGGAIAKVATDYYWKDVQMVQPSAAQVYHGIISIPWIV  117

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDVLPIAGYRRRPYFIL+G LG+I+MLTL+++ +L +  ALL + AGSA VAI
Sbjct  118  KPLWGLLTDVLPIAGYRRRPYFILSGLLGIISMLTLALHSKLHVVFALLAITAGSASVAI  177

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI+HP LA DMQSLCG SSS+G+L+GY ISG LVH +GS+GVFG+LS+
Sbjct  178  ADVTIDACVAQNSINHPFLASDMQSLCGLSSSIGRLLGYSISGLLVHALGSQGVFGVLSI  237

Query  939  PPSLVVLVGIMIRE  980
            P +LV+ VG+++++
Sbjct  238  PSALVLSVGMVLKD  251



>ref|XP_008377495.1| PREDICTED: probable folate-biopterin transporter 2 [Malus domestica]
Length=461

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VV+VYGI QGL   LSRI  +YYMKD QK+QPSEAQ + GII +PWIVKP+W
Sbjct  6    LHWSFVWGVVVVYGIRQGLGDALSRIGTEYYMKDVQKVQPSEAQFYQGIIYIPWIVKPIW  65

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFI AGS+GVI+ML +S ++ L + LA+L L  GSAGVAIADV 
Sbjct  66   GLLTDVLPIFGYRRRPYFIFAGSIGVISMLLISFHEKLHLALAILVLTGGSAGVAIADVT  125

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC  +NSI HPSLA D+QSLC  + S+G L+G+ ISG  VHLIG KGVFG+L++P  L
Sbjct  126  IDACAAKNSILHPSLASDIQSLCALTESIGALVGFSISGIFVHLIGPKGVFGLLAIPSGL  185

Query  951  VVLVGIMIRE  980
            VV+VG ++ E
Sbjct  186  VVVVGTLLDE  195



>ref|XP_010104513.1| hypothetical protein L484_025485 [Morus notabilis]
 gb|EXC01114.1| hypothetical protein L484_025485 [Morus notabilis]
Length=510

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  +HWSFVL VV+VYGI+QGL   L+R+  +YYMKD QK+QPSEAQI+ GI S+PWIV
Sbjct  50   LASEMHWSFVLGVVVVYGISQGLGGALARVGTEYYMKDVQKVQPSEAQIYAGITSIPWIV  109

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLPI GYRRRPYF+LAGSLGVI+ML L++++ L + LALL L AGSAGVAI
Sbjct  110  KPLWGLLTDVLPIFGYRRRPYFLLAGSLGVISMLMLAVHEKLHLVLALLFLTAGSAGVAI  169

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSISHPSLA DMQSLC  SSS+G L+G+ ISG  VHLIG KGV+G+L++
Sbjct  170  ADVTIDACVAQNSISHPSLAADMQSLCALSSSIGALVGFSISGIFVHLIGPKGVYGLLTI  229

Query  939  PPSLVVLVGIMIRE  980
            P  LV  VGI++ E
Sbjct  230  PAGLVFTVGIVLNE  243



>ref|XP_002515410.1| transporter, putative [Ricinus communis]
 gb|EEF46859.1| transporter, putative [Ricinus communis]
Length=498

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 156/194 (80%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++  HWS V  V+ VYGI+QGL    SR+   YYMKD QK+QPSE+QI+ GIIS+PW+V
Sbjct  39   LANETHWSLVFGVLAVYGISQGLGGAFSRVGTDYYMKDVQKVQPSESQIYQGIISIPWLV  98

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KP+WGLLTDVLP++GYRRRPYFI AG +GV++ML LS+++ L +  ALL L AGSAGVAI
Sbjct  99   KPIWGLLTDVLPVSGYRRRPYFIFAGLVGVVSMLLLSLHENLHLVFALLSLTAGSAGVAI  158

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NS +HPSLA DMQSLC  SSSVG L+GY ISG  +H IGSKGVFG+L++
Sbjct  159  ADVTIDACVAQNSNTHPSLAPDMQSLCTLSSSVGALLGYSISGIFIHFIGSKGVFGLLTI  218

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVGIM+ E
Sbjct  219  PAGLVLLVGIMLEE  232



>ref|XP_009359139.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
Length=498

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VV+VYGI+QGL   LSRI  +YYMKD QK+QPSEAQ + GII +PWIVKP+W
Sbjct  43   LHWSFVWGVVVVYGISQGLGDALSRIGTEYYMKDVQKVQPSEAQFYQGIIYIPWIVKPIW  102

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFI AGS+GVI+ML +S ++ L + LA+L L  GSAGVAIADV 
Sbjct  103  GLLTDVLPIFGYRRRPYFIFAGSIGVISMLLISFHEKLHLALAILVLTGGSAGVAIADVT  162

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC  +NSI HPSLA D+QSLC  +SS+G L+G+ +SG  VHLIG KGVFG+L++P  L
Sbjct  163  IDACAAKNSILHPSLASDIQSLCALTSSIGALVGFSLSGIFVHLIGPKGVFGLLAIPSGL  222

Query  951  VVLVGIMIRE  980
            VV+VG ++ E
Sbjct  223  VVVVGTLLDE  232



>ref|XP_009359096.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
Length=498

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VV+VYGI+QGL   LSRI  +YYMKD QK+QPSEAQ + GII +PWIVKP+W
Sbjct  43   LHWSFVWGVVVVYGISQGLGDALSRIGTEYYMKDVQKVQPSEAQFYQGIIYIPWIVKPIW  102

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFI AGS+GVI+ML +S ++ L + LA+L L  GSAGVAIADV 
Sbjct  103  GLLTDVLPIFGYRRRPYFIFAGSIGVISMLLISFHEKLHLALAILVLTGGSAGVAIADVT  162

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC  +NSI HPSLA D+QSLC  +SS+G L+G+ +SG  VHLIG KGVFG+L++P  L
Sbjct  163  IDACAAKNSILHPSLASDIQSLCALTSSIGALVGFSLSGIFVHLIGPKGVFGLLAIPSGL  222

Query  951  VVLVGIMIRE  980
            VV+VG ++ E
Sbjct  223  VVVVGTLLDE  232



>ref|XP_004291974.1| PREDICTED: probable folate-biopterin transporter 2 [Fragaria 
vesca subsp. vesca]
Length=491

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSF L VV+VYGI+QG    L R+  +YYMKD  K+QPS+AQ + GI S+PW+VKPLW
Sbjct  34   MHWSFALGVVVVYGISQGFGGALYRVGTEYYMKDVLKVQPSQAQFYQGITSIPWLVKPLW  93

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDVLP+ GYRRRPYFILAGS+GVIAML LS ++ L I LA+L L   SAGVA+ADV 
Sbjct  94   GLLTDVLPLFGYRRRPYFILAGSIGVIAMLVLSFHEKLHIALAILALTVESAGVAVADVT  153

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NSI+H SLA D+QSLC  SSS+G L+G+ ISG  VHLIG KGV+G+L++P  L
Sbjct  154  IDACVAQNSITHHSLAADLQSLCALSSSIGALLGFSISGIFVHLIGPKGVYGLLAIPSGL  213

Query  951  VVLVGIMIRE  980
            V L+G +IRE
Sbjct  214  VFLIGTLIRE  223



>ref|XP_006450260.1| hypothetical protein CICLE_v10008084mg [Citrus clementina]
 ref|XP_006483527.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483528.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X2 [Citrus sinensis]
 gb|ESR63500.1| hypothetical protein CICLE_v10008084mg [Citrus clementina]
 gb|KDO67403.1| hypothetical protein CISIN_1g041017mg [Citrus sinensis]
Length=499

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  +HWSFVL VVIVYGI+QGL   L+R+  QYYMKD QK+QPSEAQ++ GI SLPWIV
Sbjct  40   LATEMHWSFVLGVVIVYGISQGLGGALARVGTQYYMKDVQKVQPSEAQVYAGITSLPWIV  99

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLPI GYRRRPYFILAG LGV +ML LSM++ L +  A+  L A SAG+AI
Sbjct  100  KPLWGLLTDVLPIFGYRRRPYFILAGCLGVFSMLLLSMHEKLHLVFAVSALTASSAGIAI  159

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI HPSLA DMQSLC   S++G LIGY ISG  VHLIG KGVFG++++
Sbjct  160  ADVTIDACVAQNSICHPSLASDMQSLCSLCSAIGALIGYSISGIFVHLIGPKGVFGLMTI  219

Query  939  P  941
            P
Sbjct  220  P  220



>ref|XP_012076403.1| PREDICTED: probable folate-biopterin transporter 2 [Jatropha 
curcas]
 ref|XP_012076404.1| PREDICTED: probable folate-biopterin transporter 2 [Jatropha 
curcas]
 gb|KDP33498.1| hypothetical protein JCGZ_07069 [Jatropha curcas]
Length=499

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 155/196 (79%), Gaps = 1/196 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L +  HWSFV  V+ VYGI+QGL    +R++ +YYMKD QK+QPSE+QI+ GIIS+PW+V
Sbjct  38   LGNETHWSFVFGVLAVYGISQGLGGAFNRVATEYYMKDVQKVQPSESQIYQGIISIPWLV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDVLP++GYRRRPYFILAG LGVI+ML +S++ +L +  ALL L  GS GVAI
Sbjct  98   KPLWGLLTDVLPVSGYRRRPYFILAGLLGVISMLLVSLHGKLHLVFALLALTTGSCGVAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NS +HP LA DMQSLC  SSS+G L+G+ ISG  VHLIG KG+FG+L++
Sbjct  158  ADVTIDACVAQNSNTHPLLAPDMQSLCALSSSIGALVGFSISGIFVHLIGPKGIFGLLTI  217

Query  939  PPSLVVLVGIMIRESL  986
            P  LV  VGI++ E L
Sbjct  218  PAGLVFCVGIVLNEPL  233



>ref|XP_007011687.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY29306.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=496

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +3

Query  417  HWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWG  596
            HWSFV  VV VYGI+QGL   L+R+  +YYMKD QK+QPSE+Q+++GI S+PWIVKP+WG
Sbjct  42   HWSFVFGVVSVYGISQGLGGALARVGTEYYMKDVQKVQPSESQVYSGITSIPWIVKPIWG  101

Query  597  LLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvii  773
            LLTDV+PI GYRRRPYFIL+G LG+++ML +S++ +L +  AL+ L AGSAGVAIADV +
Sbjct  102  LLTDVVPIRGYRRRPYFILSGLLGLVSMLLISLHSKLHLVFALMALTAGSAGVAIADVTV  161

Query  774  daCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLV  953
            DACV +NSISHPSLA DMQSLC  +S+ G L+G+ ISG  VHLIG KGVFG+L++P +LV
Sbjct  162  DACVAQNSISHPSLAADMQSLCALTSATGALVGFSISGVFVHLIGPKGVFGLLTIPAALV  221

Query  954  VLVGIMIRE  980
              VGI++ E
Sbjct  222  FSVGIVLAE  230



>ref|XP_010929183.1| PREDICTED: probable folate-biopterin transporter 2 [Elaeis guineensis]
Length=512

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+D +HWSFV  VVIV GI+QGL   + R++  YY KD QK+QPS AQ++ GI SLPWIV
Sbjct  54   LADEMHWSFVFGVVIVNGISQGLGGAIWRVASDYYWKDVQKVQPSAAQVYHGITSLPWIV  113

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLP+AGYRRRPY ILAG +GVI+MLTLS++ +L +  AL+ + AGSAGVAI
Sbjct  114  KPLWGILTDVLPVAGYRRRPYLILAGLVGVISMLTLSLHSKLHVVFALMAMTAGSAGVAI  173

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV +DACV +NSI+HP+LA DMQSLCG SSS+G L+G++ISG LVH I S+GV G++S+
Sbjct  174  ADVTVDACVAQNSINHPALAADMQSLCGLSSSIGSLLGFLISGLLVHAISSQGVLGLISI  233

Query  939  PPSLVVLVGIMIRE  980
            P +LV  VG++++E
Sbjct  234  PFALVFSVGLVLKE  247



>ref|XP_010417642.1| PREDICTED: probable folate-biopterin transporter 3 [Camelina 
sativa]
Length=497

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 162/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY KDEQK+QPS+AQI+ G+I +PWI+
Sbjct  41   LIEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQKIQPSQAQIYVGLIQIPWII  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDV+P+ GYRRRPYFI AG L +I+M+ L ++  L + LAL CL+AGSAGVAI
Sbjct  101  KPLWGLLTDVVPVWGYRRRPYFIFAGFLAMISMMVLWLDTNLHLALALSCLVAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHLIG+KGV+G+L +
Sbjct  161  ADVTIDACVTQCSISHPTLAADMQSLCGLSSSIGSLVGFSLSGVLVHLIGAKGVYGLLGL  220

Query  939  PPSLVVLVGIMIRES  983
               LVV+VG++++ES
Sbjct  221  TAGLVVVVGMVLKES  235



>ref|XP_010474503.1| PREDICTED: probable folate-biopterin transporter 3, partial [Camelina 
sativa]
Length=270

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY KDEQK+QPS+AQI+ G+I +PWI+
Sbjct  41   LIEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQKIQPSQAQIYVGLIQIPWII  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDV+P+ GYRRRPYFI AG L +I+M+ L ++  L + L L CL+AGSAGVAI
Sbjct  101  KPLWGLLTDVVPVWGYRRRPYFIFAGLLAMISMMVLWLHTNLHLALGLSCLVAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHL G++GV+G+L +
Sbjct  161  ADVTIDACVTQCSISHPTLAADMQSLCGLSSSIGSLVGFSLSGVLVHLFGARGVYGLLGL  220



>emb|CDX88152.1| BnaA06g27430D [Brassica napus]
Length=499

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 150/195 (77%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  38   LAKELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYF+LAG LGV++ML +S +  L + LALL +   SA +AI
Sbjct  98   KPLWGILTDVLPIYGFHRRPYFVLAGVLGVVSMLFISVLGNLHLYLALLWMTIASAAMAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVHL+GSKGVFG+L++
Sbjct  158  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHLVGSKGVFGLLTL  217

Query  939  PPSLVVLVGIMIRES  983
            P +LV +VG++  ES
Sbjct  218  PFALVSVVGLVFSES  232



>gb|KJB55121.1| hypothetical protein B456_009G063900 [Gossypium raimondii]
Length=493

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSFV  VV +YGINQGL   LSRI  +YYMKD Q++QPSEAQ+++GI S+PWI+KP+W
Sbjct  42   MHWSFVFGVVSIYGINQGLGGALSRIGTEYYMKDVQRVQPSEAQVYSGITSIPWIIKPIW  101

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDV+PI  YRRRPYFIL+G LGV++ML +S++ +L++  A+L L AG+   A+ADV 
Sbjct  102  GLLTDVVPIMSYRRRPYFILSGMLGVVSMLFISLHSKLQLVFAILALTAGNLAGAVADVT  161

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            +DACV +NSISHPS A DMQSLC  S S G L+G+ ISG  ++LIG KGVFG+L++P +L
Sbjct  162  VDACVAQNSISHPSRAADMQSLCTLSYSFGGLLGFSISGVFINLIGPKGVFGLLTLPAAL  221

Query  951  VVLVGIMIRE  980
            + LVGI++ E
Sbjct  222  ISLVGILLSE  231



>ref|XP_006301270.1| hypothetical protein CARUB_v10021670mg [Capsella rubella]
 gb|EOA34168.1| hypothetical protein CARUB_v10021670mg [Capsella rubella]
Length=497

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 161/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V+IVYG++QGL  GLS++S QYY KDEQK+QPS+AQI+ G+I +PWI+
Sbjct  41   LIEELHWSFFFGVIIVYGVSQGLGKGLSKVSTQYYFKDEQKIQPSQAQIYVGLIQIPWII  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDV+P+ GYRRRPYFI AG L +I+M+ L ++  L + LAL CL+AGSAGVAI
Sbjct  101  KPLWGLLTDVVPVFGYRRRPYFIFAGFLAMISMMVLWLHTNLHLALALSCLVAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHL GSKGV+G+L +
Sbjct  161  ADVTIDACVTQCSISHPTLAADMQSLCGLSSSIGSLVGFSLSGVLVHLFGSKGVYGLLGL  220

Query  939  PPSLVVLVGIMIRES  983
               LVV+VG++++ES
Sbjct  221  TAGLVVVVGMVLKES  235



>ref|NP_001057012.1| Os06g0186700 [Oryza sativa Japonica Group]
 dbj|BAD72450.1| integral membrane transporter-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF18926.1| Os06g0186700 [Oryza sativa Japonica Group]
 dbj|BAG93259.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VV  YG +QGL  G+ R++  YY KD Q++QPS AQ++ G+ S+PW+VKPLW
Sbjct  57   LHWSFVAGVVATYGASQGLGGGVMRVASDYYWKDVQRVQPSAAQVYQGVTSIPWMVKPLW  116

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDVLPIAGYRRRPYF++AG +GV+AML LS++ +L +  ALL LMAGSA VAIADV 
Sbjct  117  GLLTDVLPIAGYRRRPYFVIAGFMGVVAMLVLSLHSKLHVLFALLALMAGSASVAIADVT  176

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV ENSI HP LA DM SL G  +SVG LIG+ ISGFLVH IGS+G  G+L++P +L
Sbjct  177  IDACVAENSIVHPHLAADMISLNGFCASVGGLIGFSISGFLVHAIGSQGALGMLAIPSAL  236

Query  951  VVLVGIMIRE  980
            V+L G+MI++
Sbjct  237  VILAGMMIKD  246



>ref|XP_003560977.1| PREDICTED: probable folate-biopterin transporter 2 [Brachypodium 
distachyon]
Length=540

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFVL VV  YG++QGL  G++R++  YY KD QK+QPS AQ++ G+ S+PW++KPLW
Sbjct  56   LHWSFVLGVVATYGVSQGLGGGITRVASDYYWKDVQKVQPSAAQVYHGVTSIPWLIKPLW  115

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDVLP+AGYRRRPYF+LAG +GVIAML +S++ +L +  ALL LM+GSA VAIADV 
Sbjct  116  GLLTDVLPVAGYRRRPYFVLAGIMGVIAMLIVSLHSKLHVFFALLALMSGSASVAIADVT  175

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV ENS+ HP LA DM SL G  +SVG LIG+ ISGFLVH IGS+G  G+L++P +L
Sbjct  176  IDACVAENSLIHPHLAADMISLNGFCASVGGLIGFSISGFLVHAIGSQGALGMLTIPSAL  235

Query  951  VVLVGIMIRE  980
            V+L G+++++
Sbjct  236  VILAGMLLKD  245



>ref|XP_009151029.1| PREDICTED: probable folate-biopterin transporter 2 [Brassica 
rapa]
Length=499

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  38   LAKELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYF+LAG LGV++ML +S +  L + LALL +   SA +AI
Sbjct  98   KPLWGILTDVLPIYGFHRRPYFVLAGVLGVVSMLFISVLGNLHLYLALLWMTIASAAMAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVHL+GSKGVFG+L++
Sbjct  158  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHLVGSKGVFGLLTL  217

Query  939  PPSLVVLVGIMIRES  983
            P +L  +VG++  ES
Sbjct  218  PFALASVVGMVFSES  232



>gb|KFK27767.1| hypothetical protein AALP_AA8G426300 [Arabis alpina]
Length=499

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  37   LSSELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDV+PI G+ RRPYFILAG LGV++M+ +S++  L + LALL +   SA +AI
Sbjct  97   KPLWGILTDVVPIFGFHRRPYFILAGVLGVVSMMFISIHSNLHLYLALLWMTISSAAMAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVHL+GSKGVFG+L+ 
Sbjct  157  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHLVGSKGVFGLLTF  216

Query  939  PPSLVVLVGIMIRES  983
            P  LV +VGI+  ES
Sbjct  217  PFVLVSVVGIVFSES  231



>ref|XP_010429876.1| PREDICTED: probable folate-biopterin transporter 3 [Camelina 
sativa]
Length=497

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 161/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY KDEQK+QPS+AQI+ G+I +PWI+
Sbjct  41   LIEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQKIQPSQAQIYVGLIQIPWII  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDV+P+ GYRRRPYFI AG L +I+M+ L ++  L + L L CL+AGSAGVAI
Sbjct  101  KPLWGLLTDVVPVWGYRRRPYFIFAGLLAMISMMVLWLHTNLHLALGLSCLVAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHLIG+KGV+G+L +
Sbjct  161  ADVTIDACVTQCSISHPTLAADMQSLCGLSSSIGSLVGFSLSGVLVHLIGAKGVYGLLGL  220

Query  939  PPSLVVLVGIMIRES  983
               LVV+VG++++ES
Sbjct  221  TAGLVVVVGMVLKES  235



>emb|CDX80483.1| BnaC07g29610D [Brassica napus]
Length=499

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  38   LAKELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYF+LAG LGV++ML +S +  L + LALL +   SA +AI
Sbjct  98   KPLWGILTDVLPIYGFHRRPYFVLAGVLGVVSMLFISVLGNLHLYLALLWMTIASAAMAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVHL+GSKGVFG+L++
Sbjct  158  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHLVGSKGVFGLLTL  217

Query  939  PPSLVVLVGIMIRES  983
            P +L  +VG++  ES
Sbjct  218  PFALASVVGMVFSES  232



>gb|AAO64142.1| putative membrane protein [Arabidopsis thaliana]
 dbj|BAF00588.1| putative membrane protein [Arabidopsis thaliana]
Length=499

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  37   LSSELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYFILAG LGV+++L +S++  L + LAL  +   SA +AI
Sbjct  97   KPLWGILTDVLPIFGFHRRPYFILAGVLGVVSLLFISLHSNLHLYLALFWMTISSAAMAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVHL+GSKGVFG+L+ 
Sbjct  157  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHLVGSKGVFGLLTF  216

Query  939  PPSLVVLVGIMIRE  980
            P +LV +VGI+  E
Sbjct  217  PFALVSVVGIVFSE  230



>ref|NP_197887.1| probable folate-biopterin transporter 2 [Arabidopsis thaliana]
 sp|Q5FV41.1|FBT2_ARATH RecName: Full=Probable folate-biopterin transporter 2 [Arabidopsis 
thaliana]
 gb|AAW70379.1| At5g25050 [Arabidopsis thaliana]
 gb|AED93394.1| probable folate-biopterin transporter 2 [Arabidopsis thaliana]
Length=499

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  37   LSSELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYFILAG LGV+++L +S++  L + LAL  +   SA +AI
Sbjct  97   KPLWGILTDVLPIFGFHRRPYFILAGVLGVVSLLFISLHSNLHLYLALFWMTISSAAMAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVHL+GSKGVFG+L+ 
Sbjct  157  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHLVGSKGVFGLLTF  216

Query  939  PPSLVVLVGIMIRE  980
            P +LV +VGI+  E
Sbjct  217  PFALVSVVGIVFSE  230



>gb|KHG17661.1| Shikimate kinase [Gossypium arboreum]
Length=438

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = +3

Query  417  HWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWG  596
            HWSFV +VV  YGI+QGL   L+R+  +YYMKD QK+QPSE+Q++TGI S+PWIVKP+WG
Sbjct  42   HWSFVFAVVSTYGISQGLGGALARVGTEYYMKDVQKVQPSESQVYTGITSIPWIVKPIWG  101

Query  597  LLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvii  773
            LLTDV+PI GYRRRPYFIL+G LG+++ML +S++ +L +  AL+ L AGSAGVAIADV +
Sbjct  102  LLTDVIPIRGYRRRPYFILSGLLGLVSMLVISLHGKLHLVFALMALTAGSAGVAIADVTV  161

Query  774  daCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLV  953
            DACV +NS  +PSLA DMQSLC   S++G LIG+ ISG  VHLIG KGVFG+L++P +LV
Sbjct  162  DACVAQNSNKNPSLAADMQSLCSLMSAIGALIGFSISGVFVHLIGPKGVFGLLTIPAALV  221

Query  954  VLVGIMIRE  980
              VGI++ E
Sbjct  222  FSVGIVLLE  230



>ref|XP_010421353.1| PREDICTED: probable folate-biopterin transporter 2 [Camelina 
sativa]
Length=500

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YG+NQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  38   LSSELHWSFVFGVVSLYGVNQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYFILAG LGV+++L +S++  L + LALL +   SA +AI
Sbjct  98   KPLWGILTDVLPIFGFHRRPYFILAGVLGVVSLLFISLHSNLHLYLALLWMTISSAAMAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVH +GSKGVFG+L+ 
Sbjct  158  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHFVGSKGVFGLLTF  217

Query  939  PPSLVVLVGIMIRE  980
            P +LV +VGI+  E
Sbjct  218  PFALVSVVGIVFNE  231



>ref|XP_009129989.1| PREDICTED: probable folate-biopterin transporter 2 [Brassica 
rapa]
 emb|CDY05469.1| BnaA02g32220D [Brassica napus]
Length=498

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YGINQGL   + R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  37   LSKELHWSFVFGVVSLYGINQGLGGSMGRVATEYYMKDVQKVQPSESQALTAITKIPWII  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI GY RRPYFILAG LGV++ML +S++  L +  AL+ +   SA +AI
Sbjct  97   KPLWGILTDVLPIFGYHRRPYFILAGVLGVVSMLFISLHSNLHLYFALMWMTLSSAAMAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI   +LA DMQSLC  SSS+G L+GY +SG LVHL+GSKGVFG+L++
Sbjct  157  ADVTIDACTAYNSIKQSALASDMQSLCSLSSSIGALVGYFMSGILVHLVGSKGVFGLLTL  216

Query  939  PPSLVVLVGIMIRES  983
            P +LV +VGI+  ES
Sbjct  217  PFALVSVVGIVFSES  231



>emb|CDY05381.1| BnaC02g40890D [Brassica napus]
Length=498

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YGINQGL   + R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  37   LSKELHWSFVFGVVSLYGINQGLGGSMGRVATEYYMKDVQKVQPSESQALTAITKIPWII  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI GY RRPYFILAG LGV++ML +S++  L +  AL+ +   SA +AI
Sbjct  97   KPLWGILTDVLPIFGYHRRPYFILAGVLGVVSMLFISLHGNLHLYFALMWMTLSSAAMAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI   +LA DMQSLC  SSS+G L+GY +SG LVHL+GSKGVFG+L++
Sbjct  157  ADVTIDACTAYNSIKQSALASDMQSLCSLSSSIGALVGYFMSGILVHLVGSKGVFGLLTL  216

Query  939  PPSLVVLVGIMIRES  983
            P +LV +VGI+  ES
Sbjct  217  PFALVSVVGIVFSES  231



>ref|XP_006289494.1| hypothetical protein CARUB_v10003028mg [Capsella rubella]
 gb|EOA22392.1| hypothetical protein CARUB_v10003028mg [Capsella rubella]
Length=499

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  37   LASELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYFILAG LGV+++L +S++  L + LAL  +   SA +AI
Sbjct  97   KPLWGILTDVLPIFGFHRRPYFILAGVLGVVSLLFISLHSNLHLYLALWWMTISSAAMAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVHL+GSKGVFG+L+ 
Sbjct  157  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHLVGSKGVFGLLTF  216

Query  939  PPSLVVLVGIMIRE  980
            P +LV +VGI+  E
Sbjct  217  PFALVSVVGIVFNE  230



>ref|XP_007161137.1| hypothetical protein PHAVU_001G045500g [Phaseolus vulgaris]
 gb|ESW33131.1| hypothetical protein PHAVU_001G045500g [Phaseolus vulgaris]
Length=498

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 153/194 (79%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  +HWSFV  VV++YGI+QG+   L+ +  +YYMKD QK+QPSEAQ++ GI S+PWIV
Sbjct  38   LSREMHWSFVFGVVVIYGISQGIGGALAEVGTKYYMKDVQKVQPSEAQVYKGITSIPWIV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLP  GYRRRPYF+ AG LGVI+ML LS ++ L + LALL L AGSAGVAI
Sbjct  98   KPLWGLLTDVLPFFGYRRRPYFVFAGILGVISMLLLSWHKNLHLVLALLSLTAGSAGVAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSISHPSLA DMQSLC  SSSVG L G+ ISG  VHLIG  GVFG++++
Sbjct  158  ADVTIDACVAQNSISHPSLAADMQSLCAFSSSVGSLFGFFISGIFVHLIGPMGVFGLMTI  217

Query  939  PPSLVVLVGIMIRE  980
            P  LV+ VG ++ E
Sbjct  218  PAGLVIFVGFLLYE  231



>ref|XP_010454828.1| PREDICTED: probable folate-biopterin transporter 2 [Camelina 
sativa]
Length=501

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YG+NQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  38   LSSELHWSFVFGVVSLYGVNQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYFILAG LGV+++  +S++  L + LALL +   SA +AI
Sbjct  98   KPLWGILTDVLPIFGFHRRPYFILAGVLGVVSLFFISLHSNLHLYLALLWMTISSAAMAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVH +GSKGVFG+L+ 
Sbjct  158  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHFVGSKGVFGLLTF  217

Query  939  PPSLVVLVGIMIRE  980
            P +LV +VGI+  E
Sbjct  218  PFALVSVVGIVFNE  231



>ref|XP_011031425.1| PREDICTED: probable folate-biopterin transporter 2 [Populus euphratica]
Length=497

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 147/197 (75%), Gaps = 1/197 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++  HWSFV  V+ VYG+NQGL    +R+   YYMKD QK+QPSE+QI+ GIIS+PW+V
Sbjct  38   LANETHWSFVFGVLAVYGVNQGLGGAFNRVGTDYYMKDVQKVQPSESQIYQGIISIPWLV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGL+TD LPI GYRRRPY I AG LG  +ML LS ++ L I  ALL + AGS G AI
Sbjct  98   KPLWGLVTDFLPIFGYRRRPYLIFAGLLGTFSMLLLSFHENLHIVFALLSMTAGSTGAAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NS   PSLA DMQSLC  SSS+G L+G+ +SG  VHLIG KGVFG+LS+
Sbjct  158  ADVTIDACVVQNSNIRPSLAADMQSLCALSSSIGALMGFSLSGIFVHLIGPKGVFGLLSI  217

Query  939  PPSLVVLVGIMIRESLR  989
            P  LV LVGI++ E  +
Sbjct  218  PYGLVFLVGILLDEPFK  234



>emb|CDP07891.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            KL+  +HWSFV  VVIVYGI+QGL  G +R+  +YYMK+ QK+QPSE+Q++ GI ++PWI
Sbjct  37   KLAREMHWSFVFGVVIVYGISQGLGGGFARLGTEYYMKEVQKVQPSESQVYLGITNIPWI  96

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagva  755
            VKPLWGLLTDV+PI GYRRRPYFILAG +GVI+ML LS+++ L I  ALL + AGSAGVA
Sbjct  97   VKPLWGLLTDVVPILGYRRRPYFILAGFVGVISMLFLSLHKNLHIVYALLLMTAGSAGVA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV +DACV +NS +HPSLA DMQSLC  SSS+G L+G+ +SG  VHLIG  GVFG+LS
Sbjct  157  IADVTVDACVAQNSGTHPSLAADMQSLCALSSSIGSLVGFSLSGIFVHLIGPNGVFGLLS  216

Query  936  MP  941
            +P
Sbjct  217  IP  218



>gb|EEC80148.1| hypothetical protein OsI_21953 [Oryza sativa Indica Group]
Length=601

 Score =   219 bits (557),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 153/197 (78%), Gaps = 8/197 (4%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV +VV  YG++QGL  G+ R++  YY KD Q++QPS AQ++ G+ S+PW+VKPLW
Sbjct  112  LHWSFVAAVVATYGVSQGLGGGIMRVASDYYWKDVQRVQPSAAQVYQGVTSIPWMVKPLW  171

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDVLPIAGYRRRPYF++AG +GV+AML LS++ +L +  ALL LMAGSA VAIADV 
Sbjct  172  GLLTDVLPIAGYRRRPYFVIAGFMGVVAMLVLSLHSKLHVLFALLALMAGSASVAIADVT  231

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGS-------KGVFGI  929
            IDACV ENSI HP LA DM SL G  +SVG LIG+ ISGFLVH IGS       KG  G+
Sbjct  232  IDACVAENSIVHPHLAADMISLNGFCASVGGLIGFSISGFLVHAIGSQINLVFLKGALGM  291

Query  930  LSMPPSLVVLVGIMIRE  980
            L++P +LV+L G+MI++
Sbjct  292  LAIPSALVILAGMMIKD  308



>ref|XP_009615878.1| PREDICTED: probable folate-biopterin transporter 2 [Nicotiana 
tomentosiformis]
Length=501

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VVIVYG++QGL    S I  +YYMKD QK+QPSE+Q+++GI S+PWIVKPLW
Sbjct  44   LHWSFVFGVVIVYGVSQGLGGAFSMIGTEYYMKDVQKVQPSESQVYSGITSIPWIVKPLW  103

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDV+PI GYRRRPYF+ AGSLGV++ML LS+++ L I  ALL L AGSAGVAIADV 
Sbjct  104  GLLTDVVPILGYRRRPYFLFAGSLGVVSMLFLSLHKNLHIVFALLSLTAGSAGVAIADVT  163

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMP  941
            +DACV +NS SHPSLA DMQSLC  SSS+G L+G+ +SG LVHL+G  GV+G+LS+P
Sbjct  164  VDACVAQNSGSHPSLAADMQSLCSLSSSIGALVGFSLSGTLVHLLGPMGVYGLLSIP  220



>ref|XP_010927961.1| PREDICTED: probable folate-biopterin transporter 2 [Elaeis guineensis]
Length=499

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 153/194 (79%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  +HWSFV  +V V GI+QGL   + R++  YY KD Q+ QPS AQ++ GI SLPWIV
Sbjct  41   LAKEMHWSFVYGIVAVNGISQGLGGAVFRVASDYYWKDVQQAQPSAAQVYQGITSLPWIV  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KPLWGLLTD+LP+AGYRRRPYFILAG LG I+ML + + N +   L LL L AGSAGVAI
Sbjct  101  KPLWGLLTDILPVAGYRRRPYFILAGLLGAISMLVMWLQNGMCTVLGLLLLTAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI+HPSLA DMQSLCG SSS+G LIG+ ISG L+H IGSKGV G+LS+
Sbjct  161  ADVTIDACVAQNSINHPSLAADMQSLCGFSSSIGGLIGFSISGLLMHAIGSKGVLGLLSI  220

Query  939  PPSLVVLVGIMIRE  980
            P +LV+ VG++++E
Sbjct  221  PATLVLSVGMVLKE  234



>ref|XP_006394753.1| hypothetical protein EUTSA_v10004061mg [Eutrema salsugineum]
 gb|ESQ32039.1| hypothetical protein EUTSA_v10004061mg [Eutrema salsugineum]
Length=499

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  37   LARELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WG+LTDVLP+ G+ RRPYFILAG LGV+++L +S++  L + LAL  +   SA +AI
Sbjct  97   KPIWGILTDVLPMFGFHRRPYFILAGVLGVVSLLFISIHSNLHLYLALFWMTISSAAMAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+GY +SG LVHL+G KGVFG+L+ 
Sbjct  157  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALVGYFMSGILVHLVGPKGVFGLLTF  216

Query  939  PPSLVVLVGIMIRES  983
            P +LV +VG++  ES
Sbjct  217  PFALVSVVGVVFSES  231



>ref|XP_008794379.1| PREDICTED: probable folate-biopterin transporter 2 [Phoenix dactylifera]
Length=511

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 154/194 (79%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+D +HWSFV  VV V GI+QGL   + R++  YY KD QK+QPS AQ++ GI SLPWIV
Sbjct  53   LADEMHWSFVFGVVTVNGISQGLGGAIWRVASDYYWKDVQKVQPSAAQVYHGITSLPWIV  112

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KPLWGLLTDVLP+AGYRRRPY ILAG +G I+MLTLS+ ++L +  AL+ + AGSAGVAI
Sbjct  113  KPLWGLLTDVLPLAGYRRRPYLILAGLVGAISMLTLSLHDKLHVVFALMAMTAGSAGVAI  172

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI+HP+LA DMQSLC  S S+G L+G+ ISG LVH I S+GV G++S+
Sbjct  173  ADVTIDACVAQNSINHPALAADMQSLCELSLSIGSLLGFSISGLLVHAISSQGVLGLISI  232

Query  939  PPSLVVLVGIMIRE  980
            P +LV  VGI+++E
Sbjct  233  PFALVFSVGIVLKE  246



>ref|XP_002872136.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48395.1| integral membrane transporter family protein, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=498

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YGINQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  36   LSSELHWSFVFGVVSLYGINQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  95

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYFILAG LGV+++L +S++  L + LALL +   SA +AI
Sbjct  96   KPLWGILTDVLPIFGFHRRPYFILAGVLGVVSLLFISLHSNLHLYLALLWMTISSAAMAI  155

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVH++GSK VFG+L+ 
Sbjct  156  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHIVGSKVVFGLLTF  215

Query  939  PPSLVVLVGIMIRE  980
            P +LV +VGI+  E
Sbjct  216  PFALVSVVGIVFSE  229



>ref|XP_010495476.1| PREDICTED: probable folate-biopterin transporter 2 [Camelina 
sativa]
Length=725

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV +YG+NQGL   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  262  LSSELHWSFVFGVVSLYGVNQGLGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  321

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLPI G+ RRPYFILAG LGV+++L +S++  L + LALL +   SA +AI
Sbjct  322  KPLWGILTDVLPIFGFHRRPYFILAGVLGVVSLLFISLHSNLHLYLALLWMTISSAAMAI  381

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC   NSI HPSLA DMQSLC  SSS+G L+G+ +SG LVH +GSKGVFG+L+ 
Sbjct  382  ADVTIDACTAYNSIKHPSLASDMQSLCSLSSSIGALLGFFMSGILVHFVGSKGVFGLLTF  441

Query  939  PPSLVVLVGIMIRE  980
            P +LV +VGI+  E
Sbjct  442  PYALVSVVGIVFNE  455



>ref|XP_009790825.1| PREDICTED: probable folate-biopterin transporter 2 [Nicotiana 
sylvestris]
Length=501

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VVIVYG++QGL    S I  +YYMKD QK+QPSE+Q+++GI S+PWIVKPLW
Sbjct  44   LHWSFVFGVVIVYGVSQGLGGAFSMIGTEYYMKDVQKVQPSESQVYSGITSIPWIVKPLW  103

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GLLTDV+PI GYRRRPYF+ AGSLGV++ML LS+++ L I  ALL L AGSAGVAIADV 
Sbjct  104  GLLTDVVPILGYRRRPYFLFAGSLGVVSMLFLSLHKNLHIVFALLSLTAGSAGVAIADVT  163

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMP  941
            +DACV +NS SHPSLA DMQSLC  SSS+G L+G+ +SG LVHL+G  GV+G+LS+P
Sbjct  164  VDACVAQNSGSHPSLAADMQSLCSLSSSIGALVGFSLSGTLVHLLGPLGVYGLLSIP  220



>ref|XP_002309684.1| hypothetical protein POPTR_0006s28180g [Populus trichocarpa]
 gb|EEE93207.1| hypothetical protein POPTR_0006s28180g [Populus trichocarpa]
Length=494

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++  HWSFV  V+ VYGINQGL   L+R+   YYMKD QK+QPSE+QI+ GIIS+PW+V
Sbjct  38   LANETHWSFVFGVLAVYGINQGLGGALNRVGTDYYMKDVQKVQPSESQIYQGIISIPWLV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGL+TD LPI GYRRRPY I AG LG  + L LS ++ L I  ALL + AGS G AI
Sbjct  98   KPLWGLVTDFLPIFGYRRRPYLIFAGLLGTFSTLLLSFHENLHIVFALLSMTAGSTGAAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NS   PSLA DMQSLC  SSS+G L+G+ +SG  VHLIG KGVFG+LS+
Sbjct  158  ADVTIDACVVQNSNIRPSLAADMQSLCALSSSIGALMGFSLSGIFVHLIGPKGVFGLLSI  217

Query  939  PPSLVVLVGIMIRE  980
            P  LV LVGI++ E
Sbjct  218  PYGLVFLVGILLDE  231



>gb|EEE65228.1| hypothetical protein OsJ_20385 [Oryza sativa Japonica Group]
Length=546

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 151/197 (77%), Gaps = 8/197 (4%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFV  VV  YG +QGL  G+ R++  YY KD Q++QPS AQ++ G+ S+PW+VKPLW
Sbjct  57   LHWSFVAGVVATYGASQGLGGGVMRVASDYYWKDVQRVQPSAAQVYQGVTSIPWMVKPLW  116

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDVLPIAGYRRRPYF++AG +GV+AML LS++ +L +  ALL LMAGSA VAIADV 
Sbjct  117  GLLTDVLPIAGYRRRPYFVIAGFMGVVAMLVLSLHSKLHVLFALLALMAGSASVAIADVT  176

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGS-------KGVFGI  929
            IDACV ENSI HP LA DM SL G  +SVG LIG+ ISGFLVH IGS       KG  G+
Sbjct  177  IDACVAENSIVHPHLAADMISLNGFCASVGGLIGFSISGFLVHAIGSQINLVFLKGALGM  236

Query  930  LSMPPSLVVLVGIMIRE  980
            L++P +LV+L G+MI++
Sbjct  237  LAIPSALVILAGMMIKD  253



>ref|XP_004498793.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X2 [Cicer arietinum]
Length=503

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 155/194 (80%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  +HWSFV  VV+VYGI+QG    L+ +  +YYMKD QK+QPSEAQ++ GI S+PWIV
Sbjct  43   LSREMHWSFVFGVVVVYGISQGFGGALAGVGTKYYMKDIQKVQPSEAQVYAGITSIPWIV  102

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLPI GYRRRPYFI AG LG IAML LSM++ L + LA+L L AGSAGVAI
Sbjct  103  KPLWGLLTDVLPILGYRRRPYFIFAGFLGAIAMLLLSMHENLHLVLAILSLTAGSAGVAI  162

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSISHPSLA DMQSLC  SSSVG L+G+ ISG  VHLIG  GVFG++++
Sbjct  163  ADVTIDACVAQNSISHPSLAADMQSLCAFSSSVGALLGFSISGIFVHLIGPTGVFGLMTI  222

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVG ++ E
Sbjct  223  PAGLVILVGFLLDE  236



>ref|XP_004498792.1| PREDICTED: probable folate-biopterin transporter 2-like isoform 
X1 [Cicer arietinum]
Length=524

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 155/194 (80%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  +HWSFV  VV+VYGI+QG    L+ +  +YYMKD QK+QPSEAQ++ GI S+PWIV
Sbjct  43   LSREMHWSFVFGVVVVYGISQGFGGALAGVGTKYYMKDIQKVQPSEAQVYAGITSIPWIV  102

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLPI GYRRRPYFI AG LG IAML LSM++ L + LA+L L AGSAGVAI
Sbjct  103  KPLWGLLTDVLPILGYRRRPYFIFAGFLGAIAMLLLSMHENLHLVLAILSLTAGSAGVAI  162

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSISHPSLA DMQSLC  SSSVG L+G+ ISG  VHLIG  GVFG++++
Sbjct  163  ADVTIDACVAQNSISHPSLAADMQSLCAFSSSVGALLGFSISGIFVHLIGPTGVFGLMTI  222

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVG ++ E
Sbjct  223  PAGLVILVGFLLDE  236



>ref|XP_010541554.1| PREDICTED: probable folate-biopterin transporter 2 [Tarenaya 
hassleriana]
Length=499

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LHWSFV  VV VYGINQG+   L R++ +YYMKD QK+QPSE+Q  T I  +PWI+
Sbjct  35   LSAELHWSFVFGVVSVYGINQGVGGSLGRVATEYYMKDVQKVQPSESQALTAITKIPWII  94

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTDVLP+ G++RRPYF+LAG LG +++L +S++  L + LAL  +   SA +A+
Sbjct  95   KPLWGILTDVLPMFGFKRRPYFVLAGFLGAVSLLLISVHSNLHLFLALFWMTVASAAMAV  154

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI HPSLA DMQSLC  SSS+G L+G+ +SG  VH  GS+GVFG+L++
Sbjct  155  ADVTIDACIAYNSIEHPSLASDMQSLCSFSSSIGALLGFFMSGIFVHWFGSQGVFGLLTV  214

Query  939  PPSLVVLVGIMIRE  980
            P  LV +VGIM+ E
Sbjct  215  PFGLVAVVGIMLNE  228



>ref|XP_008789895.1| PREDICTED: probable folate-biopterin transporter 2 isoform X1 
[Phoenix dactylifera]
Length=499

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  +HWSFV  +V V GI+QGL   + R++  YY KD Q  QPS AQ++ GI SLPWIV
Sbjct  41   LAKEMHWSFVYGIVAVNGISQGLGGAIFRVASDYYWKDVQLAQPSAAQVYQGITSLPWIV  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KPLWGLLTD+LP+AGY+RRPYFILAG LG I+ML + + N +   L LL L AGSAGVAI
Sbjct  101  KPLWGLLTDILPVAGYKRRPYFILAGLLGAISMLIMWLQNGMCTVLGLLLLTAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI+HPSLA DMQSLCG SSS+G LIG+ ISG L+H IGSKGV G+LS+
Sbjct  161  ADVTIDACVAQNSINHPSLAADMQSLCGFSSSIGGLIGFSISGLLMHAIGSKGVLGLLSI  220

Query  939  PPSLVVLVGIMIRE  980
            P +LV+ VG++++E
Sbjct  221  PAALVLSVGMVLKE  234



>ref|XP_008790123.1| PREDICTED: probable folate-biopterin transporter 2 [Phoenix dactylifera]
Length=508

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = +3

Query  303  DEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYGINQGLSLGL  482
            +E   L G + KE+++ +   R RW PF WFR L+D +HWSFV  VV VYGINQGL   +
Sbjct  17   EETIGLTGDAPKEKEAIEVEQRCRWSPFSWFRMLADEMHWSFVFGVVTVYGINQGLGGAI  76

Query  483  SRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGS  662
             R++  YY KD QK+QPS +Q++ GI SLPWIVKPLWGLLTDVLP+AGYRRRPY ILAG 
Sbjct  77   WRVASDYYWKDVQKVQPSASQVYQGITSLPWIVKPLWGLLTDVLPMAGYRRRPYLILAGL  136

Query  663  LGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLC  839
            LGVI+ML LS++Q L +  ALL + AGSAGVAIADV IDACV +NS +HP+LA DMQSLC
Sbjct  137  LGVISMLMLSLHQKLHVVFALLAMTAGSAGVAIADVTIDACVAQNSKNHPALAADMQSLC  196

Query  840  GGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            G SSS G+L+G+ ISG LVH IGS+GVFG++ +P +LV  VGI+++E+
Sbjct  197  GLSSSSGRLLGFSISGLLVHAIGSQGVFGLMGIPFALVFSVGIVLKET  244



>ref|XP_008445272.1| PREDICTED: probable folate-biopterin transporter 2 [Cucumis melo]
Length=503

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSFV  VVIVYGI+QGL   L+R+S +YYMKD QK+QPSEAQ+++GI S+PW+VKP+W
Sbjct  41   MHWSFVFGVVIVYGISQGLGGALNRVSTKYYMKDVQKVQPSEAQVYSGITSIPWMVKPIW  100

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GL TD++PI GY RRPYF+ AG LGVI++L+L++++ L + LA+L L AGSA VAIADV 
Sbjct  101  GLFTDLVPILGYHRRPYFVFAGLLGVISLLSLALHEKLHLVLAILLLTAGSASVAIADVT  160

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NS  HP+LA D+QSLC  SSS+G L+G+ ISG LVHLIGSKGV+G+L++P  L
Sbjct  161  IDACVAQNSNIHPTLAADLQSLCALSSSIGALLGFSISGILVHLIGSKGVYGLLAIPGGL  220

Query  951  VVLVGIMIRE  980
            V LVGI++ E
Sbjct  221  VFLVGILLNE  230



>ref|XP_008789896.1| PREDICTED: probable folate-biopterin transporter 2 isoform X2 
[Phoenix dactylifera]
Length=499

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  +HWSFV  +V V GI+QGL   + R++  YY KD Q  QPS AQ++ GI SLPWIV
Sbjct  41   LAKEMHWSFVYGIVAVNGISQGLGGAIFRVASDYYWKDVQLAQPSAAQVYQGITSLPWIV  100

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KPLWGLLTD+LP+AGY+RRPYFILAG LG I+ML + + N +   L LL L AGSAGVAI
Sbjct  101  KPLWGLLTDILPVAGYKRRPYFILAGLLGAISMLIMWLQNGMCTVLGLLLLTAGSAGVAI  160

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI+HPSLA DMQSLCG SSS+G LIG+ ISG L+H IGSKGV G+LS+
Sbjct  161  ADVTIDACVAQNSINHPSLAADMQSLCGFSSSIGGLIGFSISGLLMHAIGSKGVLGLLSI  220

Query  939  PPSLVVLVGIMIRE  980
            P +LV+ VG++++E
Sbjct  221  PAALVLSVGMVLKE  234



>gb|ERN07070.1| hypothetical protein AMTR_s00019p00060350 [Amborella trichopoda]
Length=471

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LSD LHW+FV  VVIVYGI+QGL   LSR++  YY KD Q +QPS +Q + GI  +PW+V
Sbjct  14   LSDELHWTFVTGVVIVYGISQGLGGALSRVASDYYWKDVQLVQPSASQFYQGITYIPWVV  73

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGL TDV P+AGY+RRPYFILAG LGV +ML LS++  L +  AL+CL AGSAGVAI
Sbjct  74   KPLWGLFTDVCPVAGYKRRPYFILAGLLGVFSMLVLSLHHNLHVVFALICLTAGSAGVAI  133

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI HP LA DMQSLCG SSS+G L+G+ ISGFLV+ IGS+G  G++S+
Sbjct  134  ADVTIDACVAQNSIRHPPLAPDMQSLCGFSSSIGALLGFSISGFLVYFIGSQGALGLMSI  193

Query  939  PPS  947
            P +
Sbjct  194  PAA  196



>gb|KJB55119.1| hypothetical protein B456_009G063800 [Gossypium raimondii]
Length=975

 Score =   218 bits (555),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +3

Query  417  HWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWG  596
            HWSFV +VV  YGI+QGL   L+R+  +YYMKD QK+QPSE+Q++TGI S+PWIVKP+WG
Sbjct  42   HWSFVFAVVSTYGISQGLGGALARVGTEYYMKDVQKVQPSESQVYTGITSIPWIVKPIWG  101

Query  597  LLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvii  773
            LLTDV+PI GYRRRPYFIL+G LG+++ML +S++ +L +  AL+ L AGSAGVAIADV +
Sbjct  102  LLTDVIPIRGYRRRPYFILSGLLGLVSMLIISLHGKLHLVFALMALTAGSAGVAIADVTV  161

Query  774  daCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLV  953
            DACV +NS   PSLA DMQSLC   S++G LIG+ ISG  VHLIG KGVFG+L++P +LV
Sbjct  162  DACVAQNSSKIPSLAADMQSLCSLMSAIGALIGFSISGVFVHLIGPKGVFGLLTIPAALV  221

Query  954  VLVGIMIRE  980
              VGI++ E
Sbjct  222  FSVGIVLFE  230



>ref|XP_006845395.2| PREDICTED: probable folate-biopterin transporter 2 isoform X1 
[Amborella trichopoda]
Length=477

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LSD LHW+FV  VVIVYGI+QGL   LSR++  YY KD Q +QPS +Q + GI  +PW+V
Sbjct  20   LSDELHWTFVTGVVIVYGISQGLGGALSRVASDYYWKDVQLVQPSASQFYQGITYIPWVV  79

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGL TDV P+AGY+RRPYFILAG LGV +ML LS++  L +  AL+CL AGSAGVAI
Sbjct  80   KPLWGLFTDVCPVAGYKRRPYFILAGLLGVFSMLVLSLHHNLHVVFALICLTAGSAGVAI  139

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI HP LA DMQSLCG SSS+G L+G+ ISGFLV+ IGS+G  G++S+
Sbjct  140  ADVTIDACVAQNSIRHPPLAPDMQSLCGFSSSIGALLGFSISGFLVYFIGSQGALGLMSI  199

Query  939  PPS  947
            P +
Sbjct  200  PAA  202



>ref|XP_011623772.1| PREDICTED: probable folate-biopterin transporter 2 isoform X2 
[Amborella trichopoda]
Length=474

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LSD LHW+FV  VVIVYGI+QGL   LSR++  YY KD Q +QPS +Q + GI  +PW+V
Sbjct  20   LSDELHWTFVTGVVIVYGISQGLGGALSRVASDYYWKDVQLVQPSASQFYQGITYIPWVV  79

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGL TDV P+AGY+RRPYFILAG LGV +ML LS++  L +  AL+CL AGSAGVAI
Sbjct  80   KPLWGLFTDVCPVAGYKRRPYFILAGLLGVFSMLVLSLHHNLHVVFALICLTAGSAGVAI  139

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSI HP LA DMQSLCG SSS+G L+G+ ISGFLV+ IGS+G  G++S+
Sbjct  140  ADVTIDACVAQNSIRHPPLAPDMQSLCGFSSSIGALLGFSISGFLVYFIGSQGALGLMSI  199

Query  939  PPS  947
            P +
Sbjct  200  PAA  202



>gb|KJB55120.1| hypothetical protein B456_009G063800 [Gossypium raimondii]
Length=1295

 Score =   218 bits (556),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +3

Query  417  HWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWG  596
            HWSFV +VV  YGI+QGL   L+R+  +YYMKD QK+QPSE+Q++TGI S+PWIVKP+WG
Sbjct  42   HWSFVFAVVSTYGISQGLGGALARVGTEYYMKDVQKVQPSESQVYTGITSIPWIVKPIWG  101

Query  597  LLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvii  773
            LLTDV+PI GYRRRPYFIL+G LG+++ML +S++ +L +  AL+ L AGSAGVAIADV +
Sbjct  102  LLTDVIPIRGYRRRPYFILSGLLGLVSMLIISLHGKLHLVFALMALTAGSAGVAIADVTV  161

Query  774  daCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLV  953
            DACV +NS   PSLA DMQSLC   S++G LIG+ ISG  VHLIG KGVFG+L++P +LV
Sbjct  162  DACVAQNSSKIPSLAADMQSLCSLMSAIGALIGFSISGVFVHLIGPKGVFGLLTIPAALV  221

Query  954  VLVGIMIRE  980
              VGI++ E
Sbjct  222  FSVGIVLFE  230



>ref|XP_010048291.1| PREDICTED: probable folate-biopterin transporter 2 [Eucalyptus 
grandis]
 gb|KCW80540.1| hypothetical protein EUGRSUZ_C01893 [Eucalyptus grandis]
Length=500

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  +HWSFVL VVIVYGI+QG+   L+ ++ +YYMKD QK+QPSE+Q+++GII +PW+V
Sbjct  42   LAAEMHWSFVLGVVIVYGISQGVGNALTDVATKYYMKDVQKVQPSESQVYSGIIYIPWVV  101

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaia  761
            KP+WG+LTDVLP+AGYRRRPY +LAG LGV +ML LS  ++ + LAL+ L AG+AGV I 
Sbjct  102  KPIWGILTDVLPVAGYRRRPYLVLAGILGVFSMLVLSFCKVHLVLALVLLTAGTAGVVIG  161

Query  762  dviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMP  941
            DV+IDACV +NSISHPSLA DMQSLC  S S G L+G++ISG LVH +G  GVF +L++P
Sbjct  162  DVVIDACVAQNSISHPSLAADMQSLCALSESTGGLLGFVISGILVHRMGPVGVFALLTIP  221

Query  942  PSLVVLVGIMIRE  980
              LV+L+G ++ E
Sbjct  222  AGLVLLLGNILDE  234



>emb|CAC09501.2| H0711G06.7 [Oryza sativa Indica Group]
Length=433

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+   +  ++  YY KD Q++QPS AQ + G +S PW+
Sbjct  38   RLSRELHWSFVLAVVAVYGACQGVGDAVGGVAAGYYWKDVQRVQPSAAQFYQGFVSAPWV  97

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagva  755
            VKP+WGLLTDV+P+AGYRRRPYF+LAG +G  +MLTL+++ +L I  A+L L A SAG A
Sbjct  98   VKPVWGLLTDVVPVAGYRRRPYFLLAGVIGASSMLTLALHRKLGIMPAILALTAQSAGAA  157

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            +ADV +DA V +NSI+H  LA DMQSLCG SSSVG L+G+ ISG LVH +GS+G  G+LS
Sbjct  158  VADVTVDALVAQNSITHQPLAADMQSLCGFSSSVGALLGFSISGLLVHSMGSQGALGLLS  217

Query  936  MPPSLVVLVGIMIRE  980
            +P +LV L G++++E
Sbjct  218  IPSALVFLAGVLLKE  232



>ref|XP_004138696.1| PREDICTED: probable folate-biopterin transporter 2 [Cucumis sativus]
 gb|KGN63001.1| hypothetical protein Csa_2G382740 [Cucumis sativus]
Length=503

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSFV  VVIVYGI+QGL   L+R+S +YYMKD QK+QPSEAQ+++GI  +PW+VKP+W
Sbjct  41   MHWSFVFGVVIVYGISQGLGGALNRVSTKYYMKDVQKVQPSEAQVYSGITYIPWMVKPIW  100

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadvi  770
            GL TD++PI GY RRPYF+ AG LGVI++L+L++++ L + LA+L L AGSA VAIADV 
Sbjct  101  GLFTDLVPILGYHRRPYFVFAGFLGVISLLSLALHEKLHLVLAILLLTAGSASVAIADVT  160

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NS  HP+LA D+QSLC  SSSVG L+G+ ISG LVHLIGS GV+G+L +P  L
Sbjct  161  IDACVAQNSNIHPTLAADLQSLCALSSSVGALLGFSISGVLVHLIGSMGVYGLLVIPGGL  220

Query  951  VVLVGIMIRE  980
            V LVGI++ E
Sbjct  221  VFLVGILLNE  230



>ref|XP_002437984.1| hypothetical protein SORBIDRAFT_10g005900 [Sorghum bicolor]
 gb|EER89351.1| hypothetical protein SORBIDRAFT_10g005900 [Sorghum bicolor]
Length=543

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VV  YGI+QGL  G++R++  YY KD Q++QPS AQ++ G+ S+PW+V
Sbjct  54   LARELHWSFVFGVVATYGISQGLGGGITRVASDYYWKDVQRVQPSVAQVYQGVTSIPWMV  113

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGLLTDVLP+AGYRRRPYFILAG +GVIAML L+++ +L    ALL LM GSA VAI
Sbjct  114  KPLWGLLTDVLPVAGYRRRPYFILAGFIGVIAMLILALHSKLHALFALLALMTGSASVAI  173

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV ENSI +P LA DM SL G  SSVG LIG+ ISGFLVH IG++G  G+L++
Sbjct  174  ADVTIDACVAENSIVYPHLAADMISLNGFCSSVGGLIGFSISGFLVHAIGAQGALGLLTI  233

Query  939  PPSLVVLVGIMIRE  980
            P +LV+L G +++E
Sbjct  234  PSALVILSGALLKE  247



>gb|EPS69234.1| hypothetical protein M569_05531, partial [Genlisea aurea]
Length=484

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VVIVYGINQGL      +S +YYMKD QK+QPSEAQ+++GI ++PWIV
Sbjct  18   LAAELHWSFVFGVVIVYGINQGLGGAFWGVSSKYYMKDVQKVQPSEAQVYSGITNIPWIV  77

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WG+ TD++PI GY+RRPYFILAG LG+I M+ LS    L I LALL + AG+A VAI
Sbjct  78   KPVWGIFTDLVPIFGYQRRPYFILAGILGIIPMIFLSQYKDLPIVLALLFMTAGNASVAI  137

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV +DACV +NS +HP LA DMQS+C  SSS+G L+G+ ISG LVH IGS+GVFG+L++
Sbjct  138  ADVTVDACVAQNSGTHPFLAADMQSMCALSSSIGSLLGFSISGILVHWIGSQGVFGLLTI  197

Query  939  P  941
            P
Sbjct  198  P  198



>ref|NP_001053217.1| Os04g0499100 [Oryza sativa Japonica Group]
 emb|CAD41506.3| OSJNBa0029H02.8 [Oryza sativa Japonica Group]
 dbj|BAF15131.1| Os04g0499100 [Oryza sativa Japonica Group]
Length=527

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+   +  ++  YY KD Q++QPS AQ + G +S PW+
Sbjct  29   RLSRELHWSFVLAVVAVYGACQGVGDAVGGVAAGYYWKDVQRVQPSAAQFYQGFVSAPWV  88

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagva  755
            VKP+WGLLTDV+P+AGYRRRPYF+LAG +G  +MLTLS++ +L I  A+L L A SAG A
Sbjct  89   VKPIWGLLTDVVPVAGYRRRPYFLLAGVIGASSMLTLSLHRKLGIMPAILALTAQSAGAA  148

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            +ADV +DA V +NSI+H  LA DMQSLCG SSSVG L+G+ ISG LVH +GS+G  G+LS
Sbjct  149  VADVTVDALVAQNSITHQPLAADMQSLCGFSSSVGALLGFSISGLLVHSMGSQGALGLLS  208

Query  936  MPPSLVVLVGIMIRE  980
            +P +LV L G++++E
Sbjct  209  IPSALVFLAGVLLKE  223



>ref|XP_006653566.1| PREDICTED: probable folate-biopterin transporter 2-like [Oryza 
brachyantha]
Length=530

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 150/195 (77%), Gaps = 1/195 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+   ++ ++  YY KD Q++QPS AQ + G +S PW+
Sbjct  37   RLSRELHWSFVLAVVAVYGACQGVGDAVNGVATGYYWKDVQRVQPSAAQFYQGFVSAPWV  96

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagva  755
            VKP+WGLLTDV+P+AGYRRRPYF+LAG +G  +MLTLS++ +L I  A+L L A SAG A
Sbjct  97   VKPVWGLLTDVVPVAGYRRRPYFLLAGVIGASSMLTLSLHRKLGIVPAILALTAQSAGAA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            +ADV +DA V +NSI+H  LA DMQSLCG SSSVG L+G+ ISG LVH +GS+G  G+LS
Sbjct  157  VADVTVDALVAQNSIAHQPLAADMQSLCGLSSSVGALLGFSISGVLVHSMGSQGALGLLS  216

Query  936  MPPSLVVLVGIMIRE  980
            +P +LV L G++++E
Sbjct  217  IPSALVFLAGVLLKE  231



>gb|EAY94725.1| hypothetical protein OsI_16503 [Oryza sativa Indica Group]
Length=536

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+   +  ++  YY KD Q++QPS AQ + G +S PW+
Sbjct  38   RLSRELHWSFVLAVVAVYGACQGVGDAVGGVAAGYYWKDVQRVQPSAAQFYQGFVSAPWV  97

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagva  755
            VKP+WGLLTDV+P+AGYRRRPYF+LAG +G  +MLTL+++ +L I  A+L L A SAG A
Sbjct  98   VKPVWGLLTDVVPVAGYRRRPYFLLAGVIGASSMLTLALHRKLGIMPAILALTAQSAGAA  157

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            +ADV +DA V +NSI+H  LA DMQSLCG SSSVG L+G+ ISG LVH +GS+G  G+LS
Sbjct  158  VADVTVDALVAQNSITHQPLAADMQSLCGFSSSVGALLGFSISGLLVHSMGSQGALGLLS  217

Query  936  MPPSLVVLVGIMIRE  980
            +P +LV L G++++E
Sbjct  218  IPSALVFLAGVLLKE  232



>ref|XP_009359095.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
 ref|XP_009359140.1| PREDICTED: probable folate-biopterin transporter 2 [Pyrus x bretschneideri]
Length=498

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 156/191 (82%), Gaps = 1/191 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFVL VV+VYG++QGL   L R+  +YYMKD QK+QPSEAQ + GI ++PW+VKPLW
Sbjct  43   LHWSFVLGVVVVYGVSQGLGGALYRVGTEYYMKDVQKVQPSEAQFYQGITNIPWLVKPLW  102

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFI+AGS+GV+AML LS + +L I LALL L  GS GVA+ADV 
Sbjct  103  GLLTDVLPIFGYRRRPYFIIAGSVGVMAMLVLSFHAKLHIALALLALTTGSGGVAVADVT  162

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NSI+HPSLA D+QSLC  SSS+G L+G+ +SG  VHL+G KGV+G+L++P  L
Sbjct  163  IDACVAQNSINHPSLAADIQSLCALSSSIGALLGFSVSGIFVHLLGPKGVYGLLAIPFGL  222

Query  951  VVLVGIMIRES  983
            V L+G +I+E+
Sbjct  223  VFLIGTLIKEA  233



>ref|XP_004964643.1| PREDICTED: probable folate-biopterin transporter 2-like [Setaria 
italica]
Length=539

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 154/194 (79%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFVL VV  YG++QGL  G++R++  YY KD Q++QPS AQ++ G+ S+PW+V
Sbjct  50   LTRELHWSFVLGVVATYGVSQGLGGGINRVASDYYWKDVQRVQPSVAQVYQGVTSIPWMV  109

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWGL TDVLP+AGYRRRPYFILAG +GVIAML +S++ +L    ALL LMAGSA VAI
Sbjct  110  KPLWGLFTDVLPVAGYRRRPYFILAGFIGVIAMLIVSLHSKLHALFALLALMAGSASVAI  169

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV ENSI +P LA DM SL G  SSVG LIG+ ISGFLVH IG++G  G+L++
Sbjct  170  ADVTIDACVAENSILYPHLAADMISLNGFCSSVGGLIGFSISGFLVHAIGAQGALGLLTL  229

Query  939  PPSLVVLVGIMIRE  980
            P +LV+L G++++E
Sbjct  230  PSALVILSGMLLKE  243



>ref|XP_004976116.1| PREDICTED: probable folate-biopterin transporter 2-like [Setaria 
italica]
Length=534

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 149/196 (76%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+   +  ++  YY KD Q++QPS AQ + G+   PW+
Sbjct  37   RLSRELHWSFVLAVVAVYGACQGVGNAVGGVAAGYYWKDVQRVQPSAAQFYQGVTDAPWV  96

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagva  755
            VKPLWGLLTDV+P+AGYRRRPYF+LAG +GV +ML LSM++ L I  ALL L A SAG A
Sbjct  97   VKPLWGLLTDVIPVAGYRRRPYFVLAGVVGVSSMLMLSMHRGLGIMSALLALTAQSAGAA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV +DA V +NSI+H +LA DMQSLCG SSS+G L+G+ ISG LVH +GS+   G+LS
Sbjct  157  IADVTVDAVVAQNSITHEALASDMQSLCGFSSSLGALLGFSISGLLVHSMGSQAALGLLS  216

Query  936  MPPSLVVLVGIMIRES  983
            +P +LV+  GI+++E+
Sbjct  217  IPSALVLSAGILLKEN  232



>ref|XP_003588878.1| hypothetical protein MTR_1g014250 [Medicago truncatula]
 gb|AES59129.1| folate/biopterin transporter [Medicago truncatula]
Length=505

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 167/230 (73%), Gaps = 2/230 (1%)
 Frame = +3

Query  297  GQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrK-LSDVLHWSFVLSVVIVYGINQGLS  473
             Q+++     Q  +ERKS        +     + K LS  +HWSFV  VV+VYGI+QGL 
Sbjct  6    NQEDSIPESKQQNEERKSKGVRIWKCFCIPSEWFKMLSREMHWSFVFGVVVVYGISQGLG  65

Query  474  LGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFIL  653
              L+ +  +YYMKD QK+QPSEAQ++ GI S+PWIVKPLWGLLTDVLPI GYRR+PYFI 
Sbjct  66   GALAGVGTKYYMKDVQKVQPSEAQVYAGITSIPWIVKPLWGLLTDVLPIFGYRRKPYFIF  125

Query  654  AGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQ  830
            AG LG  AML LS ++ L + LA+L L AGSAGVAIADV IDACV +NSISHPSLA DMQ
Sbjct  126  AGLLGATAMLLLSFHENLHLVLAILALTAGSAGVAIADVTIDACVAQNSISHPSLASDMQ  185

Query  831  SLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            SLC  SSS+G L+G+ ISG  VHLIG  GVFG++++P  L++LVG ++ E
Sbjct  186  SLCAFSSSIGALLGFSISGIFVHLIGPMGVFGLMTIPAGLMILVGFLLDE  235



>dbj|BAK01020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+      ++  YY KD Q++QP+ +Q + G++++PW+
Sbjct  45   RLSRELHWSFVLAVVAVYGACQGVGSSFGSVAAGYYWKDVQRVQPAASQFYQGVVNVPWV  104

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQL-RIELALLCLMagsagva  755
            VKPLWGL TDV+P+AGYRRRPY +LAG +GV +MLTL++ +   I  AL+     +AG A
Sbjct  105  VKPLWGLFTDVVPVAGYRRRPYLLLAGVMGVSSMLTLALRRTPAIAPALMAFTTQAAGAA  164

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV++DA V +NSISHP LA DMQSLCG SSS G L+GY ISG LVH IGS+G  G+LS
Sbjct  165  IADVVVDAMVAQNSISHPPLAADMQSLCGYSSSAGALVGYSISGLLVHAIGSQGALGLLS  224

Query  936  MPPSLVVLVGIMIRES  983
            +P  LV   GI+++E 
Sbjct  225  IPSVLVFSAGILVKED  240



>ref|XP_008377493.1| PREDICTED: probable folate-biopterin transporter 2 [Malus domestica]
Length=498

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHWSFVL VV+VYG++QGL   L R+  +YYMKD QK+QPSEAQ + G+ ++PW+VKPLW
Sbjct  43   LHWSFVLGVVVVYGVSQGLGGALYRVGTEYYMKDVQKVQPSEAQFYQGVTNIPWLVKPLW  102

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDVLPI GYRRRPYFI+AGS+GV+AML LS + +L I LALL L  GS GVA+ADV 
Sbjct  103  GLLTDVLPIFGYRRRPYFIIAGSVGVMAMLVLSFHAKLHIALALLALTTGSGGVAVADVT  162

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDACV +NSI+HPSLA D+QSLC  SSS+G L+G+ +SG  VHL+G KGV+G+L++P  L
Sbjct  163  IDACVAQNSINHPSLAADIQSLCALSSSIGALLGFSVSGIFVHLLGPKGVYGLLAIPFGL  222

Query  951  VVLVGIMIRE  980
            V L+G +I+E
Sbjct  223  VFLIGTLIKE  232



>gb|EYU22001.1| hypothetical protein MIMGU_mgv1a005007mg [Erythranthe guttata]
Length=501

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 142/181 (78%), Gaps = 1/181 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  VVIVYG++QGL   L+ +  +YYMKD QK+QPS+AQ ++GI S+PWIV
Sbjct  39   LAKELHWSFVFGVVIVYGMSQGLGGALAMVGTEYYMKDVQKVQPSDAQFYSGITSIPWIV  98

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV+P+ GY R+PYF+ AG +GV AML +S++ ++ I LALL L AGSA VAI
Sbjct  99   KPIWGLLTDVVPVFGYHRKPYFLFAGFMGVFAMLFVSIHKEVHIVLALLSLTAGSASVAI  158

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV +DACV + S  HPSLA D+QSLC  S+++G L+G+  SG  VHLIG +GVFG+L++
Sbjct  159  ADVTVDACVAQKSGIHPSLAADIQSLCALSAAIGSLVGFSFSGIFVHLIGPQGVFGLLTI  218

Query  939  P  941
            P
Sbjct  219  P  219



>ref|XP_003550212.2| PREDICTED: probable folate-biopterin transporter 2-like [Glycine 
max]
 gb|KHN46357.1| hypothetical protein glysoja_036435 [Glycine soja]
Length=498

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  +HWSFV  VV+VYGI+QGL   L+ +  +YYMKD QK+QPSEAQ++ GI S+PWIV
Sbjct  38   LSREMHWSFVFGVVVVYGISQGLGGALAEVGTKYYMKDVQKVQPSEAQVYKGITSIPWIV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLP  GYRRRPYFI AG LGVIAML LS+++ L + LALL L AGSA VAI
Sbjct  98   KPLWGLLTDVLPFFGYRRRPYFIFAGILGVIAMLLLSLHENLHLMLALLALTAGSAAVAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSIS PSLA DMQSLC  SSSVG L GY ISG  VHL+G  GVFG++++
Sbjct  158  ADVTIDACVAQNSISQPSLAADMQSLCAFSSSVGSLFGYFISGIFVHLLGPMGVFGLMTI  217

Query  939  PPSLVVLVGIMIRE  980
            P  L++ VG ++ E
Sbjct  218  PAGLIISVGFLLYE  231



>gb|EMT28403.1| hypothetical protein F775_17337 [Aegilops tauschii]
Length=527

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 143/196 (73%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+      ++  YY KD Q++QP+ +Q + G++++PW+
Sbjct  45   RLSRELHWSFVLAVVAVYGACQGVGSSFGSVAAGYYWKDVQRVQPAASQFYQGVVNVPWV  104

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQL-RIELALLCLMagsagva  755
            VKPLWGL TDV+P+AGYRRRPY +LAG +GV +MLTL++ +   I  AL+     +AG A
Sbjct  105  VKPLWGLFTDVVPVAGYRRRPYLLLAGVMGVSSMLTLALRRTPAIVPALVAFTTQAAGAA  164

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV++DA V +NSISHP LA DMQSLCG  SS G L+GY ISG +VH IGS+G  G+LS
Sbjct  165  IADVVVDAMVAQNSISHPPLAADMQSLCGYCSSAGALVGYSISGLVVHAIGSQGALGLLS  224

Query  936  MPPSLVVLVGIMIRES  983
            +P  LV   GI+++E 
Sbjct  225  IPSVLVFSAGILVKEE  240



>gb|AFK35303.1| unknown [Lotus japonicus]
Length=499

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 156/194 (80%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  +HWSFV  VV+VYGI+QG+    + +  +YYMKD QK+QPSEAQ+++GI S+PWIV
Sbjct  40   LSREMHWSFVFGVVVVYGISQGVGGAFATVGTKYYMKDVQKVQPSEAQVYSGITSIPWIV  99

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDV+PI G+RRRPYFI AG +G I+ML LS+++ L + LALL L AGSAGVAI
Sbjct  100  KPLWGLLTDVVPIFGFRRRPYFIFAGFVGAISMLLLSLHENLHLVLALLSLTAGSAGVAI  159

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSISHPSLA DMQSLC  SSSVG L+G+ ISG  VHLIG  GVFG++++
Sbjct  160  ADVTIDACVAQNSISHPSLAADMQSLCAFSSSVGALLGFSISGIFVHLIGPMGVFGLMTI  219

Query  939  PPSLVVLVGIMIRE  980
            P  LV+LVG ++ E
Sbjct  220  PAGLVILVGFLLNE  233



>gb|EMT29625.1| hypothetical protein F775_06957 [Aegilops tauschii]
Length=538

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+V  VYG  QG+   +  ++  YY KD  +LQPS AQ + GI+  PW+
Sbjct  41   RLSRELHWSFVLAVFAVYGACQGVGNAVGVVAASYYSKDVLRLQPSAAQFYQGIVDSPWV  100

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
            VKP+WGLLTDV+P+AGYRRRPYF+LAG +G  +ML +S+ + L +  A+L L A SAG A
Sbjct  101  VKPIWGLLTDVVPVAGYRRRPYFLLAGVIGATSMLMISLQSNLGLIPAVLALTAQSAGAA  160

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV +DA V +NSI+HP LA DMQSLCG  SS G LIGY ISG LVH +G++G  G+LS
Sbjct  161  IADVTLDALVAQNSITHPPLAADMQSLCGFCSSFGSLIGYSISGLLVHSMGAQGALGLLS  220

Query  936  MPPSLVVLVGIMIRES  983
            +P +LV   GI+++ES
Sbjct  221  IPSALVFSAGILLKES  236



>dbj|BAK05889.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=539

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+V  VYG  QG+   +  ++  YY KD  +LQPS AQ + GI+  PW+
Sbjct  42   RLSRELHWSFVLAVFTVYGACQGVGNTVGVVAASYYSKDVLRLQPSAAQFYQGIVDSPWV  101

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
            VKP+WGLLTDV+P+AGYRRRPYF+LAG +G  +ML +S+ + L +  A+L L A SAG A
Sbjct  102  VKPVWGLLTDVVPVAGYRRRPYFLLAGVIGATSMLIISLQSNLGLIPAVLALTAQSAGAA  161

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV +DA V +NSI+HP LA DMQSLCG  SS G LIGY ISG LVH +G++G  G+LS
Sbjct  162  IADVTLDALVAQNSITHPPLAADMQSLCGFCSSFGSLIGYSISGLLVHSMGAQGAIGLLS  221

Query  936  MPPSLVVLVGIMIRES  983
            +P +LV   GI+++ES
Sbjct  222  IPSALVFSAGILLKES  237



>ref|XP_003581391.1| PREDICTED: probable folate-biopterin transporter 2 [Brachypodium 
distachyon]
Length=533

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+V  VYG  QG+   +  ++  YY KD Q +QPS AQ + G+   PW+
Sbjct  37   RLSRELHWSFVLAVFAVYGACQGVGNAVGGVAAGYYWKDVQGVQPSAAQFYQGVTDAPWV  96

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagva  755
            VKPLWGLLTDV+PIAGYRRRPYF++AG +GV +ML LS+ + L I  A++ L A SAG A
Sbjct  97   VKPLWGLLTDVVPIAGYRRRPYFLVAGVIGVSSMLMLSLQRNLGIMPAIVALTAQSAGAA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV +DA V +NSI++P LA DMQSLCG SSS G LIG+ ISG LVH +GS+G  G+LS
Sbjct  157  IADVTVDALVAQNSITNPPLASDMQSLCGFSSSFGALIGFSISGLLVHSLGSQGALGLLS  216

Query  936  MPPSLVVLVGIMIRES  983
            +P  LV   GI+++ES
Sbjct  217  IPSVLVFSAGILLKES  232



>ref|XP_003544591.2| PREDICTED: probable folate-biopterin transporter 2-like [Glycine 
max]
 gb|KHN12483.1| hypothetical protein glysoja_045225 [Glycine soja]
Length=496

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  +HWSFV  VV+VYGI+QGL   L+ +  +YYMKD QK+QPSEAQI+ GI S+PWIV
Sbjct  37   LSREMHWSFVFGVVVVYGISQGLGGALAEVGTKYYMKDVQKVQPSEAQIYKGITSIPWIV  96

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KPLWGLLTDVLP  GYRRRPYFI AG +GVIAML LS+++ L + LALL L AGSAG AI
Sbjct  97   KPLWGLLTDVLPFFGYRRRPYFIFAGFIGVIAMLLLSLHENLHLVLALLALTAGSAGGAI  156

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV +NSIS PSLA DMQSLC  S SVG LIGY ISG  VH +G  GVFG++++
Sbjct  157  ADVTIDACVAQNSISQPSLAADMQSLCAFSLSVGSLIGYFISGIFVHFLGPMGVFGLMTI  216

Query  939  PPSLVVLVGIMIRE  980
            P  LV+ VG ++ E
Sbjct  217  PAGLVISVGFLLYE  230



>ref|XP_010532070.1| PREDICTED: probable folate-biopterin transporter 3 [Tarenaya 
hassleriana]
Length=495

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L D LHWSF L V+IVYG++QGL  GLS++S QYY+KDEQK+QPSEAQ++ G+I +PWIV
Sbjct  38   LIDELHWSFFLGVIIVYGVSQGLGHGLSKVSTQYYLKDEQKVQPSEAQVYVGVIQIPWIV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
            KP+WGL TDV+P+ GYRRRPYFI AG L +I+ML LS+++ L + LAL  L+AGSAGVA+
Sbjct  98   KPIWGLFTDVVPVLGYRRRPYFIFAGLLAMISMLVLSLHRNLDLALALSSLVAGSAGVAV  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SIS+PSLA DMQSLCG SSSVG L+G  +SG LVHL G KGV+G+LS+
Sbjct  158  ADVTIDACVTQCSISNPSLASDMQSLCGISSSVGSLVGLSLSGLLVHLFGPKGVYGLLSL  217

Query  939  PPSLVVLVGIMIRES  983
               LVV+ G+++ ES
Sbjct  218  TAGLVVMAGMLLNES  232



>ref|XP_006287981.1| hypothetical protein CARUB_v10001216mg [Capsella rubella]
 gb|EOA20879.1| hypothetical protein CARUB_v10001216mg [Capsella rubella]
Length=368

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 137/190 (72%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            LHW+F+  VV +YGINQG    L +++ +YYMKD QK+QPS+ Q    +  +PWI+KPLW
Sbjct  41   LHWTFLFGVVSIYGINQGFGNSLGKVATEYYMKDVQKVQPSQYQSLFTVTKIPWIIKPLW  100

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadvi  770
            G+LTDV+PI G  R PYFI+AG LGV++ L LS+ + L + LAL  +   S G AIADV 
Sbjct  101  GILTDVVPIYGSHRGPYFIIAGVLGVVSFLFLSVQSNLNLYLALFWMTISSTGTAIADVT  160

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NS  HPSLA DMQ+    SSS+G LIG  +SG L+HL+GSKGVFG+L+ P + 
Sbjct  161  IDACIAYNSNEHPSLAPDMQTFSNSSSSIGALIGSFMSGILLHLVGSKGVFGLLAFPFAF  220

Query  951  VVLVGIMIRE  980
            V++VGI+ ++
Sbjct  221  VIVVGILFKK  230



>ref|XP_002446742.1| hypothetical protein SORBIDRAFT_06g021580 [Sorghum bicolor]
 gb|EES11070.1| hypothetical protein SORBIDRAFT_06g021580 [Sorghum bicolor]
Length=529

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 151/196 (77%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  LHWSFVL+VV VYG  QG+   +  ++  YY KD Q++QPS AQ + G+   PWI
Sbjct  33   RLSRELHWSFVLAVVAVYGACQGVGNAIGGVAAAYYWKDVQRVQPSAAQFYQGVTDAPWI  92

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagva  755
            VKP+WGLLTDV+P+ G+RRRPYF+LAG +GV +ML LS+N +L I  ALL L+A SAG A
Sbjct  93   VKPIWGLLTDVVPVVGFRRRPYFVLAGVIGVSSMLMLSLNHELGIVPALLMLIAQSAGAA  152

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV +DA V +NSI+HP LA DMQSLCG SSSVG L+G+ +SG LVH +GS+G  G+LS
Sbjct  153  IADVTVDALVAQNSITHPPLAADMQSLCGFSSSVGALLGFSLSGLLVHSMGSQGALGLLS  212

Query  936  MPPSLVVLVGIMIRES  983
            +P +LV+L GI+++E+
Sbjct  213  IPSALVLLAGILLKEN  228



>ref|XP_008790139.1| PREDICTED: probable folate-biopterin transporter 6 isoform X2 
[Phoenix dactylifera]
Length=361

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 137/190 (72%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFV  V +VYG++QG +    R++  YY KD QK+QPS  Q+FTG+  +PW++KP+W
Sbjct  50   LNASFVFGVALVYGLSQGFAWSFLRVAADYYWKDVQKVQPSMVQMFTGLYYIPWVMKPVW  109

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvaiadvi  770
            G+LTDV+P+ GYRRRPYFILAG LGV     +S   +L I LALLCL+   A +AIADV 
Sbjct  110  GVLTDVVPVLGYRRRPYFILAGILGVATTFVVSTFGRLPIILALLCLIGMMASIAIADVT  169

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NSI  P+LA DMQSLCG  SS+G LIG+  SGF VH +G++G  G++ +PP  
Sbjct  170  IDACIARNSIERPALAPDMQSLCGFLSSLGALIGFSTSGFFVHHLGAQGALGLMVIPPVS  229

Query  951  VVLVGIMIRE  980
            ++L+G +I E
Sbjct  230  LILLGFVIFE  239



>ref|XP_007224944.1| hypothetical protein PRUPE_ppa021444mg, partial [Prunus persica]
 gb|EMJ26143.1| hypothetical protein PRUPE_ppa021444mg, partial [Prunus persica]
Length=296

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = +3

Query  420  WSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGL  599
            WSFV  VV+VYGI+QGL   LSR+  +YYMK+ QK+QPSEAQ + GII  PW+VKP+WGL
Sbjct  27   WSFVWGVVVVYGISQGLGGALSRVGTKYYMKNVQKVQPSEAQFYQGIIYFPWMVKPIWGL  86

Query  600  LTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLM-agsagvaiadvii  773
            LTDV+PI GYRR PYFI AGS+GVI+ML LS ++ L +  A+L L    +         I
Sbjct  87   LTDVVPIFGYRRHPYFISAGSMGVISMLLLSFHEKLHLAFAVLSLTGGSAGVAVADVTTI  146

Query  774  daCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSK  914
            DACV +NSI+HPSL  D+QSLC  SSS+G L+G+ I G  +HLIG K
Sbjct  147  DACVEQNSINHPSLESDVQSLCALSSSIGALVGFSIGGIFIHLIGPK  193



>ref|XP_010905038.1| PREDICTED: probable folate-biopterin transporter 6 [Elaeis guineensis]
Length=498

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 137/190 (72%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFVL V +VYG++QG +    R++  YY KD Q++QPS  Q+F G+  +PW++KP+W
Sbjct  46   LNASFVLGVALVYGLSQGFAWSFLRVAADYYWKDVQQVQPSMVQMFAGLYYIPWVMKPIW  105

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvaiadvi  770
            G+LTDV+P+ GYRRRPYFILAG LGV     LS   +L I LALLCL+   A +AIADV 
Sbjct  106  GVLTDVVPVLGYRRRPYFILAGILGVATTFVLSTFGKLPIILALLCLIGIMASIAIADVT  165

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NSI  P LA DMQSLCG  SS+G LIGY  SGF +H +G++G  G++S+PP  
Sbjct  166  IDACIATNSIERPKLAPDMQSLCGFLSSLGALIGYSTSGFFIHHLGAQGALGLMSIPPVS  225

Query  951  VVLVGIMIRE  980
            ++L+G +I E
Sbjct  226  LILLGFVIFE  235



>ref|NP_001190391.1| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
 gb|AED93393.1| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
Length=434

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 2/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWS+V +VV   GINQG    L  ++  YYMKD QK+QPS+ Q  + I  + WI+
Sbjct  37   LASKLHWSYVFAVVSNCGINQGFGYSLGHVATDYYMKDVQKVQPSQYQALSAITRISWII  96

Query  582  -KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
             KPL+G+LTDVLPI G+ RRPYFILAG +GV+++L +S+ + L + LAL  +   SA +A
Sbjct  97   FKPLFGILTDVLPIFGFHRRPYFILAGVIGVVSLLFISLQSNLHLYLALFWMTISSAAMA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV IDAC T NS  HPSLA DMQSLC  S S+G+L+G+ +SG LVHL+GSKGVFG+L+
Sbjct  157  IADVTIDACTTYNSNKHPSLASDMQSLCSLSYSIGELLGFFMSGILVHLVGSKGVFGLLT  216

Query  936  MPPSLVVLVGIMIRE  980
               +LV +VG++  E
Sbjct  217  FTFALVSVVGVLFSE  231



>dbj|BAD44281.1| putative membrane protein [Arabidopsis thaliana]
Length=434

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 2/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWS+V +VV   GINQG    L  ++  YYMKD QK+QPS+ Q  + I  + WI+
Sbjct  37   LASKLHWSYVFAVVSNCGINQGFGYSLGHVATDYYMKDVQKVQPSQYQALSAITRISWII  96

Query  582  -KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
             KPL+G+LTDVLPI G+ RRPYFILAG +GV+++L +S+ + L + LAL  +   SA +A
Sbjct  97   FKPLFGILTDVLPIFGFHRRPYFILAGVIGVVSLLFISLQSNLHLYLALFWMTISSAAMA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV IDAC T NS  HPSLA DMQSLC  S S+G+L+G+ +SG LVHL+GSKGVFG+L+
Sbjct  157  IADVTIDACTTYNSNKHPSLASDMQSLCSLSYSIGELLGFFMSGILVHLVGSKGVFGLLT  216

Query  936  MPPSLVVLVGIMIRE  980
               +LV +VG++  E
Sbjct  217  FTFALVSVVGVLFSE  231



>ref|NP_197886.3| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
 gb|AED93391.1| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
Length=457

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 2/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWS+V +VV   GINQG    L  ++  YYMKD QK+QPS+ Q  + I  + WI+
Sbjct  37   LASKLHWSYVFAVVSNCGINQGFGYSLGHVATDYYMKDVQKVQPSQYQALSAITRISWII  96

Query  582  -KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
             KPL+G+LTDVLPI G+ RRPYFILAG +GV+++L +S+ + L + LAL  +   SA +A
Sbjct  97   FKPLFGILTDVLPIFGFHRRPYFILAGVIGVVSLLFISLQSNLHLYLALFWMTISSAAMA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV IDAC T NS  HPSLA DMQSLC  S S+G+L+G+ +SG LVHL+GSKGVFG+L+
Sbjct  157  IADVTIDACTTYNSNKHPSLASDMQSLCSLSYSIGELLGFFMSGILVHLVGSKGVFGLLT  216

Query  936  MPPSLVVLVGIMIRE  980
               +LV +VG++  E
Sbjct  217  FTFALVSVVGVLFSE  231



>ref|XP_010265723.1| PREDICTED: probable folate-biopterin transporter 6 [Nelumbo nucifera]
Length=518

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 139/190 (73%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFV  V +VYG +QG S    R+   YY KD QK+QPS  Q++ G+  +PW++KP+W
Sbjct  61   LNTSFVFGVFLVYGFSQGFSWSFFRVVSDYYWKDVQKVQPSAVQLYIGLYYIPWVMKPIW  120

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDV P+ GYRRRPYFILAG +GV++ LT+S +  L   +AL+CL+  +AGVAIA+V 
Sbjct  121  GLLTDVFPVRGYRRRPYFILAGVVGVVSALTISFHGNLSALVALVCLIGITAGVAIANVT  180

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NSI  PSLA D+QSLCG  +SVG LIGY  SG  VH +G++G  G+L++P +L
Sbjct  181  IDACIARNSIEMPSLAPDLQSLCGFCTSVGALIGYSTSGMFVHQLGAQGSLGLLAIPSAL  240

Query  951  VVLVGIMIRE  980
            +VL+G +I E
Sbjct  241  LVLLGFVIYE  250



>sp|F4KIL8.2|FBT5_ARATH RecName: Full=Probable folate-biopterin transporter 5 [Arabidopsis 
thaliana]
Length=492

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 2/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWS+V +VV   GINQG    L  ++  YYMKD QK+QPS+ Q  + I  + WI+
Sbjct  37   LASKLHWSYVFAVVSNCGINQGFGYSLGHVATDYYMKDVQKVQPSQYQALSAITRISWII  96

Query  582  -KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
             KPL+G+LTDVLPI G+ RRPYFILAG +GV+++L +S+ + L + LAL  +   SA +A
Sbjct  97   FKPLFGILTDVLPIFGFHRRPYFILAGVIGVVSLLFISLQSNLHLYLALFWMTISSAAMA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV IDAC T NS  HPSLA DMQSLC  S S+G+L+G+ +SG LVHL+GSKGVFG+L+
Sbjct  157  IADVTIDACTTYNSNKHPSLASDMQSLCSLSYSIGELLGFFMSGILVHLVGSKGVFGLLT  216

Query  936  MPPSLVVLVGIMIRE  980
               +LV +VG++  E
Sbjct  217  FTFALVSVVGVLFSE  231



>ref|XP_008790138.1| PREDICTED: probable folate-biopterin transporter 6 isoform X1 
[Phoenix dactylifera]
Length=502

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 137/190 (72%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFV  V +VYG++QG +    R++  YY KD QK+QPS  Q+FTG+  +PW++KP+W
Sbjct  50   LNASFVFGVALVYGLSQGFAWSFLRVAADYYWKDVQKVQPSMVQMFTGLYYIPWVMKPVW  109

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvaiadvi  770
            G+LTDV+P+ GYRRRPYFILAG LGV     +S   +L I LALLCL+   A +AIADV 
Sbjct  110  GVLTDVVPVLGYRRRPYFILAGILGVATTFVVSTFGRLPIILALLCLIGMMASIAIADVT  169

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NSI  P+LA DMQSLCG  SS+G LIG+  SGF VH +G++G  G++ +PP  
Sbjct  170  IDACIARNSIERPALAPDMQSLCGFLSSLGALIGFSTSGFFVHHLGAQGALGLMVIPPVS  229

Query  951  VVLVGIMIRE  980
            ++L+G +I E
Sbjct  230  LILLGFVIFE  239



>gb|KCW80541.1| hypothetical protein EUGRSUZ_C01893 [Eucalyptus grandis]
Length=465

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 129/193 (67%), Gaps = 35/193 (18%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  +HWSFVL VVIVYGI+QG+   L+ ++ +YYMKD QK+QPSE+Q+++GII +PW+V
Sbjct  42   LAAEMHWSFVLGVVIVYGISQGVGNALTDVATKYYMKDVQKVQPSESQVYSGIIYIPWVV  101

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaia  761
            KP+WG+LTDVLP+AGYRRRPY +LA  +                                
Sbjct  102  KPIWGILTDVLPVAGYRRRPYLVLADVV--------------------------------  129

Query  762  dviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMP  941
               IDACV +NSISHPSLA DMQSLC  S S G L+G++ISG LVH +G  GVF +L++P
Sbjct  130  ---IDACVAQNSISHPSLAADMQSLCALSESTGGLLGFVISGILVHRMGPVGVFALLTIP  186

Query  942  PSLVVLVGIMIRE  980
              LV+L+G ++ E
Sbjct  187  AGLVLLLGNILDE  199



>ref|NP_001190390.1| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
 gb|AED93392.1| probable folate-biopterin transporter 5 [Arabidopsis thaliana]
Length=517

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 141/195 (72%), Gaps = 2/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWS+V +VV   GINQG    L  ++  YYMKD QK+QPS+ Q  + I  + WI+
Sbjct  37   LASKLHWSYVFAVVSNCGINQGFGYSLGHVATDYYMKDVQKVQPSQYQALSAITRISWII  96

Query  582  -KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
             KPL+G+LTDVLPI G+ RRPYFILAG +GV+++L +S+ + L + LAL  +   SA +A
Sbjct  97   FKPLFGILTDVLPIFGFHRRPYFILAGVIGVVSLLFISLQSNLHLYLALFWMTISSAAMA  156

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV IDAC T NS  HPSLA DMQSLC  S S+G+L+G+ +SG LVHL+GSKGVFG+L+
Sbjct  157  IADVTIDACTTYNSNKHPSLASDMQSLCSLSYSIGELLGFFMSGILVHLVGSKGVFGLLT  216

Query  936  MPPSLVVLVGIMIRE  980
               +LV +VG++  E
Sbjct  217  FTFALVSVVGVLFSE  231



>ref|XP_006495335.1| PREDICTED: probable folate-biopterin transporter 6-like, partial 
[Citrus sinensis]
Length=351

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 137/195 (70%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LH SF+  +V+VYG+ QG S    ++   YY KD QK+QPS  QI+ G+  LPW++
Sbjct  33   LSSQLHSSFIFGIVLVYGLCQGFSGSFFKVVTDYYWKDVQKVQPSTVQIYIGLYYLPWVM  92

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WG+ TD  PI GY RRPYF++AG LG+++ L ++ + +L I LAL CL+  + G+AI
Sbjct  93   KPIWGIFTDAFPIKGYHRRPYFVIAGVLGLVSALIVALLGKLPIALALTCLIGITGGMAI  152

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI   +LA DMQSLC   S  G LIGY  SGF +H +G +G  GIL++
Sbjct  153  ADVVIDACIARNSIETRALAPDMQSLCAFCSGAGSLIGYSSSGFFIHHLGHQGALGILAI  212

Query  939  PPSLVVLVGIMIRES  983
            PP+L++++G +I E+
Sbjct  213  PPTLLIVLGFVIYET  227



>ref|XP_011081396.1| PREDICTED: probable folate-biopterin transporter 6 [Sesamum indicum]
Length=522

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 141/194 (73%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL V++VYG+NQG S    ++   YY KD QKLQPS  Q+F G+  +PW++
Sbjct  61   LSSRLNPTFVLGVMLVYGLNQGFSGSFFKVVSDYYWKDVQKLQPSAVQLFVGLYYIPWVM  120

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF++AG +G ++ L+++   QL + LAL CL+  +AGVAI
Sbjct  121  KPIWGLLTDVFPVKGYRRRPYFVMAGIVGAVSALSVAAGGQLPVVLALTCLIGVTAGVAI  180

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA DMQSLCG  SS G L+GY  SGF VH +G++   GIL++
Sbjct  181  ADVTIDACIARNSIEIRSLAADMQSLCGFCSSAGALLGYSSSGFFVHHLGAQVALGILAI  240

Query  939  PPSLVVLVGIMIRE  980
            PP+ ++++G +I E
Sbjct  241  PPATLIVLGFVIYE  254



>ref|XP_010048290.1| PREDICTED: probable folate-biopterin transporter 2 [Eucalyptus 
grandis]
 gb|KCW80539.1| hypothetical protein EUGRSUZ_C01892 [Eucalyptus grandis]
Length=506

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  +HWSFVL VV+VYG++QGL   LSR++ +YYMKD Q++QPSEAQI++ I+++PW++
Sbjct  45   LSAEMHWSFVLGVVLVYGVSQGLGGALSRVATEYYMKDVQEVQPSEAQIYSAIVNVPWLI  104

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaia  761
            KP+WGLLTDV+P+ GYRRRPYF+ AG L V +ML LS  ++ + LAL+ L AGS GVAIA
Sbjct  105  KPIWGLLTDVVPVGGYRRRPYFVCAGLLSVFSMLMLSFYKVHLVLALVLLTAGSTGVAIA  164

Query  762  dviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMP  941
            DV IDACV +NSISHP LA DMQSLC  S+S+G L+G+ +SG LVHLIG  GV+G+L++P
Sbjct  165  DVTIDACVAQNSISHPYLAADMQSLCALSASIGALVGFTLSGILVHLIGPMGVYGLLTVP  224



>ref|XP_010048832.1| PREDICTED: probable folate-biopterin transporter 6 [Eucalyptus 
grandis]
 gb|KCW81227.1| hypothetical protein EUGRSUZ_C02600 [Eucalyptus grandis]
Length=527

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LSD L+ +FVL V +VYG+NQG +    ++   YY KD Q++QPS  Q++ G   +PWI+
Sbjct  55   LSDNLNPTFVLGVFVVYGLNQGFAGSFFKVVSDYYWKDVQRVQPSAVQLYIGFYYIPWIM  114

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvai  758
            KPLWGLLTDV P+ GYRRRPYF+ +G LGV  AM   +  +L + LAL  L   +A +AI
Sbjct  115  KPLWGLLTDVFPVMGYRRRPYFVASGVLGVASAMAVAAGGKLLVPLALTFLTGLTASLAI  174

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACV  NSI   +LA DMQSLCG  SS G LIGY  SGF VH IG++G  G+L++
Sbjct  175  ADVTIDACVAHNSIMMAALAPDMQSLCGLCSSAGALIGYSTSGFFVHHIGAQGALGVLAI  234

Query  939  PPSLVVLVGIMIRE  980
            PP+L++++G +I E
Sbjct  235  PPALLIVLGFVIHE  248



>ref|XP_006450267.1| hypothetical protein CICLE_v10008109mg [Citrus clementina]
 gb|ESR63507.1| hypothetical protein CICLE_v10008109mg [Citrus clementina]
 gb|KDO67413.1| hypothetical protein CISIN_1g044122mg [Citrus sinensis]
Length=492

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 137/195 (70%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LH SF+  +V+VYG+ QG S    ++   YY KD QK+QPS  QI+ G+  LPW++
Sbjct  33   LSSQLHSSFIFGIVLVYGLCQGFSGSFFKVVTDYYWKDVQKVQPSTVQIYIGLYYLPWVM  92

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WG+ TD  PI GY RRPYF++AG LG+++ L ++ + +L I LAL CL+  + G+AI
Sbjct  93   KPIWGIFTDAFPIKGYHRRPYFVIAGVLGLVSALIVALLGKLPIALALTCLIGITGGMAI  152

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI   +LA DMQSLC   S  G LIGY  SGF VH +G +G  GIL++
Sbjct  153  ADVVIDACIARNSIETRALAPDMQSLCAFCSGAGSLIGYSSSGFFVHHLGHQGALGILAI  212

Query  939  PPSLVVLVGIMIRES  983
            PP+L++++G +I E+
Sbjct  213  PPTLLIVLGFVIYET  227



>ref|XP_006483535.1| PREDICTED: probable folate-biopterin transporter 6-like [Citrus 
sinensis]
Length=492

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 137/195 (70%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LH SF+  +V+VYG+ QG S    ++   YY KD QK+QPS  QI+ G+  LPW++
Sbjct  33   LSSQLHSSFIFGIVLVYGLCQGFSGSFFKVVTDYYWKDVQKVQPSTVQIYIGLYYLPWVM  92

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WG+ TD  PI GY RRPYF++AG LG+++ L ++ + +L I LAL CL+  + G+AI
Sbjct  93   KPIWGIFTDAFPIKGYHRRPYFVIAGVLGLVSALIVALLGKLPIALALTCLIGITGGMAI  152

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI   +LA DMQSLC   S  G LIGY  SGF +H +G +G  GIL++
Sbjct  153  ADVVIDACIARNSIETRALAPDMQSLCAFCSGAGSLIGYSSSGFFIHHLGHQGALGILAI  212

Query  939  PPSLVVLVGIMIRES  983
            PP+L++++G +I E+
Sbjct  213  PPTLLIVLGFVIYET  227



>gb|EMT16404.1| hypothetical protein F775_14916 [Aegilops tauschii]
Length=268

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 136/186 (73%), Gaps = 1/186 (1%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +L+V  VYG  QG+   +  ++  YY KD  +LQPS AQ++ GI+  PW+VKP+WGLL D
Sbjct  6    MLAVFAVYGACQGVGSAIGVVAASYYSKDVLRLQPSAAQLYQGIVDSPWVVKPIWGLLAD  65

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviidaCV  785
            V+P+AGYRRRPYF+LAG +G  +ML +S+ + L +  A+L L A SAG AIADV +DA V
Sbjct  66   VVPVAGYRRRPYFLLAGVIGATSMLMVSVQSNLGLIPAVLALTAQSAGAAIADVTLDALV  125

Query  786  TENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
             +NSI+HPSLA DMQSLCG  SS G LIG+ +SG LVH +G++   G+LS+P +LV   G
Sbjct  126  AQNSITHPSLAADMQSLCGFCSSFGSLIGFSMSGLLVHSMGAQVAIGLLSIPSALVFSAG  185

Query  966  IMIRES  983
            I+++ES
Sbjct  186  ILLKES  191



>ref|XP_008220654.1| PREDICTED: probable folate-biopterin transporter 6 [Prunus mume]
Length=510

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV VYG++QG S    R+   +Y KD QK+QPS  Q++ G+  +PWI+
Sbjct  50   LSSELNPTFVLGVVTVYGLSQGFSGSYFRVVADFYWKDVQKVQPSVVQLYIGLYYIPWIM  109

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF+LAG  G+I+ L +++ + L   +AL CL+   A VAI
Sbjct  110  KPIWGLLTDVFPVQGYRRRPYFVLAGLTGIISALMVALSDSLAAAVALTCLIGVMASVAI  169

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G++G  G+L++
Sbjct  170  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGAQGALGLLAI  229

Query  939  PPSLVVLVGIMIRES  983
            PP  + ++G +I E 
Sbjct  230  PPVFLTVLGFVIYEE  244



>emb|CBI25262.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = +3

Query  558  IISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLM  734
            +I LPW++KPLWGLLTD+LPI GYRRRPYFI AG LGVI+ML+L++++ + + LALL LM
Sbjct  1    MIQLPWVIKPLWGLLTDILPIIGYRRRPYFIFAGFLGVISMLSLALHKKMHLVLALLSLM  60

Query  735  agsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSK  914
             GSAGVAIADV IDACV +NSISHPSLAGDMQSLCG SSS+G L+GY +SGFLVH +G K
Sbjct  61   TGSAGVAIADVTIDACVAQNSISHPSLAGDMQSLCGLSSSIGALVGYSLSGFLVHFVGPK  120

Query  915  GVFGILSMPPSLVVLVGIMIRE  980
            GVFG+LS+P  LV+LVG+ +RE
Sbjct  121  GVFGVLSVPAGLVILVGMFLRE  142



>ref|XP_010104519.1| hypothetical protein L484_025493 [Morus notabilis]
 gb|EXC01120.1| hypothetical protein L484_025493 [Morus notabilis]
Length=509

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L  +FV  VV+VYG+NQG S    ++   YY KD QK+QPS  Q+++G+ ++PW++
Sbjct  48   LSSQLSPTFVAGVVLVYGLNQGFSGSFFKVVSDYYWKDVQKVQPSAVQLYSGLYTIPWVM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ G+RRRPYF+LAG +G ++ + ++++  +    A+ CLM  SA VAI
Sbjct  108  KPIWGLLTDVFPVRGFRRRPYFVLAGVVGALSAVAVALDGGMSAAAAVGCLMGLSAAVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   +LA D+QSLCG  SSVG L+GY  SGF VH +G +G  G+L++
Sbjct  168  ADVTIDACIARNSIEIRALASDLQSLCGFCSSVGALLGYSSSGFFVHHLGPQGALGLLAV  227

Query  939  PPSLVVLVGIMIRE  980
            PP+L+V++G  I E
Sbjct  228  PPALLVVLGFFIYE  241



>gb|EMS50413.1| hypothetical protein TRIUR3_11905 [Triticum urartu]
Length=466

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 130/186 (70%), Gaps = 0/186 (0%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  VV+VYG+NQG +    R++  YY KD Q++QP+  Q  +    +PW++KPLWG++
Sbjct  9    TFVAGVVLVYGLNQGFAGSFFRVASDYYWKDVQRVQPATVQFLSIFFHVPWVLKPLWGVM  68

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaC  782
            TDVLP+ GYRRRPYF+ +G LG+ +   L+   L +  A++C +  S  VAIADV IDAC
Sbjct  69   TDVLPVQGYRRRPYFVFSGMLGMFSTAILAGVGLSVTSAVVCFVGISTAVAIADVTIDAC  128

Query  783  VTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLV  962
            + +NSI  P+LA DMQSLC  SSS+G LIGY  SG  VH +G++G  G++++PP+++V +
Sbjct  129  IAKNSIDKPALAPDMQSLCAFSSSLGALIGYATSGMFVHHLGAQGALGVMALPPTMLVFL  188

Query  963  GIMIRE  980
            G  I E
Sbjct  189  GFYIYE  194



>ref|XP_008347488.1| PREDICTED: probable folate-biopterin transporter 6 isoform X1 
[Malus domestica]
Length=321

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q++ G+  +PW++
Sbjct  48   LSSELNPTFVLGVVLVYGLSQGFSGSYFKVVTDYYWKDVQKLQPSVVQLYIGLYYIPWLM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF+LAG +G ++ LT++ +  L   +AL  L+  +AGVAI
Sbjct  108  KPVWGLLTDVFPVRGYRRRPYFVLAGVIGTVSALTVAFSGNLAAVVALTWLIGVTAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G +G   +L++
Sbjct  168  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGPQGALILLAI  227

Query  939  PPSLVVLVGIMIRE  980
            PP  + ++G +I E
Sbjct  228  PPIFLTVLGFVIYE  241



>ref|XP_007223112.1| hypothetical protein PRUPE_ppa005422mg [Prunus persica]
 gb|EMJ24311.1| hypothetical protein PRUPE_ppa005422mg [Prunus persica]
Length=462

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L  +FVL VVIVYG++QG S    R+   +Y KD +K+QPS  Q++ G+  +PW++
Sbjct  2    LSSELDPTFVLGVVIVYGLSQGFSGSYFRVVADFYWKDVRKVQPSVVQLYIGLYYIPWVM  61

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WG+LTDV P+ GYRRRPYF+LAG  G+I+ L +++ + L   +AL CL+   A VAI
Sbjct  62   KPIWGILTDVFPVQGYRRRPYFVLAGLTGIISALMVALSDSLAAAVALTCLIGVMASVAI  121

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI    LA D+QSLCG  SS G L+GY  SGF VH +G++G  G+L++
Sbjct  122  ADVTIDACIARNSIEIRWLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGAQGALGLLAI  181

Query  939  PPSLVVLVGIMIRE  980
            PP  + ++G +I E
Sbjct  182  PPVFLTVLGFVIYE  195



>ref|XP_008377627.1| PREDICTED: probable folate-biopterin transporter 6 isoform X3 
[Malus domestica]
Length=509

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q++ G+  +PW++
Sbjct  48   LSSELNPTFVLGVVLVYGLSQGFSGSYFKVVTDYYWKDVQKLQPSVVQLYIGLYYIPWLM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF+LAG +G ++ LT++ +  L   +AL  L+  +AGVAI
Sbjct  108  KPVWGLLTDVFPVRGYRRRPYFVLAGVIGTVSALTVAFSGNLAAVVALTWLIGVTAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G +G  G+L++
Sbjct  168  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGPQGALGLLAI  227

Query  939  PPSLVVLVGIMIRE  980
            PP  + ++G +I E
Sbjct  228  PPIFLTVLGFVIYE  241



>gb|EAZ31237.1| hypothetical protein OsJ_15337 [Oryza sativa Japonica Group]
Length=561

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  489  ISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLG  668
            ++  YY KD Q++QPS AQ + G +S PW+VKP+WGLLTDV+P+AGYRRRPYF+LAG +G
Sbjct  93   VAAGYYWKDVQRVQPSAAQFYQGFVSAPWVVKPIWGLLTDVVPVAGYRRRPYFLLAGVIG  152

Query  669  VIAMLTLSMN-QLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGG  845
              +MLTLS++ +L I  A+L L A SAG A+ADV +DA V +NSI+H  LA DMQSLCG 
Sbjct  153  ASSMLTLSLHRKLGIMPAILALTAQSAGAAVADVTVDALVAQNSITHQPLAADMQSLCGF  212

Query  846  SSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            SSSVG L+G+ ISG LVH +GS+G  G+LS+P +LV L G++++E
Sbjct  213  SSSVGALLGFSISGLLVHSMGSQGALGLLSIPSALVFLAGVLLKE  257



>ref|XP_010670827.1| PREDICTED: probable folate-biopterin transporter 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670828.1| PREDICTED: probable folate-biopterin transporter 2 [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L+  LHWSFV  V+IVYG +QGL   L+R+ ++YYMKD QK+QPSEAQI+ G  S+PW+V
Sbjct  38   LAKELHWSFVFGVMIVYGFSQGLGGALNRVGMEYYMKDVQKVQPSEAQIYQGFTSIPWMV  97

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP++GL+TDV+PI GY RRPYFI AG LG++ ML LS + ++ I   +L L  GS G AI
Sbjct  98   KPIYGLMTDVVPILGYHRRPYFIFAGVLGIVPMLFLSFHKKMHIFFVVLSLATGSTGAAI  157

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV +DACV ++S  H  LA DMQSLC  SSS G L+G+ +SG LVH IG KGVFG+L++
Sbjct  158  ADVTVDACVAQHSNKHQHLAPDMQSLCSLSSSTGSLLGFFLSGLLVHFIGPKGVFGLLTI  217

Query  939  PPSLVVLVGIMIRE  980
            P +LV LVGI++ E
Sbjct  218  PSALVFLVGIILHE  231



>gb|KJB55110.1| hypothetical protein B456_009G063700 [Gossypium raimondii]
Length=519

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F++ +VIVYG+N G S    ++   YY KD QK+QPS  Q++ G+  +PWI+
Sbjct  55   LSSQLNPTFIIGIVIVYGLNLGFSGSFFKVVTDYYWKDVQKVQPSVVQLYIGLYYIPWIM  114

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WGLLTDV PI GYRRRPYF+LAG LG ++ L +++   L   LAL C +  +AG+AI
Sbjct  115  KPVWGLLTDVFPIRGYRRRPYFVLAGVLGGVSALMVALIGNLPAALALSCFIGIAAGMAI  174

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA DMQSLCG  SS G LIGY  SGF VH +G++G   ++S+
Sbjct  175  ADVTIDACIATNSIEVRSLAPDMQSLCGFCSSAGALIGYSTSGFFVHHLGAQGALILMSI  234

Query  939  PPSLVVLVGIMIRE  980
            PP  + ++G +I E
Sbjct  235  PPVFITVLGFVIYE  248



>ref|XP_011649848.1| PREDICTED: probable folate-biopterin transporter 6 [Cucumis sativus]
Length=473

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LH SF+  V+++YG++ G S    ++   YY KD QKLQPS  QI+ GI ++PW++
Sbjct  11   LSTELHPSFIAGVILIYGLSHGFSGSYFKVVSDYYWKDVQKLQPSVVQIYIGIYTIPWVM  70

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTD  P+ GY RRPYF+++G +G  A + +++   L +  AL  L+  S  +AI
Sbjct  71   KPIWGLLTDAFPVRGYLRRPYFVISGVVGATAAVGMAVKGGLGVLEALGLLIGISGAMAI  130

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI    LA D+QSLCG  SS+G LIGY  SGF VHL+G++   GIL++
Sbjct  131  ADVTIDACIVRNSIEVQWLAQDLQSLCGACSSIGHLIGYSTSGFFVHLLGAQEALGILAI  190

Query  939  PPSLVVLVGIMIRES  983
            PP+LVVL+G  I E+
Sbjct  191  PPALVVLLGFFIHET  205



>gb|EEE69726.1| hypothetical protein OsJ_29410 [Oryza sativa Japonica Group]
Length=389

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  VV+VYG++QG +    R++  YY KD Q++QP+  Q+ + +  +PW++KPLWG++
Sbjct  40   TFVAGVVLVYGLSQGFAGSFFRVASDYYWKDVQRVQPATVQLLSAVFFIPWVLKPLWGIM  99

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviida  779
            TDV P+ GYRRRPYF+ AG LG  +   ++M N L +  A+L  +  S  VAIADV IDA
Sbjct  100  TDVFPVRGYRRRPYFLFAGVLGTASAAIVTMVNGLPMTSAILSFVGISTAVAIADVTIDA  159

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+ +N I  PSL  DMQSLC  SSS+G LIGY  SG  VH +G++G  G++++PP+ +V 
Sbjct  160  CIAKNGIDKPSLVPDMQSLCAFSSSLGALIGYATSGMFVHHLGAQGALGVMALPPATLVF  219

Query  960  VGIMIRE  980
            +G  I E
Sbjct  220  LGFFIYE  226



>ref|XP_011031432.1| PREDICTED: probable folate-biopterin transporter 6 isoform X2 
[Populus euphratica]
Length=515

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  VV+VYG +QGLS    ++   YY KD QK+QPS  Q++ G+  +PW++
Sbjct  48   LSSQLNPTFIFGVVVVYGFSQGLSGSFFKVVTDYYWKDVQKVQPSAVQLYMGLYYIPWVM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WGL TDV P+ GY+RRPYFI+AG LG  + L ++ + ++ I +AL CL+  +AGVAI
Sbjct  108  KPIWGLFTDVFPVRGYKRRPYFIVAGVLGCASALMIALLGKVPIAVALSCLIGITAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+ +NSI   +LA DMQSLCG  SS+G LIGY  SGF VH +G +    +L++
Sbjct  168  ADVTIDACIAKNSIEIRALAPDMQSLCGFCSSLGALIGYSSSGFFVHHLGPQAALVLLAV  227

Query  939  PPSLVVLVGIMIRE  980
            PP+L++++G +I E
Sbjct  228  PPALLIVLGFVIYE  241



>ref|XP_007011697.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY29316.1| Major facilitator superfamily protein [Theobroma cacao]
Length=503

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 134/194 (69%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  +V+VYG++QG S    ++   YY KD QK+QPS  Q++ G+  +PWI+
Sbjct  44   LSSQLNPTFIFGIVLVYGLSQGFSSSFFKVVTDYYWKDVQKVQPSVVQLYIGLYYIPWIM  103

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WGL TDV PI GYRRRPYF+LAG +G  + L +++   L   LAL CL+  +AG+AI
Sbjct  104  KPVWGLFTDVFPIKGYRRRPYFVLAGVVGGASALMVALFGNLPAALALGCLIGVAAGMAI  163

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA DMQSLCG  SS G LIGY  SGF VH +G++G   +L++
Sbjct  164  ADVTIDACIARNSIKVRSLAPDMQSLCGFCSSAGALIGYSTSGFFVHHLGAQGALILLAI  223

Query  939  PPSLVVLVGIMIRE  980
            PP  + ++G +I E
Sbjct  224  PPVFITVLGFVIYE  237



>gb|KGN62998.1| hypothetical protein Csa_2G382710 [Cucumis sativus]
Length=545

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LH SF+  V+++YG++ G S    ++   YY KD QKLQPS  QI+ GI ++PW++
Sbjct  83   LSTELHPSFIAGVILIYGLSHGFSGSYFKVVSDYYWKDVQKLQPSVVQIYIGIYTIPWVM  142

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTD  P+ GY RRPYF+++G +G  A + +++   L +  AL  L+  S  +AI
Sbjct  143  KPIWGLLTDAFPVRGYLRRPYFVISGVVGATAAVGMAVKGGLGVLEALGLLIGISGAMAI  202

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI    LA D+QSLCG  SS+G LIGY  SGF VHL+G++   GIL++
Sbjct  203  ADVTIDACIVRNSIEVQWLAQDLQSLCGACSSIGHLIGYSTSGFFVHLLGAQEALGILAI  262

Query  939  PPSLVVLVGIMIRES  983
            PP+LVVL+G  I E+
Sbjct  263  PPALVVLLGFFIHET  277



>ref|XP_010670825.1| PREDICTED: probable folate-biopterin transporter 6 [Beta vulgaris 
subsp. vulgaris]
Length=495

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            S++LS+++VYG+N G S    R+   YY KD Q++ PS AQ + G   +PWI++PLWGLL
Sbjct  45   SYILSIILVYGLNLGFSDSYFRVVTDYYWKDVQRINPSSAQFYVGFYYIPWILRPLWGLL  104

Query  603  TDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvaiadviida  779
            TDV PI GY RRPYFI+AG +GV+ A++  + +     LAL+CL+  + G+AI  V IDA
Sbjct  105  TDVFPIMGYHRRPYFIIAGVIGVLSAVIVTTFSNSPTSLALVCLIGVAVGMAITTVNIDA  164

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C  +NSI    LA D+QSLCG   S G L+GY  SGFL+HL+G++G  G+L++ P   ++
Sbjct  165  CTAKNSIEVKELAADLQSLCGFCHSAGNLLGYSTSGFLLHLLGAQGALGLLTIAPVSFIV  224

Query  960  VGIMIRE  980
            +G +I E
Sbjct  225  LGFLIYE  231



>ref|XP_009359177.1| PREDICTED: probable folate-biopterin transporter 6 [Pyrus x bretschneideri]
Length=509

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q++ G+  +PW++
Sbjct  48   LSSELNPTFVLGVVLVYGLSQGFSGSYFKVVTDYYWKDVQKLQPSVVQLYIGLYYIPWLM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF+LAG +G ++ LT++ +  L   +AL  L+  +AGVAI
Sbjct  108  KPVWGLLTDVFPVGGYRRRPYFVLAGVIGTVSALTVAFSGNLAAVVALTWLIGVTAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G +G   +L++
Sbjct  168  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGPQGALCLLAI  227

Query  939  PPSLVVLVGIMIRE  980
            PP  + ++G ++ E
Sbjct  228  PPIFLTVLGFVMYE  241



>gb|EMS49312.1| hypothetical protein TRIUR3_08956 [Triticum urartu]
Length=457

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 1/176 (1%)
 Frame = +3

Query  459  NQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRR  638
             +G+      ++  YY KD Q++QP+ +Q + G++++PW+VKPLWGL TDV+P+AGYRRR
Sbjct  32   QKGVGSSFGSVAAGYYWKDVQRVQPAASQFYQGVVNVPWVVKPLWGLFTDVVPVAGYRRR  91

Query  639  PYFILAGSLGVIAMLTLSMNQL-RIELALLCLMagsagvaiadviidaCVTENSISHPSL  815
            PY +LAG +GV +MLTL++ +   I  AL+     +AG AIADV++DA V +NSISHP L
Sbjct  92   PYLLLAGVMGVSSMLTLALRRTPAIAPALVAFTTQAAGAAIADVVVDAMVAQNSISHPPL  151

Query  816  AGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            A DMQSLCG  SS G L+GY ISG +VH IGS+G  G+LS+P  LV   GI+++E 
Sbjct  152  AADMQSLCGYCSSAGALVGYSISGLVVHAIGSQGALGLLSIPSVLVFSAGILVKED  207



>ref|XP_010273712.1| PREDICTED: probable folate-biopterin transporter 6 [Nelumbo nucifera]
Length=517

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 141/190 (74%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFVL VV+VYG++QG S    R+   YY KD QK+QPS  Q++ G+  +PW++KP+W
Sbjct  60   LNTSFVLGVVLVYGLSQGFSGSFFRVVSDYYWKDVQKVQPSAVQLYYGLYYIPWVMKPIW  119

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadvi  770
            GLLTDV P+ GYRRRPYFILAG+LG +  L ++++ +L I +AL CL+  +A VAIADV 
Sbjct  120  GLLTDVFPVRGYRRRPYFILAGALGAVPALVIAVHAKLSIVMALGCLIGIAASVAIADVT  179

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NSI  P+LA DMQSLCG   S G L+GY  SGF VH +G++G  G+L++PP+L
Sbjct  180  IDACIARNSIEIPALAPDMQSLCGFCMSAGALVGYSTSGFFVHHLGAQGSLGLLALPPAL  239

Query  951  VVLVGIMIRE  980
            +V++G +I E
Sbjct  240  LVVLGFVIYE  249



>ref|XP_009359104.1| PREDICTED: probable folate-biopterin transporter 6 [Pyrus x bretschneideri]
Length=509

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q++ G+  +PW++
Sbjct  48   LSSELNPTFVLGVVLVYGLSQGFSGSYFKVVTDYYWKDVQKLQPSVVQLYIGLYYIPWLM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF++AG +G ++ LT++ +  L   +AL  L+  +AGVAI
Sbjct  108  KPVWGLLTDVFPVRGYRRRPYFVVAGVIGTVSALTVAFSGNLAAVVALTWLIGVTAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G +G   +L++
Sbjct  168  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGPQGALCLLAI  227

Query  939  PPSLVVLVGIMIRE  980
            PP  + ++G +I E
Sbjct  228  PPIFLTVLGFVIYE  241



>ref|XP_011031431.1| PREDICTED: probable folate-biopterin transporter 6 isoform X1 
[Populus euphratica]
Length=515

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  VV+VYG +QGLS    ++   YY KD QK+QPS  Q++ G+  +PW++
Sbjct  48   LSSQLNPTFIFGVVVVYGFSQGLSGSFFKVVTDYYWKDVQKVQPSAVQLYMGLYYIPWVM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WGL TDV P+ GY+RRPYFI+AG LG  + L ++ + ++ I +AL CL+  +AGVAI
Sbjct  108  KPIWGLFTDVFPVRGYKRRPYFIVAGVLGCASALMIALLGKVPIAVALSCLIGITAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+ +NSI   +LA DMQSLCG  SS+G LIGY  SGF VH +G +    +L++
Sbjct  168  ADVTIDACIAKNSIEIRALAPDMQSLCGFCSSLGALIGYSSSGFFVHHLGPQVALVLLAV  227

Query  939  PPSLVVLVGIMIRE  980
            PP+L++++G +I E
Sbjct  228  PPALLIVLGFVIYE  241



>ref|NP_001063211.1| Os09g0423400 [Oryza sativa Japonica Group]
 dbj|BAD33420.1| integral membrane transporter-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD33653.1| integral membrane transporter-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF25125.1| Os09g0423400 [Oryza sativa Japonica Group]
 gb|EAZ09143.1| hypothetical protein OsI_31413 [Oryza sativa Indica Group]
 dbj|BAG92837.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  VV+VYG++QG +    R++  YY KD Q++QP+  Q+ + +  +PW++KPLWG++
Sbjct  40   TFVAGVVLVYGLSQGFAGSFFRVASDYYWKDVQRVQPATVQLLSAVFFIPWVLKPLWGIM  99

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviida  779
            TDV P+ GYRRRPYF+ AG LG  +   ++M N L +  A+L  +  S  VAIADV IDA
Sbjct  100  TDVFPVRGYRRRPYFLFAGVLGTASAAIVTMVNGLPMTSAILSFVGISTAVAIADVTIDA  159

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+ +N I  PSL  DMQSLC  SSS+G LIGY  SG  VH +G++G  G++++PP+ +V 
Sbjct  160  CIAKNGIDKPSLVPDMQSLCAFSSSLGALIGYATSGMFVHHLGAQGALGVMALPPATLVF  219

Query  960  VGIMIRE  980
            +G  I E
Sbjct  220  LGFFIYE  226



>emb|CDX85743.1| BnaA02g00700D [Brassica napus]
Length=630

 Score =   175 bits (443),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ SFVL VV+VYG+NQG S  + ++   YY KD Q+++PS  Q++ G+  +PW++
Sbjct  44   LSSRLNPSFVLGVVLVYGLNQGFSGSVFKVVTDYYWKDVQQVEPSVVQLYMGLYYIPWVM  103

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvai  758
            +P+WGL TDV PI GY+R+PYF++AG LGV+ A+  + + ++   LAL CL+  SA +AI
Sbjct  104  RPVWGLFTDVFPIRGYKRKPYFVVAGVLGVVSAVAVVILGKVPAALALSCLLGVSAAMAI  163

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            A+V+IDAC+  NSIS  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L++
Sbjct  164  AEVVIDACIATNSISIWSLAPDIQSLCMVCSSAGALVGYATSGVFVHRLGPQGALGVLAL  223

Query  939  PPSLVVLVGIMIRE  980
            PP+ ++++GI   E
Sbjct  224  PPATIIILGIFFYE  237



>ref|XP_008445270.1| PREDICTED: probable folate-biopterin transporter 6 [Cucumis melo]
Length=500

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LH SF+  V+++YG++ G S    ++   YY KD QKLQPS  QI+TGI ++PW++
Sbjct  34   LSTELHPSFIAGVILIYGLSHGFSGSYFKVVSDYYWKDVQKLQPSVVQIYTGIYTIPWVM  93

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTD  P+ GY RRPYF+++G +G  A + +++   L +  AL  L+  S  +AI
Sbjct  94   KPIWGLLTDAFPVRGYLRRPYFVISGVVGATAAVGVAVKGGLGVLEALGLLIGVSGAMAI  153

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI    LA D+QSLCG  SS+G LIGY  SG  VHL+G++   GIL++
Sbjct  154  ADVTIDACIVRNSIEVQWLAQDLQSLCGACSSIGHLIGYSSSGIFVHLLGAQEALGILAI  213

Query  939  PPSLVVLVGIMIRES  983
            PP+L++L+G  I E+
Sbjct  214  PPALIILLGFFIHET  228



>ref|XP_002460232.1| hypothetical protein SORBIDRAFT_02g025050 [Sorghum bicolor]
 gb|EER96753.1| hypothetical protein SORBIDRAFT_02g025050 [Sorghum bicolor]
Length=507

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  VV+VYG++QG +    R++  YY KD Q+LQP+  Q  +    +PW++KPLWG++
Sbjct  45   TFVAGVVLVYGLSQGFAGSFFRVASDYYWKDVQRLQPATVQFLSVFFFIPWVLKPLWGIM  104

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviida  779
            TDV P+ GYRRRPYF+ +G LG ++   +++   L +  A+LCL+  S  VAIADV IDA
Sbjct  105  TDVFPVCGYRRRPYFLFSGILGTVSAAIVAITVGLPVSSAVLCLVGISTAVAIADVTIDA  164

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+ +NSI  P+LA DMQSLC  SSS+G L+GY  SG  VH +G++G  G++++ P+ VV 
Sbjct  165  CIAKNSIDKPALAPDMQSLCAFSSSLGALVGYATSGMFVHHLGAQGALGVMAIAPATVVF  224

Query  960  VGIMIRE  980
            +G  I E
Sbjct  225  LGFFIYE  231



>ref|XP_007161078.1| hypothetical protein PHAVU_001G041000g [Phaseolus vulgaris]
 gb|ESW33072.1| hypothetical protein PHAVU_001G041000g [Phaseolus vulgaris]
Length=490

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F++ V ++YG+ QGLS  L ++   YY KD QKLQPS  Q+  G+  +PW++
Sbjct  32   LSSKLNPTFMIGVFLIYGLGQGLSGSLFKVVADYYWKDVQKLQPSTVQLLVGVYFIPWVL  91

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KPLWG+LTD  P+ GYRRRPYFI++G +G ++ +T+++   L +  AL+C +  SA +AI
Sbjct  92   KPLWGILTDAFPVRGYRRRPYFIISGVIGTVSAVTVALTGNLAVTAALMCFLGVSASLAI  151

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI    LA D+QSLCG  S  G L+GY+ SGF VH +G +   G++++
Sbjct  152  ADVTIDACIARNSIEVRELAPDLQSLCGYCSGAGALVGYLASGFFVHRLGPQESLGLMAL  211

Query  939  PPSLVVLVGIMIRES  983
             P+L  ++G +I E+
Sbjct  212  SPALTTVLGFVIYEN  226



>gb|AES59126.2| folate/biopterin transporter [Medicago truncatula]
Length=453

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++ L+ +F+  + +VYGI QG +  L ++   YY KD QKLQPS  Q++ GI  +PWI+
Sbjct  34   LTNNLNPTFIAGIFLVYGIGQGFTGSLFKLVTDYYWKDVQKLQPSTVQLYVGIYFIPWIL  93

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WG+LTD  PI GYRRRPYF++AG +G ++   +++  ++ +  AL+C +  SA +AI
Sbjct  94   KPIWGILTDAFPILGYRRRPYFVVAGVVGTVSATIVAVGGEVSVVAALMCFVGVSASLAI  153

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI  P LA D+QSLCG  S  G L+GY+ SGF VH +G +G  G++++
Sbjct  154  ADVTIDACIARNSIEVPGLAPDLQSLCGFCSGSGALLGYLASGFFVHHLGPQGSLGLMAV  213

Query  939  PPSLVVLVGIMIRE  980
             P+L +++G +I E
Sbjct  214  FPALTIVLGFVIYE  227



>ref|XP_008652737.1| PREDICTED: probable folate-biopterin transporter 6 [Zea mays]
 tpg|DAA61532.1| TPA: hypothetical protein ZEAMMB73_226414 [Zea mays]
 tpg|DAA61533.1| TPA: hypothetical protein ZEAMMB73_226414 [Zea mays]
Length=507

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  VV+VYG++QG +    R++  YY KD Q++QP+  Q  +    +PW++KPLWG++
Sbjct  52   TFVAGVVLVYGLSQGFAGSFFRVASDYYWKDVQRVQPATVQFLSVFFFIPWVLKPLWGIM  111

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviida  779
            TDV PI GYRRRPYF+ +G LG ++   +++   L +  A+LCLM  S  VAIADV IDA
Sbjct  112  TDVFPICGYRRRPYFLFSGILGTVSAAIVAVTIGLPMSSAVLCLMGISTAVAIADVTIDA  171

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
             + +NSI  P+LA DMQSLC  SSS+G L+GY  SG  VH +G++G  G++++PP+ VV 
Sbjct  172  SIAKNSIDKPALAPDMQSLCAFSSSLGALVGYATSGLFVHHLGAQGALGVMAIPPATVVF  231

Query  960  VGIMIRE  980
            +G  I E
Sbjct  232  LGFFIYE  238



>ref|XP_003588875.1| Folate-Biopterin Transporter (FBT) family [Medicago truncatula]
Length=466

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L++ L+ +F+  + +VYGI QG +  L ++   YY KD QKLQPS  Q++ GI  +PWI+
Sbjct  34   LTNNLNPTFIAGIFLVYGIGQGFTGSLFKLVTDYYWKDVQKLQPSTVQLYVGIYFIPWIL  93

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WG+LTD  PI GYRRRPYF++AG +G ++   +++  ++ +  AL+C +  SA +AI
Sbjct  94   KPIWGILTDAFPILGYRRRPYFVVAGVVGTVSATIVAVGGEVSVVAALMCFVGVSASLAI  153

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI  P LA D+QSLCG  S  G L+GY+ SGF VH +G +G  G++++
Sbjct  154  ADVTIDACIARNSIEVPGLAPDLQSLCGFCSGSGALLGYLASGFFVHHLGPQGSLGLMAV  213

Query  939  PPSLVVLVGIMIRE  980
             P+L +++G +I E
Sbjct  214  FPALTIVLGFVIYE  227



>ref|XP_006661247.1| PREDICTED: LOW QUALITY PROTEIN: probable folate-biopterin transporter 
6-like [Oryza brachyantha]
Length=497

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  VV+VYG++QG +    R++  YY KD Q++QPS  Q  +    +PW++KPLWG++
Sbjct  42   TFVAGVVLVYGLSQGFAGSFFRVASDYYWKDVQRVQPSTVQFLSVFFFIPWVLKPLWGIM  101

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviida  779
            TDV P+ GYRRRPYF+ AG LG  +   ++M N L +  A+L  +  S  VAIADV IDA
Sbjct  102  TDVFPVRGYRRRPYFLFAGVLGTASAAIVAMVNGLPMTSAILSFVGISTAVAIADVTIDA  161

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+ +N I  PSL  DMQSLC  SSS+G LIGY  SG  VH +G++G  G++++PP+++V 
Sbjct  162  CIAKNGIDKPSLVPDMQSLCAFSSSLGALIGYATSGMFVHHLGAQGALGVMALPPAMLVF  221

Query  960  VGIMIRE  980
            +G  I E
Sbjct  222  LGFFIYE  228



>gb|KDO67414.1| hypothetical protein CISIN_1g037870mg [Citrus sinensis]
Length=511

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 137/195 (70%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  +++VYG++QG S   S++   YY KD QK+QPS  QI+ G+  LP ++
Sbjct  50   LSSQLNSTFIFGIILVYGLSQGFSGSFSKVVTDYYWKDVQKVQPSVVQIYIGLCYLPSVM  109

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WGL TD  PI GY RRPYF++AG  G ++ L  S + +L I +AL C +  SAG+AI
Sbjct  110  KPIWGLFTDAFPIKGYHRRPYFVIAGVAGCVSALMFSLLGKLPIAIALACSVGISAGIAI  169

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI   +LA DMQSLCG  S+ G LIGY +SGF V+ +G +G  G+L++
Sbjct  170  ADVVIDACIARNSIEIRALAPDMQSLCGFCSAAGSLIGYAVSGFSVNHLGPQGALGVLAI  229

Query  939  PPSLVVLVGIMIRES  983
            PP L++++G +I E+
Sbjct  230  PPVLLIVLGFVIYET  244



>ref|XP_006450268.1| hypothetical protein CICLE_v10010366mg [Citrus clementina]
 gb|ESR63508.1| hypothetical protein CICLE_v10010366mg [Citrus clementina]
Length=511

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 137/195 (70%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  +++VYG++QG S   S++   YY KD QK+QPS  QI+ G+  LP ++
Sbjct  50   LSSQLNSTFIFGIILVYGLSQGFSGSFSKVVTDYYWKDVQKVQPSVVQIYIGLCYLPSVM  109

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WGL TD  PI GY RRPYF++AG  G ++ L  S + +L I +AL C +  SAG+AI
Sbjct  110  KPIWGLFTDAFPIKGYHRRPYFVIAGVAGCVSALMFSLLGKLPIAIALACSVGISAGIAI  169

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI   +LA DMQSLCG  S+ G LIGY +SGF V+ +G +G  G+L++
Sbjct  170  ADVVIDACIARNSIEIRALAPDMQSLCGFCSAAGSLIGYAVSGFSVNHLGPQGALGVLAI  229

Query  939  PPSLVVLVGIMIRES  983
            PP L++++G +I E+
Sbjct  230  PPVLLIVLGFVIYET  244



>ref|XP_006483723.1| PREDICTED: probable folate-biopterin transporter 6-like [Citrus 
sinensis]
Length=511

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 137/195 (70%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  +++VYG++QG S   S++   YY KD QK+QPS  QI+ G+  LP ++
Sbjct  50   LSSQLNSTFIFGIILVYGLSQGFSGSFSKVVTDYYWKDVQKVQPSVVQIYIGLCYLPSVM  109

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WGL TD  PI GY RRPYF++AG  G ++ L  S + +L I +AL C +  SAG+AI
Sbjct  110  KPIWGLFTDAFPIKGYHRRPYFVIAGVAGCVSALMFSLLGKLPIAIALACSVGISAGIAI  169

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI   +LA DMQSLCG  S+ G LIGY +SGF V+ +G +G  G+L++
Sbjct  170  ADVVIDACIARNSIEIRALAPDMQSLCGFCSAAGSLIGYAVSGFSVNHLGPQGALGVLAI  229

Query  939  PPSLVVLVGIMIRES  983
            PP L++++G +I E+
Sbjct  230  PPVLLIVLGFVIYET  244



>ref|XP_002283360.2| PREDICTED: probable folate-biopterin transporter 6 [Vitis vinifera]
 emb|CBI21153.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 132/188 (70%), Gaps = 1/188 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +F+L + +VYG++QG S    ++   +Y KD QK+QPS  Q++ G   +PWI+KP+WGLL
Sbjct  66   TFILGIALVYGLSQGFSNSFFKVVTDFYWKDVQKVQPSVVQLYIGFYYIPWIMKPVWGLL  125

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviida  779
            TDV P+ GYRRRPYF+ AG +G ++   ++++  L + +AL CL+  +AGVAIADV IDA
Sbjct  126  TDVFPVMGYRRRPYFVAAGVIGTVSAAVVAISGNLPVAVALGCLIGITAGVAIADVTIDA  185

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+  NSI   SLA DMQS  G  SS G L+GY  SGF VH +G++G  GIL  PP+++V+
Sbjct  186  CIARNSIEIRSLAADMQSFSGFCSSAGALLGYSSSGFFVHHLGAQGALGILVGPPAMLVV  245

Query  960  VGIMIRES  983
            +G +I ES
Sbjct  246  LGFVIYES  253



>ref|XP_002308712.2| hypothetical protein POPTR_0006s28130g [Populus trichocarpa]
 gb|EEE92235.2| hypothetical protein POPTR_0006s28130g [Populus trichocarpa]
Length=479

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 140/198 (71%), Gaps = 5/198 (3%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  VV+VYG +QGLS    ++   YY KD QK+QPS  Q++ G+  +PW++
Sbjct  10   LSSQLNPTFIFGVVVVYGFSQGLSRSFFKVVTDYYWKDVQKVQPSAVQLYMGLYYIPWVM  69

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WGL TDV P+ GY+RRPYFI+AG LG ++ L ++ + ++ I +AL CL+  +AGVAI
Sbjct  70   KPIWGLFTDVFPVRGYKRRPYFIVAGVLGCVSALMIALLGKVPIAVALSCLIGITAGVAI  129

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGI---  929
            ADV IDAC+ +NSI   +LA DMQSLCG  SS+G LIGY  SGF VH +G +    +   
Sbjct  130  ADVTIDACIAKNSIEIRALAPDMQSLCGFCSSLGALIGYSSSGFFVHHLGPQAGLYVSLV  189

Query  930  -LSMPPSLVVLVGIMIRE  980
             L++PP+L++++G +I E
Sbjct  190  LLAVPPALLIVLGFVIYE  207



>ref|XP_006601217.1| PREDICTED: probable folate-biopterin transporter 6-like [Glycine 
max]
Length=509

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 131/195 (67%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FV+ V I+YGI QG S  L ++   YY KD QK+QPS  Q++ G   +PW++
Sbjct  50   LSSQLNPTFVIGVFIIYGIGQGFSGSLFKVVSDYYWKDVQKIQPSTVQLYVGFYFIPWVL  109

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KPLWG+LTD  P+ GYRRRPYFI++G +G I+   ++    L    AL+C +  SA +AI
Sbjct  110  KPLWGILTDAFPVRGYRRRPYFIISGVIGAISAAVVAFAGNLAAVAALMCFLGVSASLAI  169

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI    LA D+QSLCG  S  G L+GY+ SGF VH +G++   G++++
Sbjct  170  ADVTIDACIARNSIEMRKLAPDLQSLCGFCSGAGALVGYLASGFFVHRLGTQESLGLMAL  229

Query  939  PPSLVVLVGIMIRES  983
             P+L +++G +I E+
Sbjct  230  SPALTIVLGFVIYEN  244



>tpg|DAA37101.1| TPA: hypothetical protein ZEAMMB73_089511 [Zea mays]
Length=633

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = +3

Query  447  VYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAG  626
            VYG  QG+   +  ++  YY KD Q++QPS AQ + G+   PWIVKP+WGLLTDV+P+AG
Sbjct  153  VYGACQGVGNAIGGVAAGYYWKDVQRVQPSVAQFYQGVTDAPWIVKPIWGLLTDVVPVAG  212

Query  627  YRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviidaCVTENSIS  803
            +RRRPYF+LAG +GV +ML  S+N +L I  ALL L A SAG A+ DV +DA V +NSI+
Sbjct  213  FRRRPYFVLAGVIGVSSMLMFSLNHELGIMPALLMLTAQSAGAAVGDVTVDALVAQNSIT  272

Query  804  HPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRES  983
            HP LA DMQSLCG SSS+G L+G+ +SG LVH +GS+G  G+LS+P +LV+L GI+++E+
Sbjct  273  HPPLAADMQSLCGFSSSIGALLGFSLSGLLVHSMGSQGALGLLSIPSALVLLAGILLKEN  332



>gb|EPS73522.1| hypothetical protein M569_01230, partial [Genlisea aurea]
Length=435

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L  +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q+F G+ ++PW++
Sbjct  9    LSSKLSPTFVLGVVLVYGLSQGFSFSFFKVVSDYYWKDVQKLQPSAVQLFVGLYTIPWLM  68

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP WGLLTDV P+ GY RRPYFILAG +G+ +  +++    L + LAL+CL+   AG+AI
Sbjct  69   KPFWGLLTDVFPVKGYHRRPYFILAGVVGLASAASVAFGGDLPVALALICLIGVMAGIAI  128

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI+  SLA DMQSL G  SS G LIGY  SGF + L       G+L +
Sbjct  129  ADVTIDACIARNSIAIRSLATDMQSLSGACSSAGALIGYSTSGFFISL-------GLLGI  181

Query  939  PPSLVVLVGIMIRE  980
             P+ ++ +G + +E
Sbjct  182  SPAAMIALGFVFQE  195



>ref|XP_003545404.1| PREDICTED: probable folate-biopterin transporter 6-like [Glycine 
max]
Length=523

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 130/196 (66%), Gaps = 1/196 (1%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            KLS  L+ +FV+ V ++YGI QG S  L ++   YY KD QK+QP   Q++ G   +PW+
Sbjct  62   KLSSQLNPTFVIGVFLIYGIGQGFSGSLFKVVADYYWKDVQKIQPFTVQLYVGFYFIPWV  121

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagva  755
            +KPLWG+LTD  P+ GYRRRPYFI++G +G ++   ++    L    AL+C +  SA +A
Sbjct  122  LKPLWGILTDAFPVRGYRRRPYFIISGVIGAVSAAVIAFAGNLAAVAALMCFVGVSASLA  181

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            IADV IDAC+  NSI    LA D+QSLCG  S  G L+GY+ SGF VH +G +   G+++
Sbjct  182  IADVTIDACIARNSIEVRELAPDLQSLCGFCSGAGALVGYLASGFFVHRLGPQESLGLMA  241

Query  936  MPPSLVVLVGIMIRES  983
            + P+L +++G +I E+
Sbjct  242  LSPALTIVLGFVIYEN  257



>ref|XP_008347489.1| PREDICTED: probable folate-biopterin transporter 6 isoform X2 
[Malus domestica]
Length=287

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 1/174 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q++ G+  +PW++
Sbjct  48   LSSELNPTFVLGVVLVYGLSQGFSGSYFKVVTDYYWKDVQKLQPSVVQLYIGLYYIPWLM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF+LAG +G ++ LT++ +  L   +AL  L+  +AGVAI
Sbjct  108  KPVWGLLTDVFPVRGYRRRPYFVLAGVIGTVSALTVAFSGNLAAVVALTWLIGVTAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGV  920
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G + V
Sbjct  168  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGPQAV  221



>ref|XP_003576536.1| PREDICTED: probable folate-biopterin transporter 6 [Brachypodium 
distachyon]
Length=501

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  VV+VYG++QG +    R++  YY KD Q++QP+  Q  +  + +P ++KPLWG++
Sbjct  44   TFVAGVVLVYGLSQGFAGSFFRVASDYYWKDVQRVQPATVQFLSIFLYIPLVLKPLWGVM  103

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviida  779
            TDV P+ GYRRRPYF+ +G LG+ +   L+M   L +  A++C +  S  VAIADV IDA
Sbjct  104  TDVFPVHGYRRRPYFVFSGILGMSSAAILAMGVGLSLPSAIICFVGISTAVAIADVTIDA  163

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+ +NSI  P+LA DMQSLC  SSS+G LIGY  SG  VH +G++G   I+++PP+++V 
Sbjct  164  CIAKNSIDKPALAPDMQSLCAFSSSLGALIGYATSGMFVHHLGAQGALSIMALPPAMLVF  223

Query  960  VGIMIRE  980
            +G+ I E
Sbjct  224  LGLYIYE  230



>ref|XP_002324339.2| hypothetical protein POPTR_0018s02720g [Populus trichocarpa]
 gb|EEF02904.2| hypothetical protein POPTR_0018s02720g [Populus trichocarpa]
Length=519

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 138/194 (71%), Gaps = 8/194 (4%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +F+  VV+VYG++QG S    ++   +Y KD QK+QPS  Q++ G+  +PW++
Sbjct  56   LSSQLNPTFIFGVVVVYGLSQGFSGSFFKVVTDFYWKDVQKVQPSAVQLYIGLYYIPWVM  115

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GY+RRPYF++AG LG + A++  ++ ++ I +AL CL+  +AGVAI
Sbjct  116  KPIWGLLTDVFPVRGYKRRPYFLVAGVLGCVSALMVATLGKVPIAVALSCLIGITAGVAI  175

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+ +NSI   SLA DMQSLCG  SS+G LIGY  SGF   L+       +L++
Sbjct  176  ADVTIDACIAKNSIEIRSLAPDMQSLCGICSSLGALIGYSSSGFFASLV-------LLAV  228

Query  939  PPSLVVLVGIMIRE  980
            PP++++++G +I E
Sbjct  229  PPTILIVLGFVIYE  242



>ref|XP_004498797.1| PREDICTED: probable folate-biopterin transporter 6-like isoform 
X2 [Cicer arietinum]
Length=494

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 129/188 (69%), Gaps = 1/188 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            SF+  + +VYGI QG S    ++   YY KD QK+QPS  Q++ GI  +PWI+KP+WG+ 
Sbjct  68   SFIAGIFLVYGIGQGFSGSFFKLVSDYYWKDVQKIQPSTVQLYVGIYFIPWILKPIWGIC  127

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviida  779
            TD  P+ GY+RRPYFI+AG +G ++   +++   L    AL+C +  SA +AIADV IDA
Sbjct  128  TDAFPLFGYQRRPYFIVAGVIGTVSASVVAVQGGLGAAAALVCFVGVSASLAIADVTIDA  187

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+  NSI  P LA D+QSLCG  S+ G L+GY++SGF VH +G +G  G++++ P+L ++
Sbjct  188  CIARNSIEVPCLAPDLQSLCGFCSASGALLGYLVSGFFVHHLGPQGSLGLMAIFPALTIV  247

Query  960  VGIMIRES  983
            +G +I E+
Sbjct  248  LGFVIYEN  255



>ref|XP_004498796.1| PREDICTED: probable folate-biopterin transporter 6-like isoform 
X1 [Cicer arietinum]
Length=522

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 129/188 (69%), Gaps = 1/188 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            SF+  + +VYGI QG S    ++   YY KD QK+QPS  Q++ GI  +PWI+KP+WG+ 
Sbjct  68   SFIAGIFLVYGIGQGFSGSFFKLVSDYYWKDVQKIQPSTVQLYVGIYFIPWILKPIWGIC  127

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvaiadviida  779
            TD  P+ GY+RRPYFI+AG +G ++   +++   L    AL+C +  SA +AIADV IDA
Sbjct  128  TDAFPLFGYQRRPYFIVAGVIGTVSASVVAVQGGLGAAAALVCFVGVSASLAIADVTIDA  187

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+  NSI  P LA D+QSLCG  S+ G L+GY++SGF VH +G +G  G++++ P+L ++
Sbjct  188  CIARNSIEVPCLAPDLQSLCGFCSASGALLGYLVSGFFVHHLGPQGSLGLMAIFPALTIV  247

Query  960  VGIMIRES  983
            +G +I E+
Sbjct  248  LGFVIYEN  255



>ref|XP_008377626.1| PREDICTED: probable folate-biopterin transporter 6 isoform X2 
[Malus domestica]
Length=438

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 1/174 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q++ G+  +PW++
Sbjct  48   LSSELNPTFVLGVVLVYGLSQGFSGSYFKVVTDYYWKDVQKLQPSVVQLYIGLYYIPWLM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF+LAG +G ++ LT++ +  L   +AL  L+  +AGVAI
Sbjct  108  KPVWGLLTDVFPVRGYRRRPYFVLAGVIGTVSALTVAFSGNLAAVVALTWLIGVTAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGV  920
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G + V
Sbjct  168  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGPQAV  221



>ref|XP_008377625.1| PREDICTED: probable folate-biopterin transporter 6 isoform X1 
[Malus domestica]
Length=475

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 1/174 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL VV+VYG++QG S    ++   YY KD QKLQPS  Q++ G+  +PW++
Sbjct  48   LSSELNPTFVLGVVLVYGLSQGFSGSYFKVVTDYYWKDVQKLQPSVVQLYIGLYYIPWLM  107

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GYRRRPYF+LAG +G ++ LT++ +  L   +AL  L+  +AGVAI
Sbjct  108  KPVWGLLTDVFPVRGYRRRPYFVLAGVIGTVSALTVAFSGNLAAVVALTWLIGVTAGVAI  167

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGV  920
            ADV IDAC+  NSI   SLA D+QSLCG  SS G L+GY  SGF VH +G + V
Sbjct  168  ADVTIDACIARNSIEIRSLASDLQSLCGFCSSAGALVGYSTSGFFVHHLGPQAV  221



>ref|XP_006450266.1| hypothetical protein CICLE_v10008109mg [Citrus clementina]
 gb|ESR63506.1| hypothetical protein CICLE_v10008109mg [Citrus clementina]
Length=458

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 1/174 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  LH SF+  +V+VYG+ QG S    ++   YY KD QK+QPS  QI+ G+  LPW++
Sbjct  33   LSSQLHSSFIFGIVLVYGLCQGFSGSFFKVVTDYYWKDVQKVQPSTVQIYIGLYYLPWVM  92

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            KP+WG+ TD  PI GY RRPYF++AG LG+++ L ++ + +L I LAL CL+  + G+AI
Sbjct  93   KPIWGIFTDAFPIKGYHRRPYFVIAGVLGLVSALIVALLGKLPIALALTCLIGITGGMAI  152

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGV  920
            ADV+IDAC+  NSI   +LA DMQSLC   S  G LIGY  SGF VH +G + +
Sbjct  153  ADVVIDACIARNSIETRALAPDMQSLCAFCSGAGSLIGYSSSGFFVHHLGHQAI  206



>gb|KFK42483.1| hypothetical protein AALP_AA2G262800 [Arabis alpina]
Length=353

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +3

Query  543  QIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELA  719
            ++   ++ +PWI+KP+WGLLTDV+P+ GYRRRPYFI AG + ++AM+ LS+++ L + LA
Sbjct  2    ELVKDLVKIPWIIKPVWGLLTDVVPVMGYRRRPYFIFAGVVTMVAMMVLSLHKNLHLGLA  61

Query  720  LLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVH  899
            L  L+AGSAGVAIADV IDACVT+ SISHPSLA DMQSLCG SSS+G L+G+ +SG LVH
Sbjct  62   LTSLVAGSAGVAIADVTIDACVTQCSISHPSLAADMQSLCGMSSSIGSLVGFSLSGVLVH  121

Query  900  LIGSKGVFGILSMPPSLVVLVGIMIRES  983
              G+KGV+G+L M   L V+VG++++ES
Sbjct  122  WFGAKGVYGLLGMTSGLTVVVGLLLKES  149



>gb|KFK25363.1| hypothetical protein AALP_AA8G103600 [Arabis alpina]
Length=504

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            SFVL VV+VYG+NQG S    ++   YY KD Q++QPS  Q++ G+  +PW+++P+WGLL
Sbjct  56   SFVLGVVLVYGLNQGFSGSFFKVVTDYYWKDVQQVQPSVVQLYMGLYYIPWVMRPIWGLL  115

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvaiadviida  779
            TDV PI GY+R+PYF+++G LG+++ + ++ + +L   LAL CL+  SA +AIADV IDA
Sbjct  116  TDVFPIRGYKRKPYFVVSGVLGMVSAIAIAVLGKLPAALALSCLVGVSAAMAIADVAIDA  175

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L++PP+ +V+
Sbjct  176  CIATNSINIRSLAPDIQSLCMVCSSAGALLGYATSGVFVHRLGPQGALGVLALPPATIVI  235

Query  960  VGIMIRES  983
            +G  I E 
Sbjct  236  LGFFIYEK  243



>ref|XP_009125269.1| PREDICTED: probable folate-biopterin transporter 6 [Brassica 
rapa]
 ref|XP_009125270.1| PREDICTED: probable folate-biopterin transporter 6 [Brassica 
rapa]
Length=497

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 138/195 (71%), Gaps = 1/195 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ SFV+ VV+VYG+NQG S  + ++   YY KD Q+++PS  Q++ G+  +PW++
Sbjct  44   LSSRLNPSFVVGVVLVYGLNQGFSGSIFKVVTDYYWKDVQQVEPSVVQLYMGLYYIPWVM  103

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            +P+WGL TDV PI GY+R+PYF++AG LGV++ + L +  ++   LAL CL+  SA +AI
Sbjct  104  RPIWGLFTDVFPIRGYKRKPYFVVAGVLGVVSAVALVVFGKVPAALALSCLLGVSAAMAI  163

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            A+V+IDAC+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L++
Sbjct  164  AEVVIDACIATNSINIRSLAPDIQSLCMVCSSAGALVGYATSGVFVHRLGPQGALGVLAL  223

Query  939  PPSLVVLVGIMIRES  983
            PP+ ++++GI   E 
Sbjct  224  PPATIIILGIFFYEK  238



>gb|EYU29205.1| hypothetical protein MIMGU_mgv1a018953mg, partial [Erythranthe 
guttata]
Length=499

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 133/194 (69%), Gaps = 8/194 (4%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ +FVL V++ YG+NQG S    ++   +Y KD QK+QPSE Q+F G+  +PW++
Sbjct  8    LSSKLNPTFVLGVLLTYGLNQGFSGSFFKVVSDFYWKDVQKVQPSEVQLFIGLYYIPWVM  67

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvai  758
            KP+WGL+TDV P+ GY RRPYF++AG LGV + L+++   +L +  AL  L+  + GVAI
Sbjct  68   KPVWGLMTDVFPVMGYHRRPYFVVAGVLGVASALSVAAGGRLAVAAALTLLIGITGGVAI  127

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+  NSI   SLA DMQ+LCG  SS G L+GY  SGFLV L       GIL++
Sbjct  128  ADVTIDACIARNSIEIRSLAADMQTLCGLCSSAGALLGYSTSGFLVAL-------GILAI  180

Query  939  PPSLVVLVGIMIRE  980
            P + ++L+G +I E
Sbjct  181  PSATLILLGFVIYE  194



>ref|XP_006399579.1| hypothetical protein EUTSA_v10013335mg [Eutrema salsugineum]
 gb|ESQ41032.1| hypothetical protein EUTSA_v10013335mg [Eutrema salsugineum]
Length=500

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 133/188 (71%), Gaps = 1/188 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            SFVL VV+VYG+NQG S  + ++   YY KD Q++QPS  Q++ G+  +PW+++P+WGL 
Sbjct  56   SFVLGVVLVYGLNQGFSGSIFKVVTDYYWKDVQQVQPSVVQLYMGLYYIPWVMRPIWGLF  115

Query  603  TDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvaiadviida  779
            TD+  I GY+R+PYF+++G LG++ A   + + +L   LAL CL+  SA +AIADV+IDA
Sbjct  116  TDIFLIKGYKRKPYFVVSGVLGLVSASAIVVLGKLPAALALSCLLGVSAAMAIADVVIDA  175

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            C+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L++PP+ +++
Sbjct  176  CIATNSINIRSLATDIQSLCMVCSSAGALVGYATSGVFVHRLGPQGALGVLAVPPATIII  235

Query  960  VGIMIRES  983
            +G +I E 
Sbjct  236  LGFLIYEK  243



>gb|EMS68051.1| hypothetical protein TRIUR3_09644 [Triticum urartu]
Length=475

 Score =   151 bits (381),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +3

Query  543  QIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELA  719
            + + GI+  PW+VKP+WGLLTDV+P+AGYRRRPYF+LAG +G  +ML +S+ + L +  A
Sbjct  26   KFYQGIVDSPWVVKPIWGLLTDVVPVAGYRRRPYFLLAGVIGATSMLMISLQSNLGLIPA  85

Query  720  LLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVH  899
            +L L   SAG AIADV +DA V +NSI+HP LA DMQSLCG  SS G LIGY ISG LVH
Sbjct  86   VLALTVQSAGAAIADVTLDALVAQNSITHPPLAADMQSLCGFCSSFGSLIGYSISGLLVH  145

Query  900  LIGSKGVFGILSMPPSLVVLVGIMIRES  983
             +G++G  G+LS+P +LV   GI+++ES
Sbjct  146  SMGAQGALGLLSIPSALVFSAGILLKES  173



>emb|CDX88561.1| BnaC06g40050D [Brassica napus]
Length=484

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 12/195 (6%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            L + LHWSF   V++VYG++QGL  GLS++S QYY KDEQ ++         ++SL  +V
Sbjct  38   LVEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQMIKC--------VLSLK-VV  88

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvai  758
              +       L I    R   F L G L +++M+ LS+++ L++ LAL CL+AGSAGVAI
Sbjct  89   SLVTNKGKKKLLIK--ERCHLFYLVGVLSMVSMMVLSLHKNLQLGLALSCLVAGSAGVAI  146

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDACVT+ SISHP+LA DMQSLCG SSS+G L+G+ +SG LVHL GSKGV+G+L M
Sbjct  147  ADVTIDACVTQLSISHPTLAADMQSLCGMSSSIGSLVGFSLSGVLVHLFGSKGVYGLLGM  206

Query  939  PPSLVVLVGIMIRES  983
               L V+VG++++ES
Sbjct  207  TAGLTVVVGLILKES  221



>ref|XP_001761713.1| predicted protein [Physcomitrella patens]
 gb|EDQ73469.1| predicted protein [Physcomitrella patens]
Length=569

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 119/187 (64%), Gaps = 1/187 (1%)
 Frame = +3

Query  423  SFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLL  602
            +FV  V++VYGI+QG+   LSR+ + YY +D Q  +PS  Q + GI  +PW VKPL+GLL
Sbjct  100  TFVFGVMVVYGISQGIGYALSRVVVDYYWRDVQGKEPSTVQFYRGITVIPWDVKPLYGLL  159

Query  603  TDVLPIAGYRRRPYFILAGSLGVIAMLTLSM-NQLRIELALLCLMagsagvaiadviida  779
            TD+LP  GY RRPYFILAG + +   L+L +  +     AL   +  SA  AIADV IDA
Sbjct  160  TDLLPFFGYHRRPYFILAGLITLSTYLSLVLGGKFLASTALAMFVGASAAAAIADVTIDA  219

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
             V   S   P L   +QSLCG  SS+G L G+++SG  VH+ GS+G  G++ +P  L+++
Sbjct  220  LVAMKSREKPELGTHIQSLCGSCSSIGSLSGFLLSGLAVHIFGSQGALGVMIVPGILLLI  279

Query  960  VGIMIRE  980
            +G  I E
Sbjct  280  LGFTINE  286



>emb|CDP07869.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 122/194 (63%), Gaps = 21/194 (11%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L  +FVL V++VYG++QG S    ++   YY KD QK+QPS  Q+F  + S+PW++
Sbjct  65   LSSRLDSTFVLGVILVYGLSQGFSGSFFKVVSDYYWKDVQKVQPSAVQLFISLYSIPWVM  124

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagvai  758
            KP+WGLLTDV P+ GY+RRPYF++AG +G I+ L L+++  L + LAL  L+    GVAI
Sbjct  125  KPIWGLLTDVFPVKGYKRRPYFVVAGVVGAISALFLALSGNLAVALALGFLIGIMTGVAI  184

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV IDAC+   SI   SLA DMQSLCG  SS                    G  G+L++
Sbjct  185  ADVTIDACIARKSIEIKSLAPDMQSLCGFCSS--------------------GSLGLLAI  224

Query  939  PPSLVVLVGIMIRE  980
            PP+ ++ +G +I E
Sbjct  225  PPAALIALGFVINE  238



>ref|XP_002873479.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49738.1| integral membrane transporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=502

 Score =   143 bits (361),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ SFVL VV+VYG+NQG S  + ++   YY KD Q++QPS  Q++ G+  +PW++
Sbjct  49   LSSRLNLSFVLGVVLVYGVNQGFSGSIFKVVTDYYWKDVQQVQPSVVQLYMGLYYIPWVM  108

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagvai  758
            +P+WGL TDV PI GY+R+PYF+++G LG+++ + ++ + +L   LAL CL+  SA +AI
Sbjct  109  RPIWGLFTDVFPIKGYKRKPYFVVSGVLGLVSAIAIAVLGKLPAALALSCLLGVSAAMAI  168

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L+ 
Sbjct  169  ADVVIDACIATNSINIRSLAPDIQSLCMVCSSAGALVGYATSGVFVHRLGPQGALGVLAF  228

Query  939  PPSLVVLVGIMIRE  980
             P+ +V++G  I E
Sbjct  229  SPATIVILGFFIYE  242



>ref|XP_010453115.1| PREDICTED: probable folate-biopterin transporter 6 [Camelina 
sativa]
Length=493

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 135/190 (71%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFVL VV+VYG+NQG S  + ++   YY KD Q++QPS  Q++ G+  +PW+++P+W
Sbjct  44   LNLSFVLGVVLVYGVNQGFSGSIFKVVTDYYWKDVQQVQPSVVQLYVGLYYIPWVMRPIW  103

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvaiadvi  770
            GL TDV PI GY+R+PYF+++G LG++ A+  +++ +L   LAL CL+  SA +AIADV+
Sbjct  104  GLFTDVFPIKGYKRKPYFVVSGVLGLVSAIAVVALGKLPAALALSCLLGVSAAMAIADVV  163

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L+  P+ 
Sbjct  164  IDACIATNSINIRSLAPDIQSLCMVCSSAGALVGYATSGVFVHRLGPQGALGVLAFSPAT  223

Query  951  VVLVGIMIRE  980
            +V++G  I E
Sbjct  224  IVILGFFIYE  233



>ref|NP_196643.1| probable folate-biopterin transporter 6 [Arabidopsis thaliana]
 sp|Q9LEV7.1|FBT6_ARATH RecName: Full=Probable folate-biopterin transporter 6 [Arabidopsis 
thaliana]
 emb|CAB96837.1| putative protein [Arabidopsis thaliana]
 gb|AED91600.1| probable folate-biopterin transporter 6 [Arabidopsis thaliana]
Length=503

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = +3

Query  402  LSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIV  581
            LS  L+ SFVL VV+VYG+NQG S  + ++   YY KD Q++QPS  Q++ G+  +PW++
Sbjct  49   LSSRLNLSFVLGVVLVYGVNQGFSGSIFKVVTDYYWKDVQQVQPSVVQLYMGLYYIPWVM  108

Query  582  KPLWGLLTDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvai  758
            +P+WGL TDV PI GY+R+PYF+++G LG++ A+  + + +L   LAL CL+  SA +AI
Sbjct  109  RPIWGLFTDVFPIKGYKRKPYFVVSGVLGLVSAIAIVVLGKLPAALALSCLLGVSAAMAI  168

Query  759  adviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSM  938
            ADV+IDAC+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L+ 
Sbjct  169  ADVVIDACIATNSINIRSLAPDIQSLCMVCSSAGALVGYATSGVFVHQLGPQGALGVLAF  228

Query  939  PPSLVVLVGIMIRE  980
             P+ +V++G  I E
Sbjct  229  SPATIVILGFFIYE  242



>gb|EMT06656.1| hypothetical protein F775_20552 [Aegilops tauschii]
Length=532

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 102/151 (68%), Gaps = 0/151 (0%)
 Frame = +3

Query  462  QGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRRRP  641
            QG +    R++  YY KD Q++QP+  Q  +    +PW++KPLWG++TDV P+ GYRRRP
Sbjct  39   QGFAGSFFRVASDYYWKDVQRVQPATVQFLSIFFHVPWVLKPLWGVMTDVFPVRGYRRRP  98

Query  642  YFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAG  821
            YF+ +G LG+ +   L+   L +  A++C +  S  VAIADV IDAC+ +NSI  P+LA 
Sbjct  99   YFVFSGMLGMFSTAILASVGLSVTSAVVCFVGISTAVAIADVTIDACIAKNSIDKPALAP  158

Query  822  DMQSLCGGSSSVGQLIGYMISGFLVHLIGSK  914
            DMQSLC  SSS+G LIGY  SG  VH +G++
Sbjct  159  DMQSLCAFSSSLGALIGYATSGMFVHHLGAQ  189



>ref|XP_010491768.1| PREDICTED: probable folate-biopterin transporter 6 [Camelina 
sativa]
Length=491

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 134/190 (71%), Gaps = 1/190 (1%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFVL VV+VYG+NQG S  + ++   YY KD Q++QPS  Q++ G+  +PW+++P+W
Sbjct  44   LNLSFVLGVVLVYGVNQGFSGSIFKVVTDYYWKDVQQVQPSVVQLYVGLYYIPWVMRPIW  103

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVI-AMLTLSMNQLRIELALLCLMagsagvaiadvi  770
            GL TDV PI GY+R+PYF+++G LG++ A+  + + +L   LAL CL+  SA +AIADV+
Sbjct  104  GLFTDVFPIKGYKRKPYFVVSGVLGLVSAIAVVVLGKLPAALALSCLLGVSAAMAIADVV  163

Query  771  idaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSL  950
            IDAC+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G +G  G+L+  P+ 
Sbjct  164  IDACIATNSINIRSLAPDIQSLCMVCSSAGALVGYATSGVFVHRLGPQGALGVLAFSPAT  223

Query  951  VVLVGIMIRE  980
            +V++G  I E
Sbjct  224  IVILGFFIYE  233



>ref|XP_008348559.1| PREDICTED: LOW QUALITY PROTEIN: probable folate-biopterin transporter 
3 [Malus domestica]
Length=514

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 103/132 (78%), Gaps = 8/132 (6%)
 Frame = +3

Query  591  WGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQ-LRIELALLCLMagsagvaiadv  767
            W  +  VL + G       I  G LGVI+ML LS+++ L + ++LL LMAGSAGVAIADV
Sbjct  49   WSFVVGVLTVYG-------ISQGLLGVISMLVLSLDKNLNLTMSLLALMAGSAGVAIADV  101

Query  768  iidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPS  947
             IDACVT+NSI HPSLAGDMQSLCG SSSVG L+G+ +SGFLVHL+G KGVFG+LS+PP 
Sbjct  102  TIDACVTQNSIRHPSLAGDMQSLCGLSSSVGALVGFSLSGFLVHLVGPKGVFGLLSIPPG  161

Query  948  LVVLVGIMIRES  983
            LV+LVGIM RES
Sbjct  162  LVILVGIMHRES  173



>ref|XP_009774795.1| PREDICTED: probable folate-biopterin transporter 3 [Nicotiana 
sylvestris]
Length=372

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  678  MLTLSM-NQLRIELALLCLMagsagvaiadviidaCVTENSISHPSLAGDMQSLCGGSSS  854
            ML+LS  ++L++  ALLCLM GSA  A+ADV IDACVTENSISHPSLA DMQSLCG SSS
Sbjct  1    MLSLSFGDKLQLASALLCLMGGSAAQAVADVTIDACVTENSISHPSLASDMQSLCGVSSS  60

Query  855  VGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            VGQLIGY +SGFLVHLIGSKGVFG+LS+P +LV+LVG+M+ E
Sbjct  61   VGQLIGYTLSGFLVHLIGSKGVFGVLSIPAALVILVGMMLHE  102



>ref|XP_006289087.1| hypothetical protein CARUB_v10002493mg [Capsella rubella]
 gb|EOA21985.1| hypothetical protein CARUB_v10002493mg [Capsella rubella]
Length=482

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 120/198 (61%), Gaps = 24/198 (12%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            L+ SFVL VV+VYG+NQG S  + ++   YY KD Q++QPS  Q++ G+  +PW+++P+W
Sbjct  44   LNLSFVLGVVLVYGVNQGFSGSIFKVVTDYYWKDVQQVQPSVVQLYMGLYYIPWVMRPIW  103

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadvii  773
            GL TDV PI GY+R+PYF+++G LG+++ + + +  + I   ++                
Sbjct  104  GLFTDVFPIKGYKRKPYFVVSGVLGLVSAIAVVVLAMAIADVVI----------------  147

Query  774  daCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGS--------KGVFGI  929
            DAC+  NSI+  SLA D+QSLC   SS G L+GY  SG  VH +G         KG  G+
Sbjct  148  DACIATNSINIRSLAPDIQSLCMVCSSAGALVGYATSGVFVHRLGPQRFLFFVIKGALGV  207

Query  930  LSMPPSLVVLVGIMIRES  983
            L+  P+ +VL+G  I E 
Sbjct  208  LAFSPATIVLLGFFIYEK  225



>gb|EEE63522.1| hypothetical protein OsJ_18338 [Oryza sativa Japonica Group]
Length=335

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 115/195 (59%), Gaps = 33/195 (17%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +LS  L WSFVL+VV VYG  QG+   +  ++  YY KD Q++QPS   +  G+  +   
Sbjct  28   RLSRELRWSFVLAVVAVYGACQGVGDAVGGVTAGYYWKDVQRVQPSAGAVLPGVRVI---  84

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMN-QLRIELALLCLMagsagva  755
                                         G  +MLTLS++ +L I  A+L L A SAG A
Sbjct  85   -----------------------------GASSMLTLSLHRKLGIMPAILALTAQSAGAA  115

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
            +ADV +DA V +NSI+H  LA DMQSLCG SSSVG L+G+ ISG LVH IGS+G  G+LS
Sbjct  116  VADVTVDALVAQNSITHQPLAADMQSLCGFSSSVGALLGFSISGLLVHSIGSQGALGLLS  175

Query  936  MPPSLVVLVGIMIRE  980
            +P +LV L G++++E
Sbjct  176  IPSALVFLAGVLLKE  190



>ref|XP_005854302.1| hypothetical protein NGA_0170910 [Nannochloropsis gaditana CCMP526]
 gb|EKU22054.1| hypothetical protein NGA_0170910 [Nannochloropsis gaditana CCMP526]
Length=684

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 117/198 (59%), Gaps = 6/198 (3%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +L D   + F+  ++ VYG++QGL      +S  YY+KD  KL+P+ AQ F  +  LPW 
Sbjct  112  RLCDAFGFKFIGLLMCVYGLSQGLGENYMSMSTDYYLKDVLKLEPASAQAFKSLTHLPWN  171

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagva  755
            +KP++GL++D LPI G++R PY ILAG LGV A LTL+ + +    L+   ++  +  +A
Sbjct  172  IKPIYGLMSDTLPIMGFKRSPYIILAGGLGVTAWLTLALLRRPSFNLSAFLILLANYSIA  231

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
              DVIIDA +TE S   P  A D+QSL  GS S+G ++G    G     + S+GVF + S
Sbjct  232  SPDVIIDAAITERSQLAPMYASDLQSLSWGSHSLGGILGCSTVGQAQAHLHSRGVFALTS  291

Query  936  MPPSLVVLVGIMIRESLR  989
            +       + I+I  SLR
Sbjct  292  L-----TSLSILILASLR  304



>gb|EWM24710.1| Major facilitator superfamily domain, general substrate transporter 
[Nannochloropsis gaditana]
Length=684

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 117/198 (59%), Gaps = 6/198 (3%)
 Frame = +3

Query  399  KLSDVLHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWI  578
            +L D   + F+  ++ VYG++QGL      +S  YY+KD  KL+P+ AQ F  +  LPW 
Sbjct  112  RLCDAFGFKFIGLLMCVYGLSQGLGENYMSMSTDYYLKDVLKLEPASAQAFKSLTHLPWN  171

Query  579  VKPLWGLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLS-MNQLRIELALLCLMagsagva  755
            +KP++GL++D LPI G++R PY ILAG LGV A LTL+ + +    L+   ++  +  +A
Sbjct  172  IKPIYGLMSDTLPIMGFKRSPYIILAGGLGVTAWLTLALLRRPSFNLSAFLILLANYSIA  231

Query  756  iadviidaCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILS  935
              DVIIDA +TE S   P  A D+QSL  GS S+G ++G    G     + S+GVF + S
Sbjct  232  SPDVIIDAAITERSQLAPMYASDLQSLSWGSHSLGGILGCSTVGQAQAHLHSRGVFALTS  291

Query  936  MPPSLVVLVGIMIRESLR  989
            +       + I+I  SLR
Sbjct  292  L-----TSLSILILASLR  304



>gb|EWM25378.1| folate biopterin transporter [Nannochloropsis gaditana]
Length=531

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 113/191 (59%), Gaps = 9/191 (5%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            V ++++VY + QG ++GL+R++  +Y+KD+  L P+++    GI + PW++KPL+G L+D
Sbjct  110  VTAILVVYFV-QG-AIGLARLATTFYLKDDLHLSPAQSAALMGIFTAPWLLKPLYGFLSD  167

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELA---LLCLMagsagvaiadviida  779
              P+ GYRRR Y  ++G LG ++   L+   L   +A   L C     +      V    
Sbjct  168  GFPLGGYRRRSYLAISGLLGAVSYFVLAFPGLVDSVAAATLACTFGSLSVAVSDVVADSI  227

Query  780  CV----TENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPS  947
             V    TE+   +  LAG +QSLC GSS+VG ++    SGFL+  +G++ VFGI ++ P 
Sbjct  228  VVEKIRTESPAGNLKLAGGLQSLCWGSSAVGGIVSAYFSGFLLEHLGTRAVFGITAILPL  287

Query  948  LVVLVGIMIRE  980
            LV L+ + I+E
Sbjct  288  LVTLISMGIQE  298



>ref|WP_013193199.1| folate/biopterin transporter [Trichormus azollae]
 gb|ADI66190.1| folate/biopterin transporter ['Nostoc azollae' 0708]
Length=454

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 120/186 (65%), Gaps = 3/186 (2%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            ++++++VY + QG+ LGL+R++I +++KDE  L P E  +  GI++LPW++KPL+G ++D
Sbjct  29   LMAILVVYFV-QGI-LGLARLAISFFLKDELHLSPVEVSVLLGIVALPWMIKPLFGFISD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LPI GYRRRPY +L+G LG  A ++LS       +A + +   S  VA +DVI+D+ V 
Sbjct  87   GLPIFGYRRRPYLVLSGILGAAAWVSLSTLAYSTWVATIAIALSSLSVAFSDVIVDSLVV  146

Query  789  ENS-ISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E + +   +  G +QSLC G++++G LI    SG L+    ++ VF + ++ P ++ LV 
Sbjct  147  ERARVESQAQVGSLQSLCWGTTALGGLITAYFSGLLLEYFSTRTVFLVTAIFPLIISLVA  206

Query  966  IMIRES  983
              I E+
Sbjct  207  WFIHET  212



>ref|WP_009556865.1| folate/biopterin transporter [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68100.1| folate/biopterin transporter [Oscillatoriales cyanobacterium 
JSC-12]
Length=485

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 110/188 (59%), Gaps = 7/188 (4%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            ++++++VY I QG+ LGL+R++I +++KD+  L P+E     GI +LPW+VKPL+G ++D
Sbjct  29   LIAILLVY-IVQGI-LGLARLAISFFLKDDLGLTPAEVSAMVGIAALPWMVKPLFGFISD  86

Query  609  VLPIAGYRRRPYFILAGSLGV---IAMLTLSMNQLRIELALLCLMagsagvaiadviida  779
             LPI GYRRRPY IL+G LG    IAM T+  +     LA+   M   +      ++   
Sbjct  87   GLPIFGYRRRPYLILSGLLGTASWIAMATVVNSAWAATLAI--AMGSLSVAFSDVIVDSL  144

Query  780  CVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
             V          AG +QSLC G+S+ G L+    SGFL+    ++ VF I +  P +V L
Sbjct  145  VVERARKESVGDAGSLQSLCWGASAAGGLLTAYFSGFLLEHFSTRTVFAITATFPLIVSL  204

Query  960  VGIMIRES  983
            V  +I ES
Sbjct  205  VAWLIAES  212



>ref|XP_008796776.1| PREDICTED: folate-biopterin transporter 1, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=523

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
             +V IVY + QG+ LGLSR+++ +Y+KD+  L P+E  + +G+ SLPW++KPL+G ++D 
Sbjct  96   FAVAIVYFV-QGV-LGLSRLAVNFYLKDDLHLDPAETAVISGVSSLPWLIKPLYGFISDS  153

Query  612  LPIAGYRRRPYFILAGSLGVIA-MLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
            +P+ GYRRR Y IL+G LG  +  L  S    +  +AL  L+   +      V+    V 
Sbjct  154  IPLFGYRRRSYLILSGLLGAFSWCLMASFVDSKYGVALCILLGSLSVAFSDVVVDSMVVE  213

Query  789  ENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
                   S +G +QSLC GSS+VG ++    SG LV   G + VFG+ +  P +   V +
Sbjct  214  RARGESQSTSGSLQSLCWGSSAVGGIVSAYFSGSLVDAYGVRFVFGVTAFLPLMTSAVAV  273

Query  969  MIRE  980
            +++E
Sbjct  274  LVKE  277



>gb|KJB72219.1| hypothetical protein B456_011G165800 [Gossypium raimondii]
Length=304

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG +LGLSR+++ +Y+KD+  L P+E  + +G  SLPW+VKPL+G ++D 
Sbjct  40   VAVAMVYFV-QG-ALGLSRLAVSFYLKDDLHLDPAETALISGFSSLPWLVKPLYGFISDS  97

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y +L+G LG ++   ++        A++C++ GS  VA +DV++D+ V E
Sbjct  98   FPLFGYRRRSYLVLSGLLGALSWSLMATFVGSKYGAVVCILIGSLSVAFSDVVVDSMVVE  157

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     +++G +QSLC GSS+ G ++    SG LV   G + VFGI ++ P +   V +
Sbjct  158  RARGESQAISGSLQSLCWGSSAFGSIVSSYFSGSLVDAYGVRFVFGITALLPMITSAVAV  217

Query  969  MIRE  980
            +++E
Sbjct  218  LVKE  221



>ref|WP_017319625.1| folate/biopterin transporter [cyanobacterium PCC 7702]
Length=480

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 115/186 (62%), Gaps = 6/186 (3%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +L+V  V GI     LGL+R+++ +++KDE +L P++     GI++LPWI+KPL+G ++D
Sbjct  32   ILTVYFVQGI-----LGLARLAVSFFLKDELRLNPAQVSALLGIVALPWIIKPLFGFISD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
              PI GYRRRPY +L+G LG ++ + L+        A L +  GS  VAI+DVI+D+ V 
Sbjct  87   GFPIFGYRRRPYLVLSGILGTLSWIALATIVRTPLAATLAIAVGSLSVAISDVIVDSLVV  146

Query  789  ENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E +     + AG +QSLC G+S+ G LI    SG L+    ++ VF I +  P +V LV 
Sbjct  147  ERARGESQATAGSLQSLCWGASAFGSLITAYFSGLLLEHFSNRTVFWITACFPLIVSLVA  206

Query  966  IMIRES  983
             +I ES
Sbjct  207  WLIAES  212



>ref|XP_008796775.1| PREDICTED: folate-biopterin transporter 1, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=528

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
             +V IVY + QG+ LGLSR+++ +Y+KD+  L P+E  + +G+ SLPW++KPL+G ++D 
Sbjct  101  FAVAIVYFV-QGV-LGLSRLAVNFYLKDDLHLDPAETAVISGVSSLPWLIKPLYGFISDS  158

Query  612  LPIAGYRRRPYFILAGSLGVIA-MLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
            +P+ GYRRR Y IL+G LG  +  L  S    +  +AL  L+   +      V+    V 
Sbjct  159  IPLFGYRRRSYLILSGLLGAFSWCLMASFVDSKYGVALCILLGSLSVAFSDVVVDSMVVE  218

Query  789  ENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
                   S +G +QSLC GSS+VG ++    SG LV   G + VFG+ +  P +   V +
Sbjct  219  RARGESQSTSGSLQSLCWGSSAVGGIVSAYFSGSLVDAYGVRFVFGVTAFLPLMTSAVAV  278

Query  969  MIRE  980
            +++E
Sbjct  279  LVKE  282



>ref|WP_015139724.1| folate/biopterin transporter [Nostoc sp. PCC 7524]
 gb|AFY49294.1| folate/biopterin transporter [Nostoc sp. PCC 7524]
Length=469

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 117/186 (63%), Gaps = 6/186 (3%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +L+V  V GI     LGL+R+++ +++KDE  L P +     GI++LPWI+KP++G ++D
Sbjct  32   ILTVYFVQGI-----LGLARLAVSFFLKDELLLSPVQVSALLGIVALPWIIKPMFGFISD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LPI GYRRRPY IL+G LG I+ ++L+        A + +  GS  VA++DVI+D+ V 
Sbjct  87   GLPIFGYRRRPYLILSGLLGTISWVSLATIVHDRWAATIAIALGSLSVAVSDVIVDSLVV  146

Query  789  ENS-ISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E + +   + AG +QSLC G+S+VG LI    SG L+    ++ VFGI +  P +V  + 
Sbjct  147  ERARVESQADAGSLQSLCWGASAVGGLITAYFSGLLLEHFTTRTVFGITASFPLIVSCIA  206

Query  966  IMIRES  983
             +I ES
Sbjct  207  WLIAES  212



>gb|KJB72217.1| hypothetical protein B456_011G165800 [Gossypium raimondii]
Length=335

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG +LGLSR+++ +Y+KD+  L P+E  + +G  SLPW+VKPL+G ++D 
Sbjct  91   VAVAMVYFV-QG-ALGLSRLAVSFYLKDDLHLDPAETALISGFSSLPWLVKPLYGFISDS  148

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y +L+G LG ++   ++        A++C++ GS  VA +DV++D+ V E
Sbjct  149  FPLFGYRRRSYLVLSGLLGALSWSLMATFVGSKYGAVVCILIGSLSVAFSDVVVDSMVVE  208

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     +++G +QSLC GSS+ G ++    SG LV   G + VFGI ++ P +   V +
Sbjct  209  RARGESQAISGSLQSLCWGSSAFGSIVSSYFSGSLVDAYGVRFVFGITALLPMITSAVAV  268

Query  969  MIRE  980
            +++E
Sbjct  269  LVKE  272



>ref|XP_003536528.1| PREDICTED: folate-biopterin transporter 1, chloroplastic-like 
isoform X1 [Glycine max]
Length=554

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 139/239 (58%), Gaps = 11/239 (5%)
 Frame = +3

Query  276  NRIGGIMGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYG  455
            +RIG   G D+   L  ++  E  S+      + +      KL  V      ++V +VY 
Sbjct  74   SRIGA--GTDDGDALTTETDPEVSSSSRIAARKNKYRTSSIKLFGVELSPDNVAVAMVYF  131

Query  456  INQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRR  635
            + QG+ LGL+R+++ +Y+KD+  L P+EA + +G  +LPW+VKPL+G ++D +P+ GYRR
Sbjct  132  V-QGV-LGLARLAVNFYLKDDLHLDPAEAAVLSGFSALPWLVKPLYGFISDSVPLFGYRR  189

Query  636  RPYFILAGSLGVIA---MLTLSMNQLRIELALLCLMagsagvaiadviidaCVTENSISH  806
            R Y +L+G LG ++   M T   N+     A  C++ GS  VA +DV++D+ V E +   
Sbjct  190  RSYLVLSGLLGALSWSLMATFVDNKYS---AGFCILLGSLSVAFSDVVVDSMVVERARGE  246

Query  807  P-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
              S +G +QSLC GSS+ G ++    SG L+   G + VFG+ S+ P +  +V ++++E
Sbjct  247  SQSTSGSLQSLCWGSSAFGGIVSSYFSGSLLDAYGVRFVFGVTSLLPLITSVVAVLVKE  305



>gb|KHN02722.1| hypothetical protein glysoja_015964 [Glycine soja]
Length=507

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 139/239 (58%), Gaps = 11/239 (5%)
 Frame = +3

Query  276  NRIGGIMGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYG  455
            +RIG   G D+   L  ++  E  S+      + +      KL  V      ++V +VY 
Sbjct  27   SRIGA--GTDDGDALTTETDPEVSSSSRIAARKNKYRTSSIKLFGVELSPDNVAVAMVYF  84

Query  456  INQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRR  635
            + QG+ LGL+R+++ +Y+KD+  L P+EA + +G  +LPW+VKPL+G ++D +P+ GYRR
Sbjct  85   V-QGV-LGLARLAVNFYLKDDLHLDPAEAAVLSGFSALPWLVKPLYGFISDSVPLFGYRR  142

Query  636  RPYFILAGSLGVIA---MLTLSMNQLRIELALLCLMagsagvaiadviidaCVTENSISH  806
            R Y +L+G LG ++   M T   N+     A  C++ GS  VA +DV++D+ V E +   
Sbjct  143  RSYLVLSGLLGALSWSLMATFVDNKYS---AGFCILLGSLSVAFSDVVVDSMVVERARGE  199

Query  807  P-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
              S +G +QSLC GSS+ G ++    SG L+   G + VFG+ S+ P +  +V ++++E
Sbjct  200  SQSTSGSLQSLCWGSSAFGGIVSSYFSGSLLDAYGVRFVFGVTSLLPLITSVVAVLVKE  258



>ref|WP_036006254.1| folate-biopterin transporter, partial [Leptolyngbya sp. JSC-1]
Length=454

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  435  SVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVL  614
            ++++VY + QG+ LGL+R+++ +++KDE  L P++   F GI +LPW++KPL+G ++D L
Sbjct  31   AILLVYFV-QGI-LGLARLAVSFFLKDELGLSPAQVSAFMGIAALPWMIKPLFGFISDGL  88

Query  615  PIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTEN  794
            PI GYRRRPY IL+G LG +A + L+        A + +  GS  VA +DVI+D+ V E 
Sbjct  89   PILGYRRRPYLILSGLLGTLAWVMLATVVHTAWAATVAIALGSLSVAFSDVIVDSLVVER  148

Query  795  SISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIM  971
            +       AG +QS+C G++++G LI    SGFL+    ++ VFGI +  P ++ LV   
Sbjct  149  ARQESVQEAGSLQSICWGATALGGLITAYFSGFLLEHFSNRIVFGITATFPLIISLVAWW  208

Query  972  IRES  983
            I ES
Sbjct  209  ISES  212



>gb|KCW84213.1| hypothetical protein EUGRSUZ_B01079 [Eucalyptus grandis]
Length=381

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 134/236 (57%), Gaps = 3/236 (1%)
 Frame = +3

Query  276  NRIGGIMGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYG  455
            +R+   MG      L     KE  ++      + + +    K   V      ++V +VY 
Sbjct  19   DRLLNYMGAGNGDTLTANDDKETSTSSRNVLRKKKSYTSSIKFFGVDLSPDNIAVAMVYF  78

Query  456  INQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRR  635
            + QG+ LGL+R+++ +Y+KD+  L P+E  + +G  +LPW+VKPL+G ++D +P+ GYRR
Sbjct  79   V-QGV-LGLARLAVSFYLKDDLHLDPAETAVISGFSALPWLVKPLYGFISDSVPLFGYRR  136

Query  636  RPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTENSISHP-S  812
            R Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E +     S
Sbjct  137  RSYLVLSGLLGALSWSLMATFVDSKYGAAFCILLGSLSVAFSDVVVDSMVVERARGESQS  196

Query  813  LAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            +AG +QSLC GSS+ G ++    SG LV L G + VFG+ ++ P +   V ++++E
Sbjct  197  MAGSLQSLCWGSSAFGGIVSSYFSGSLVDLYGVRFVFGLTALLPLITSAVAVLVKE  252



>ref|WP_006278630.1| Biopterin transport-related protein BT1 [Cylindrospermopsis raciborskii]
 gb|EFA68559.1| Biopterin transport-related protein BT1 [Cylindrospermopsis raciborskii 
CS-505]
Length=451

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 114/186 (61%), Gaps = 6/186 (3%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +L+V +V G     +LGLSR+S+ +++KDE +L P E     GI++LPW++KPL+G ++D
Sbjct  36   ILAVYLVQG-----ALGLSRLSVSFFLKDELQLSPVEVSAILGIVTLPWMIKPLFGFVSD  90

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
              PI GYRRRPY IL+G LG  + + L+        A + +   S  +A++DVI+D+ V 
Sbjct  91   TFPIFGYRRRPYLILSGILGAASWIALATLVDSTWKATITVTLSSLAIAVSDVIVDSLVV  150

Query  789  ENS-ISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E + +   S AG +QSLC G++++G  +    SG ++    +K VF I ++ P L+ LV 
Sbjct  151  ERARLESHSKAGSLQSLCWGATALGSFLTAYFSGLVLEYFTTKTVFLITALFPLLISLVA  210

Query  966  IMIRES  983
              I E+
Sbjct  211  WFITET  216



>ref|XP_006589593.1| PREDICTED: folate-biopterin transporter 1, chloroplastic-like 
isoform X2 [Glycine max]
Length=552

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 139/239 (58%), Gaps = 11/239 (5%)
 Frame = +3

Query  276  NRIGGIMGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYG  455
            +RIG   G D+   L  ++  E  S+      + +      KL  V      ++V +VY 
Sbjct  74   SRIGA--GTDDGDALTTETDPEVSSSSRIAARKNKYRTSSIKLFGVELSPDNVAVAMVYF  131

Query  456  INQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRR  635
            + QG+ LGL+R+++ +Y+KD+  L P+EA + +G  +LPW+VKPL+G ++D +P+ GYRR
Sbjct  132  V-QGV-LGLARLAVNFYLKDDLHLDPAEAAVLSGFSALPWLVKPLYGFISDSVPLFGYRR  189

Query  636  RPYFILAGSLGVIA---MLTLSMNQLRIELALLCLMagsagvaiadviidaCVTENSISH  806
            R Y +L+G LG ++   M T   N+     A  C++ GS  VA +DV++D+ V E +   
Sbjct  190  RSYLVLSGLLGALSWSLMATFVDNKYS---AGFCILLGSLSVAFSDVVVDSMVVERARGE  246

Query  807  P-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
              S +G +QSLC GSS+ G ++    SG L+   G + VFG+ S+ P +  +V ++++E
Sbjct  247  SQSTSGSLQSLCWGSSAFGGIVSSYFSGSLLDAYGVRFVFGVTSLLPLITSVVAVLVKE  305



>ref|WP_045874458.1| folate-biopterin transporter [Tolypothrix sp. PCC 7601]
 gb|EKE97059.1| FBT family folate-biopterin [Tolypothrix sp. PCC 7601]
Length=475

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 116/186 (62%), Gaps = 6/186 (3%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +L+V  V GI     LGL+R+++ +++KDE  L P++     GI++LPWI+KP++G ++D
Sbjct  32   ILTVYFVQGI-----LGLARLAVSFFLKDELLLSPTQVSALLGIVALPWIIKPVFGFISD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LPI GYRRRPY IL+G LG I+ ++L+        A L +  GS  VA++DVI+D+ V 
Sbjct  87   GLPIFGYRRRPYLILSGILGTISWVSLATLVHTTWAATLAIALGSLSVAVSDVIVDSLVV  146

Query  789  ENSISHPSL-AGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E + +     AG +QS+C G+S+ G LI    SG+L+    +  VF I ++ P LV  V 
Sbjct  147  ERARAESQADAGSLQSICWGASAFGGLITAYFSGWLLEHFSTHTVFWITAIFPLLVSAVA  206

Query  966  IMIRES  983
             +I ES
Sbjct  207  WLIAES  212



>ref|WP_044207339.1| folate-biopterin transporter, partial [Coleofasciculus chthonoplastes]
Length=480

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 120/185 (65%), Gaps = 3/185 (2%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +++++IVY + QG+ LGL+R++I +++KDE  L P++     GI +LPW++KPL+G L+D
Sbjct  29   LIAILIVYFV-QGI-LGLARLAISFFLKDELGLSPAQVAALIGIAALPWVIKPLFGFLSD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LP+ GYRRRPY +L+G +G  A L+L+        A L ++  S  VAI+DVI+D+ V 
Sbjct  87   GLPLFGYRRRPYLVLSGLMGTAAWLSLATVVHTAWAATLAILLSSLSVAISDVIVDSLVV  146

Query  789  ENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E +     S +G +QSL  G+S+VG +I   +SG+L+    ++ VFGI +  P LV  V 
Sbjct  147  ERARRESLSNSGSLQSLTWGTSAVGGVITAYLSGWLLEAFNTQTVFGITATFPLLVSGVA  206

Query  966  IMIRE  980
             +I E
Sbjct  207  WLIAE  211



>ref|WP_036021064.1| folate-biopterin transporter, partial [Leptolyngbya sp. PCC 7375]
Length=433

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 116/183 (63%), Gaps = 3/183 (2%)
 Frame = +3

Query  435  SVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVL  614
            ++++VY + QG+ LGL+R++I +++KD+  L P+E    TGI SLPW +KPL+G L+D L
Sbjct  30   AILLVYFV-QGI-LGLARLAISFFLKDDLGLSPAEVAALTGIASLPWTIKPLFGFLSDGL  87

Query  615  PIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTEN  794
            P+ GYRRRPY +L+G +G  A LTL+       LA   ++  S  VAIADVI+D+ V E 
Sbjct  88   PVIGYRRRPYLVLSGVMGTAAWLTLATLANTAWLATTMILLSSLSVAIADVIVDSLVVER  147

Query  795  SISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIM  971
            +     S  G +QSLC G+S++G ++   + G L+    ++ VF + +  P +V +V  +
Sbjct  148  ARQESQSEVGTLQSLCWGASALGGVLTAYLGGLLLEQTSTRVVFAVTATFPLIVSVVAWL  207

Query  972  IRE  980
            I E
Sbjct  208  IAE  210



>gb|KJB72218.1| hypothetical protein B456_011G165800 [Gossypium raimondii]
Length=355

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG +LGLSR+++ +Y+KD+  L P+E  + +G  SLPW+VKPL+G ++D 
Sbjct  91   VAVAMVYFV-QG-ALGLSRLAVSFYLKDDLHLDPAETALISGFSSLPWLVKPLYGFISDS  148

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y +L+G LG ++   ++        A++C++ GS  VA +DV++D+ V E
Sbjct  149  FPLFGYRRRSYLVLSGLLGALSWSLMATFVGSKYGAVVCILIGSLSVAFSDVVVDSMVVE  208

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     +++G +QSLC GSS+ G ++    SG LV   G + VFGI ++ P +   V +
Sbjct  209  RARGESQAISGSLQSLCWGSSAFGSIVSSYFSGSLVDAYGVRFVFGITALLPMITSAVAV  268

Query  969  MIRE  980
            +++E
Sbjct  269  LVKE  272



>gb|EKV02548.1| folate/biopterin transporter [Leptolyngbya sp. PCC 7375]
Length=462

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 116/183 (63%), Gaps = 3/183 (2%)
 Frame = +3

Query  435  SVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVL  614
            ++++VY + QG+ LGL+R++I +++KD+  L P+E    TGI SLPW +KPL+G L+D L
Sbjct  30   AILLVYFV-QGI-LGLARLAISFFLKDDLGLSPAEVAALTGIASLPWTIKPLFGFLSDGL  87

Query  615  PIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTEN  794
            P+ GYRRRPY +L+G +G  A LTL+       LA   ++  S  VAIADVI+D+ V E 
Sbjct  88   PVIGYRRRPYLVLSGVMGTAAWLTLATLANTAWLATTMILLSSLSVAIADVIVDSLVVER  147

Query  795  SISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIM  971
            +     S  G +QSLC G+S++G ++   + G L+    ++ VF + +  P +V +V  +
Sbjct  148  ARQESQSEVGTLQSLCWGASALGGVLTAYLGGLLLEQTSTRVVFAVTATFPLIVSVVAWL  207

Query  972  IRE  980
            I E
Sbjct  208  IAE  210



>ref|XP_010045835.1| PREDICTED: folate-biopterin transporter 1, chloroplastic-like, 
partial [Eucalyptus grandis]
Length=373

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGL+R+++ +Y+KD+  L P+E  + +G  +LPW+VKPL+G ++D 
Sbjct  63   IAVAMVYFV-QGV-LGLARLAVSFYLKDDLHLDPAETAVISGFSALPWLVKPLYGFISDS  120

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
            +P+ GYRRR Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  121  VPLFGYRRRSYLVLSGLLGALSWSLMATFVDSKYGAAFCILLGSLSVAFSDVVVDSMVVE  180

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S+AG +QSLC GSS+ G ++    SG LV L G + VFG+ ++ P +   V +
Sbjct  181  RARGESQSMAGSLQSLCWGSSAFGGIVSSYFSGSLVDLYGVRFVFGLTALLPLITSAVAV  240

Query  969  MIRE  980
            +++E
Sbjct  241  LVKE  244



>ref|WP_039895397.1| folate-biopterin transporter [Lyngbya sp. PCC 8106]
Length=470

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 119/186 (64%), Gaps = 3/186 (2%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            ++++++VY + QG+ LGL+R+++ +++KD+  + P+E     GI+ LPW++KPL+G L+D
Sbjct  29   LIAILLVYFV-QGI-LGLARLAVSFFLKDDLGMTPAEVSAMLGIVVLPWVIKPLFGFLSD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LP+ GYRRRPY IL+G LG IA + ++        A L +   S  VAI+DVI+D+ V 
Sbjct  87   GLPLFGYRRRPYLILSGFLGAIAWIAMATVVDSPLTATLVITLSSLSVAISDVIVDSLVV  146

Query  789  ENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E +     S  G +QSLC GSS++G LI   +SGFL+ ++  K VF I +  P +V  V 
Sbjct  147  ERARKESLSDVGSLQSLCWGSSALGGLITAYLSGFLLEIVTVKTVFLITASFPLIVCGVA  206

Query  966  IMIRES  983
             +I E 
Sbjct  207  WLITEE  212



>gb|KCW80542.1| hypothetical protein EUGRSUZ_C01894 [Eucalyptus grandis]
Length=404

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 114/189 (60%), Gaps = 41/189 (22%)
 Frame = +3

Query  414  LHWSFVLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLW  593
            +HWSFVL V IVYGI+QGL   LS ++ +YY+KD QK+QPSE                  
Sbjct  6    MHWSFVLGVAIVYGISQGLGGALSDVATKYYIKDFQKVQPSEL-----------------  48

Query  594  GLLTDVLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadvii  773
                                 G LGV +ML LS  ++ + LAL+ L AG+AGVAIADV+I
Sbjct  49   ---------------------GFLGVFSMLVLSFYKVHLVLALVLLTAGTAGVAIADVVI  87

Query  774  daCVTENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLV  953
            DACV +NSISHPSLA DMQSLC  S S G L+G++ISG  VH     GVF +L++P  LV
Sbjct  88   DACVAQNSISHPSLAADMQSLCALSESTGGLVGFVISGIFVH---RWGVFALLTIPAGLV  144

Query  954  VLVGIMIRE  980
            +L+G ++ E
Sbjct  145  LLLGSILDE  153



>ref|XP_002953783.1| hypothetical protein VOLCADRAFT_64019 [Volvox carteri f. nagariensis]
 gb|EFJ45107.1| hypothetical protein VOLCADRAFT_64019 [Volvox carteri f. nagariensis]
Length=499

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 114/183 (62%), Gaps = 3/183 (2%)
 Frame = +3

Query  435  SVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVL  614
            S+  VY + QG+ LGLSR+++ Y+ KDE  ++P+E  + TG+ S+PW++KPL+G ++D +
Sbjct  37   SMAAVYFV-QGI-LGLSRLAVSYFFKDELHIEPAEVAVLTGLSSIPWMIKPLYGFISDSI  94

Query  615  PIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTEN  794
            P+ GYRRR Y +L G +G +A   L+        A+ C++  S G A +DV++D+ V E 
Sbjct  95   PLFGYRRRSYLVLCGLMGTLAWSILAYGVHDARGAVACMLLASLGTAASDVVVDSIVVER  154

Query  795  SIS-HPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIM  971
            +   H S+AG +QSLC  S++VG +     SG  V   G++ VFG+ +  P +V    I+
Sbjct  155  TRGHHQSVAGSLQSLCWASAAVGGITSAYFSGSFVQDYGTRFVFGLTAFFPLVVSASSIL  214

Query  972  IRE  980
            I E
Sbjct  215  INE  217



>gb|EDX75389.1| folate/biopterin transporter subfamily [Coleofasciculus chthonoplastes 
PCC 7420]
Length=507

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 120/185 (65%), Gaps = 3/185 (2%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +++++IVY + QG+ LGL+R++I +++KDE  L P++     GI +LPW++KPL+G L+D
Sbjct  29   LIAILIVYFV-QGI-LGLARLAISFFLKDELGLSPAQVAALIGIAALPWVIKPLFGFLSD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LP+ GYRRRPY +L+G +G  A L+L+        A L ++  S  VAI+DVI+D+ V 
Sbjct  87   GLPLFGYRRRPYLVLSGLMGTAAWLSLATVVHTAWAATLAILLSSLSVAISDVIVDSLVV  146

Query  789  ENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E +     S +G +QSL  G+S+VG +I   +SG+L+    ++ VFGI +  P LV  V 
Sbjct  147  ERARRESLSNSGSLQSLTWGTSAVGGVITAYLSGWLLEAFNTQTVFGITATFPLLVSGVA  206

Query  966  IMIRE  980
             +I E
Sbjct  207  WLIAE  211



>ref|XP_007034792.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY05718.1| Major facilitator superfamily protein isoform 4 [Theobroma cacao]
Length=378

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGLSR+++ +Y+KD+  L P+E  + +G  +LPW+VKPL+G ++D 
Sbjct  127  VAVAMVYFV-QGV-LGLSRLAVSFYLKDDLHLDPAETAVISGFSALPWLVKPLYGFISDS  184

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
            +P+ GYRRR Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  185  IPLFGYRRRSYLVLSGLLGALSWSLMATFVDSKYSAAFCILLGSLSVAFSDVVVDSMVVE  244

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S++G +QSLC GSS+ G ++    SG LV   G + VFG+ ++ P +   V +
Sbjct  245  RARGESQSMSGSLQSLCWGSSAFGGIVSSYFSGSLVDTYGVRFVFGVTALLPLITSAVAV  304

Query  969  MIRE  980
            +++E
Sbjct  305  LVKE  308



>gb|KCW45779.1| hypothetical protein EUGRSUZ_L003921, partial [Eucalyptus grandis]
Length=404

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGL+R+++ +Y+KD+  L P+E  + +G  +LPW+VKPL+G ++D 
Sbjct  71   IAVAMVYFV-QGV-LGLARLAVSFYLKDDLHLDPAETAVISGFSALPWLVKPLYGFISDS  128

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
            +P+ GYRRR Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  129  VPLFGYRRRSYLVLSGLLGALSWSLMATFVDSKYGAAFCILLGSLSVAFSDVVVDSMVVE  188

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S+AG +QSLC GSS+ G ++    SG LV L G + VFG+ ++ P +   V +
Sbjct  189  RARGESQSMAGSLQSLCWGSSAFGGIVSSYFSGSLVDLYGVRFVFGLTALLPLITSAVAV  248

Query  969  MIRE  980
            +++E
Sbjct  249  LVKE  252



>ref|XP_007034791.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY05717.1| Major facilitator superfamily protein isoform 3 [Theobroma cacao]
Length=391

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGLSR+++ +Y+KD+  L P+E  + +G  +LPW+VKPL+G ++D 
Sbjct  127  VAVAMVYFV-QGV-LGLSRLAVSFYLKDDLHLDPAETAVISGFSALPWLVKPLYGFISDS  184

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
            +P+ GYRRR Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  185  IPLFGYRRRSYLVLSGLLGALSWSLMATFVDSKYSAAFCILLGSLSVAFSDVVVDSMVVE  244

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S++G +QSLC GSS+ G ++    SG LV   G + VFG+ ++ P +   V +
Sbjct  245  RARGESQSMSGSLQSLCWGSSAFGGIVSSYFSGSLVDTYGVRFVFGVTALLPLITSAVAV  304

Query  969  MIRE  980
            +++E
Sbjct  305  LVKE  308



>ref|XP_009409836.1| PREDICTED: folate-biopterin transporter 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=526

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 117/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
             +V IVY + QG+ LGL+R+++ +Y+KD+  L P+E  + TG+ SLPW++KP++G ++D 
Sbjct  99   FAVAIVYFV-QGV-LGLARLAVNFYLKDDLHLDPAETAVVTGLSSLPWLIKPVYGFISDS  156

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y  L+G LG ++   ++M       A LC++ GS  VA +DV++D+ V E
Sbjct  157  FPLFGYRRRSYLFLSGLLGALSWSLMAMFVDSKYSAGLCILLGSLSVAFSDVVVDSMVVE  216

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S +G +QSLC GSS+ G ++    SG LV+  G + VFGI +  P +   V I
Sbjct  217  RARGESQSTSGSLQSLCWGSSAFGGIVSAYFSGSLVNKYGVRYVFGITAFLPLMTSAVAI  276

Query  969  MIRE  980
            +++E
Sbjct  277  LVKE  280



>ref|NP_001051544.1| Os03g0795000 [Oryza sativa Japonica Group]
 dbj|BAF13458.1| Os03g0795000, partial [Oryza sativa Japonica Group]
Length=464

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 122/187 (65%), Gaps = 9/187 (5%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V IVY + QG+ LGL+R+++ +Y+KD+  L P+E  + +G+ +LPW+VKPL+G ++D 
Sbjct  41   VAVAIVYFV-QGV-LGLARLAVSFYLKDDLHLDPAETAVISGLSALPWLVKPLYGFISDS  98

Query  612  LPIAGYRRRPYFILAGSLGVIA---MLTLSMNQLRIELALLCLMagsagvaiadviidaC  782
            +P+ GYRRR Y IL+G LG ++   M T+  ++     A L ++ GS  VAIADV++D+ 
Sbjct  99   IPLFGYRRRSYLILSGLLGALSWSLMATIVDDKYS---AALSIILGSLAVAIADVVVDSM  155

Query  783  VTENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVL  959
            V E +   P S +G +QSLC GSS++G ++    SG LV   G + VFG+ +  P +   
Sbjct  156  VVERARGEPQSTSGSLQSLCWGSSAIGGVMSAYFSGSLVDTYGVRFVFGVTAFLPLMTST  215

Query  960  VGIMIRE  980
            V +++ E
Sbjct  216  VAVLVNE  222



>ref|XP_011071603.1| PREDICTED: folate-biopterin transporter 1, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=491

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGLSR+++ +Y+KD+  L P+E  + +GI SLPW+VKPL+G ++D 
Sbjct  61   IAVAMVYFV-QGV-LGLSRLAVSFYLKDDLHLDPAETAVVSGISSLPWLVKPLYGFISDS  118

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y +L+G LG I+   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  119  FPLFGYRRRSYLVLSGLLGAISWSLMATFVDSKYGAAFCILLGSLSVAFSDVVVDSMVVE  178

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S++G +QSLC GSS+ G ++    SG LV   G + VFG+ S+ P +   V +
Sbjct  179  RARGESQSMSGSLQSLCWGSSAFGGILSSYFSGSLVDAYGVRFVFGLTSLLPLITSAVAV  238

Query  969  MIRE  980
            +++E
Sbjct  239  LVKE  242



>ref|WP_023071720.1| folate biopterin transporter [Leptolyngbya sp. Heron Island J]
 gb|ESA37545.1| folate biopterin transporter [Leptolyngbya sp. Heron Island J]
Length=462

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 118/186 (63%), Gaps = 3/186 (2%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            ++++++VY + QG+ LGL+R+++ +++KDE  L P+E    TGI SLPW +KP++G L+D
Sbjct  28   LIAILLVYFV-QGI-LGLARLAVSFFLKDELGLSPAEVAALTGIASLPWTIKPIFGFLSD  85

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LPI GYRRRPY IL+G +G  A L L++      LA   ++  S  VAIADVI+D+ V 
Sbjct  86   GLPIIGYRRRPYLILSGLMGTTAWLLLAIWVRTAWLATAMILLSSLSVAIADVIVDSLVV  145

Query  789  ENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E +     S AG +QSL  G+S++G L+   + G L+    ++ VF + +  P +V +V 
Sbjct  146  ERARQESQSEAGTLQSLSWGASAIGGLLTAYLGGLLLEQTSTRTVFMVTATFPLIVAVVA  205

Query  966  IMIRES  983
             +I E 
Sbjct  206  WLITED  211



>ref|XP_011071602.1| PREDICTED: folate-biopterin transporter 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=559

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGLSR+++ +Y+KD+  L P+E  + +GI SLPW+VKPL+G ++D 
Sbjct  129  IAVAMVYFV-QGV-LGLSRLAVSFYLKDDLHLDPAETAVVSGISSLPWLVKPLYGFISDS  186

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y +L+G LG I+   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  187  FPLFGYRRRSYLVLSGLLGAISWSLMATFVDSKYGAAFCILLGSLSVAFSDVVVDSMVVE  246

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S++G +QSLC GSS+ G ++    SG LV   G + VFG+ S+ P +   V +
Sbjct  247  RARGESQSMSGSLQSLCWGSSAFGGILSSYFSGSLVDAYGVRFVFGLTSLLPLITSAVAV  306

Query  969  MIRE  980
            +++E
Sbjct  307  LVKE  310



>ref|WP_036485304.1| folate-biopterin transporter [Myxosarcina sp. GI1]
Length=492

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 108/186 (58%), Gaps = 8/186 (4%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +L+V  V GI     LGL+R+++ +++KD+  L P+E    TGI SLPWI+KP++G L+D
Sbjct  32   ILTVYFVQGI-----LGLARLAVSFFLKDDLGLSPAEVAALTGIASLPWIIKPVFGFLSD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LP+ GYRRRPY IL+G LG  +   L+ N +   L    ++  ++       +I   + 
Sbjct  87   GLPLFGYRRRPYLILSGLLGSASWWALA-NLVHSGLQATAVILLTSLSVAIGDVIVDSLV  145

Query  789  ENSISHPSL--AGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLV  962
               +   SL  AG +QSLC G+S++G LI   +SG+L+    +  VF I +  P LV +V
Sbjct  146  VERVRKESLGRAGSLQSLCWGTSAIGGLITAYLSGWLLQHFSNSAVFEITATFPLLVAIV  205

Query  963  GIMIRE  980
              +I E
Sbjct  206  AWLISE  211



>gb|KJB38164.1| hypothetical protein B456_006G240100 [Gossypium raimondii]
Length=350

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGL+R+++ +Y+KD+  L P+E  + TG  +LPW+VKPL+G ++D 
Sbjct  65   VAVAMVYFV-QGV-LGLARLAVSFYLKDDLHLDPAETAVVTGFSALPWLVKPLYGFISDS  122

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
            +P+ GYRRR Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  123  IPLFGYRRRSYLVLSGLLGALSWSLMATFVDSKYGAACCILLGSFSVAFSDVVVDSMVVE  182

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             S     S++G +QSLC GSS+ G ++    SG LV   G + VFG+ ++ P +   V +
Sbjct  183  RSRGESQSVSGSLQSLCWGSSAFGGIVSSYFSGSLVDAYGVRFVFGVTALLPLITSAVAV  242

Query  969  MIRE  980
            +++E
Sbjct  243  LVKE  246



>gb|KJB38166.1| hypothetical protein B456_006G240100 [Gossypium raimondii]
Length=329

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGL+R+++ +Y+KD+  L P+E  + TG  +LPW+VKPL+G ++D 
Sbjct  65   VAVAMVYFV-QGV-LGLARLAVSFYLKDDLHLDPAETAVVTGFSALPWLVKPLYGFISDS  122

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
            +P+ GYRRR Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  123  IPLFGYRRRSYLVLSGLLGALSWSLMATFVDSKYGAACCILLGSFSVAFSDVVVDSMVVE  182

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             S     S++G +QSLC GSS+ G ++    SG LV   G + VFG+ ++ P +   V +
Sbjct  183  RSRGESQSVSGSLQSLCWGSSAFGGIVSSYFSGSLVDAYGVRFVFGVTALLPLITSAVAV  242

Query  969  MIRE  980
            +++E
Sbjct  243  LVKE  246



>ref|WP_033336585.1| folate-biopterin transporter, partial [Scytonema hofmanni]
Length=446

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 106/186 (57%), Gaps = 6/186 (3%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +L+V  V GI     LGL+R+++ +++KDE  L P++     GI++LPWI+KPL+G ++D
Sbjct  32   ILTVYFVQGI-----LGLARLAVSFFLKDELGLTPAQVSAMLGIVALPWIIKPLFGFISD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTL-SMNQLRIELALLCLMagsagvaiadviidaCV  785
             LPI GYRRRPY +L+G LG I+ ++L ++    I   L   +   +      ++    V
Sbjct  87   GLPIFGYRRRPYLVLSGILGAISWVSLATIVHTPIAATLAIALGSLSVAVSDVIVDSLVV  146

Query  786  TENSISHPSLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
                    + AG +QSL  G+S++G LI    SGFL+    ++ VF I +  P +V  V 
Sbjct  147  ERARTESQAEAGSLQSLTWGASALGSLITAYFSGFLLQHFTTRTVFWITATFPLIVSAVA  206

Query  966  IMIRES  983
             +I ES
Sbjct  207  WLIAES  212



>ref|XP_010322256.1| PREDICTED: folate-biopterin transporter 1, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=404

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 117/184 (64%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG+ LGLS +++ +Y+KD+  L P+EA + +G  SLPW++KPL+G ++D 
Sbjct  70   IAVAMVYFV-QGV-LGLSDLAVSFYLKDDLHLDPAEAAVISGFSSLPWLIKPLYGFISDS  127

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E
Sbjct  128  FPLFGYRRRSYLVLSGLLGALSWFLMATFVDSKYGAAFCILIGSLSVAFSDVVVDSMVVE  187

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     S++G +QSLC GSS+ G +     SG LV + G + VFG+ ++ P +   V +
Sbjct  188  RARGESQSMSGSLQSLCWGSSACGGIFSSYFSGSLVEVYGVRSVFGVTALLPLITSAVSL  247

Query  969  MIRE  980
            +++E
Sbjct  248  LVKE  251



>gb|KCW84212.1| hypothetical protein EUGRSUZ_B01079 [Eucalyptus grandis]
Length=503

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 134/236 (57%), Gaps = 3/236 (1%)
 Frame = +3

Query  276  NRIGGIMGQDEAFLLEGQSQKERKSNdwtwrwrwrpfdwfrKLSDVLHWSFVLSVVIVYG  455
            +R+   MG      L     KE  ++      + + +    K   V      ++V +VY 
Sbjct  19   DRLLNYMGAGNGDTLTANDDKETSTSSRNVLRKKKSYTSSIKFFGVDLSPDNIAVAMVYF  78

Query  456  INQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDVLPIAGYRR  635
            + QG+ LGL+R+++ +Y+KD+  L P+E  + +G  +LPW+VKPL+G ++D +P+ GYRR
Sbjct  79   V-QGV-LGLARLAVSFYLKDDLHLDPAETAVISGFSALPWLVKPLYGFISDSVPLFGYRR  136

Query  636  RPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTENSISHP-S  812
            R Y +L+G LG ++   ++        A  C++ GS  VA +DV++D+ V E +     S
Sbjct  137  RSYLVLSGLLGALSWSLMATFVDSKYGAAFCILLGSLSVAFSDVVVDSMVVERARGESQS  196

Query  813  LAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGIMIRE  980
            +AG +QSLC GSS+ G ++    SG LV L G + VFG+ ++ P +   V ++++E
Sbjct  197  MAGSLQSLCWGSSAFGGIVSSYFSGSLVDLYGVRFVFGLTALLPLITSAVAVLVKE  252



>ref|WP_015209880.1| folate/biopterin transporter [Cylindrospermum stagnale]
 gb|AFZ26641.1| folate/biopterin transporter [Cylindrospermum stagnale PCC 7417]
Length=452

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 116/186 (62%), Gaps = 6/186 (3%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            +LSV  V GI     LGL+R+++ +++KDE  L P +     GI++LPW++KPL+G ++D
Sbjct  32   ILSVYFVQGI-----LGLARLAVSFFLKDELLLSPVQVSALLGIVALPWMIKPLYGFVSD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LPI GYRRRPY +L+G LG  A L+L+        A + +  GS  VA++DVI+D+ V 
Sbjct  87   GLPIFGYRRRPYLVLSGILGAAAWLSLATIVHTSWAAAIAIALGSLSVAVSDVIVDSLVV  146

Query  789  ENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E + +   + AG +QSLC G+S++G LI    SG L+    ++ VF I ++ P +V  V 
Sbjct  147  ERARAESLASAGSLQSLCWGASAIGGLITAYFSGLLLEHFTTRTVFWITALFPLIVSAVA  206

Query  966  IMIRES  983
             +I E+
Sbjct  207  WLIAET  212



>ref|WP_040483765.1| folate-biopterin transporter [Lyngbya aestuarii]
Length=470

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +3

Query  429  VLSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTD  608
            ++++++VY + QG+ LGL+R+++ +++KD+  + P+E     GI+ LPW++KPL+G L+D
Sbjct  29   LIAILLVYFV-QGI-LGLARLAVSFFLKDDLGMTPAEVSAMLGIVVLPWVIKPLFGFLSD  86

Query  609  VLPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVT  788
             LP+ GYRRRPY IL+G LG IA + ++        A L +   S  VAI+DVI+D+ V 
Sbjct  87   GLPLFGYRRRPYLILSGFLGAIAWIGMATVVDSPLTATLVITLSSLSVAISDVIVDSLVV  146

Query  789  ENSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVG  965
            E +     S  G +QSLC GSS++G LI   +SGFL+ ++  K VF I +  P +V  V 
Sbjct  147  ERARKESLSDVGSLQSLCWGSSALGGLITAYLSGFLLEIVTVKTVFLITASFPLIVCGVA  206

Query  966  IMIRE  980
             +I E
Sbjct  207  WLITE  211



>gb|KJB72220.1| hypothetical protein B456_011G165800 [Gossypium raimondii]
Length=470

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = +3

Query  432  LSVVIVYGINQGLSLGLSRISIQYYMKDEQKLQPSEAQIFTGIISLPWIVKPLWGLLTDV  611
            ++V +VY + QG +LGLSR+++ +Y+KD+  L P+E  + +G  SLPW+VKPL+G ++D 
Sbjct  40   VAVAMVYFV-QG-ALGLSRLAVSFYLKDDLHLDPAETALISGFSSLPWLVKPLYGFISDS  97

Query  612  LPIAGYRRRPYFILAGSLGVIAMLTLSMNQLRIELALLCLMagsagvaiadviidaCVTE  791
             P+ GYRRR Y +L+G LG ++   ++        A++C++ GS  VA +DV++D+ V E
Sbjct  98   FPLFGYRRRSYLVLSGLLGALSWSLMATFVGSKYGAVVCILIGSLSVAFSDVVVDSMVVE  157

Query  792  NSISHP-SLAGDMQSLCGGSSSVGQLIGYMISGFLVHLIGSKGVFGILSMPPSLVVLVGI  968
             +     +++G +QSLC GSS+ G ++    SG LV   G + VFGI ++ P +   V +
Sbjct  158  RARGESQAISGSLQSLCWGSSAFGSIVSSYFSGSLVDAYGVRFVFGITALLPMITSAVAV  217

Query  969  MIRE  980
            +++E
Sbjct  218  LVKE  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2448168820380