BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11467

Length=826
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361429.1|  PREDICTED: putative glucuronosyltransferase ...    299   5e-94   Solanum tuberosum [potatoes]
ref|XP_006361430.1|  PREDICTED: putative glucuronosyltransferase ...    299   5e-94   Solanum tuberosum [potatoes]
ref|XP_004236792.1|  PREDICTED: inositol phosphorylceramide glucu...    295   1e-92   Solanum lycopersicum
ref|XP_010319283.1|  PREDICTED: inositol phosphorylceramide glucu...    295   1e-92   Solanum lycopersicum
ref|XP_009779488.1|  PREDICTED: putative glucuronosyltransferase ...    291   3e-91   Nicotiana sylvestris
gb|KDP23737.1|  hypothetical protein JCGZ_23570                         291   8e-91   Jatropha curcas
ref|XP_004239742.1|  PREDICTED: inositol phosphorylceramide glucu...    290   1e-90   Solanum lycopersicum
ref|XP_009606765.1|  PREDICTED: putative glucuronosyltransferase ...    290   1e-90   Nicotiana tomentosiformis
ref|XP_006346008.1|  PREDICTED: putative glucuronosyltransferase ...    290   2e-90   Solanum tuberosum [potatoes]
ref|XP_006437461.1|  hypothetical protein CICLE_v10031149mg             285   2e-90   
emb|CAN77613.1|  hypothetical protein VITISV_036932                     290   4e-90   Vitis vinifera
ref|XP_002266145.1|  PREDICTED: inositol phosphorylceramide glucu...    289   6e-90   Vitis vinifera
gb|KDO49229.1|  hypothetical protein CISIN_1g008931mg                   283   2e-89   Citrus sinensis [apfelsine]
ref|XP_009599298.1|  PREDICTED: putative glucuronosyltransferase ...    287   2e-89   Nicotiana tomentosiformis
ref|XP_007030331.1|  Plant glycogenin-like starch initiation prot...    286   2e-89   
ref|XP_007030330.1|  Plant glycogenin-like starch initiation prot...    286   4e-89   
gb|KJB82307.1|  hypothetical protein B456_013G188300                    282   6e-89   Gossypium raimondii
gb|KHG12487.1|  Glycogenin-1                                            286   9e-89   Gossypium arboreum [tree cotton]
ref|XP_006437460.1|  hypothetical protein CICLE_v10031149mg             286   9e-89   Citrus clementina [clementine]
ref|XP_002319122.1|  hypothetical protein POPTR_0013s04660g             285   1e-88   Populus trichocarpa [western balsam poplar]
ref|XP_006484615.1|  PREDICTED: putative glucuronosyltransferase ...    285   1e-88   Citrus sinensis [apfelsine]
ref|XP_012089482.1|  PREDICTED: inositol phosphorylceramide glucu...    291   1e-88   
ref|XP_011038458.1|  PREDICTED: inositol phosphorylceramide glucu...    285   3e-88   Populus euphratica
ref|XP_011038459.1|  PREDICTED: inositol phosphorylceramide glucu...    284   3e-88   Populus euphratica
ref|XP_008218517.1|  PREDICTED: putative glucuronosyltransferase ...    283   3e-88   
gb|KJB82306.1|  hypothetical protein B456_013G188300                    284   5e-88   Gossypium raimondii
gb|KDO49228.1|  hypothetical protein CISIN_1g008931mg                   283   9e-88   Citrus sinensis [apfelsine]
ref|XP_010102196.1|  hypothetical protein L484_024477                   282   3e-87   
gb|KHN31485.1|  Glycogenin-1                                            281   4e-87   Glycine soja [wild soybean]
ref|XP_006604859.1|  PREDICTED: putative glucuronosyltransferase ...    281   5e-87   Glycine max [soybeans]
ref|XP_006604858.1|  PREDICTED: putative glucuronosyltransferase ...    281   5e-87   Glycine max [soybeans]
ref|XP_011101631.1|  PREDICTED: inositol phosphorylceramide glucu...    287   5e-87   
ref|XP_004152810.1|  PREDICTED: inositol phosphorylceramide glucu...    280   9e-87   Cucumis sativus [cucumbers]
gb|ABZ89190.1|  hypothetical protein 46C02.16                           280   1e-86   Coffea canephora [robusta coffee]
emb|CDO99980.1|  unnamed protein product                                280   2e-86   Coffea canephora [robusta coffee]
gb|EPS68223.1|  hypothetical protein M569_06549                         279   2e-86   Genlisea aurea
ref|XP_006606473.1|  PREDICTED: putative glucuronosyltransferase ...    278   2e-86   Glycine max [soybeans]
ref|XP_009384656.1|  PREDICTED: LOW QUALITY PROTEIN: putative glu...    279   3e-86   
ref|XP_009401946.1|  PREDICTED: putative glucuronosyltransferase ...    279   4e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008441775.1|  PREDICTED: putative glucuronosyltransferase ...    279   4e-86   Cucumis melo [Oriental melon]
ref|XP_003556480.1|  PREDICTED: putative glucuronosyltransferase ...    278   5e-86   Glycine max [soybeans]
ref|XP_010675056.1|  PREDICTED: inositol phosphorylceramide glucu...    278   6e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008366883.1|  PREDICTED: putative glucuronosyltransferase ...    278   7e-86   Malus domestica [apple tree]
ref|XP_009379742.1|  PREDICTED: putative glucuronosyltransferase ...    278   1e-85   Pyrus x bretschneideri [bai li]
ref|XP_007143949.1|  hypothetical protein PHAVU_007G116100g             278   1e-85   Phaseolus vulgaris [French bean]
gb|KCW61484.1|  hypothetical protein EUGRSUZ_H04216                     273   1e-85   Eucalyptus grandis [rose gum]
ref|XP_008370762.1|  PREDICTED: putative glucuronosyltransferase ...    277   2e-85   
ref|XP_008807617.1|  PREDICTED: putative glucuronosyltransferase ...    276   2e-85   Phoenix dactylifera
ref|XP_010247242.1|  PREDICTED: inositol phosphorylceramide glucu...    276   5e-85   Nelumbo nucifera [Indian lotus]
ref|XP_009343790.1|  PREDICTED: putative glucuronosyltransferase ...    276   5e-85   Pyrus x bretschneideri [bai li]
ref|NP_197349.2|  plant glycogenin-like starch initiation protein 6     275   7e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AAL58891.1|AF462795_1  AT5g18480/F20L16_200                          275   8e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400396.1|  hypothetical protein EUTSA_v10013196mg             275   9e-85   Eutrema salsugineum [saltwater cress]
emb|CAH67224.1|  OSIGBa0145M07.6                                        270   9e-85   Oryza sativa [red rice]
ref|XP_004302108.1|  PREDICTED: inositol phosphorylceramide glucu...    274   2e-84   Fragaria vesca subsp. vesca
ref|XP_007205021.1|  hypothetical protein PRUPE_ppa003817mg             273   5e-84   
ref|XP_010485804.1|  PREDICTED: inositol phosphorylceramide glucu...    273   5e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010024933.1|  PREDICTED: putative glucuronosyltransferase ...    273   5e-84   Eucalyptus grandis [rose gum]
ref|XP_009126256.1|  PREDICTED: putative glucuronosyltransferase ...    273   6e-84   Brassica rapa
ref|XP_010922963.1|  PREDICTED: inositol phosphorylceramide glucu...    273   7e-84   Elaeis guineensis
ref|XP_010463911.1|  PREDICTED: inositol phosphorylceramide glucu...    273   7e-84   Camelina sativa [gold-of-pleasure]
emb|CDX88935.1|  BnaA03g07140D                                          273   7e-84   
ref|XP_010413938.1|  PREDICTED: inositol phosphorylceramide glucu...    273   9e-84   Camelina sativa [gold-of-pleasure]
emb|CDY58112.1|  BnaA02g35140D                                          272   1e-83   Brassica napus [oilseed rape]
ref|XP_006297372.1|  hypothetical protein CARUB_v10013391mg             273   1e-83   Capsella rubella
ref|XP_002522004.1|  glycogenin, putative                               278   1e-83   
ref|XP_002873897.1|  hypothetical protein ARALYDRAFT_488728             272   1e-83   
emb|CDY21129.1|  BnaA01g33600D                                          272   1e-83   Brassica napus [oilseed rape]
ref|XP_010420611.1|  PREDICTED: inositol phosphorylceramide glucu...    272   1e-83   Camelina sativa [gold-of-pleasure]
gb|ABR16625.1|  unknown                                                 273   2e-83   Picea sitchensis
ref|XP_009125000.1|  PREDICTED: putative glucuronosyltransferase ...    272   2e-83   Brassica rapa
ref|XP_010492852.1|  PREDICTED: inositol phosphorylceramide glucu...    271   2e-83   Camelina sativa [gold-of-pleasure]
emb|CAE05448.4|  OSJNBa0073E02.8                                        270   2e-83   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010454088.1|  PREDICTED: inositol phosphorylceramide glucu...    271   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010558734.1|  PREDICTED: inositol phosphorylceramide glucu...    271   2e-83   Tarenaya hassleriana [spider flower]
ref|XP_002446789.1|  hypothetical protein SORBIDRAFT_06g022680          271   3e-83   Sorghum bicolor [broomcorn]
gb|EYU19884.1|  hypothetical protein MIMGU_mgv1a004141mg                271   3e-83   Erythranthe guttata [common monkey flower]
ref|XP_006287478.1|  hypothetical protein CARUB_v10000689mg             271   4e-83   Capsella rubella
gb|EEC77645.1|  hypothetical protein OsI_16652                          271   4e-83   Oryza sativa Indica Group [Indian rice]
gb|KFK37856.1|  hypothetical protein AALP_AA3G038100                    271   4e-83   Arabis alpina [alpine rockcress]
ref|XP_006653601.1|  PREDICTED: putative glucuronosyltransferase ...    270   7e-83   Oryza brachyantha
gb|AIL52751.1|  putative glucuronosyltransferase PGSIP6-like protein    270   8e-83   Dendrobium officinale
ref|XP_006408197.1|  hypothetical protein EUTSA_v10020458mg             270   9e-83   Eutrema salsugineum [saltwater cress]
ref|XP_007147201.1|  hypothetical protein PHAVU_006G104100g             269   2e-82   Phaseolus vulgaris [French bean]
gb|KFK26089.1|  hypothetical protein AALP_AA8G201300                    269   2e-82   Arabis alpina [alpine rockcress]
emb|CDX70822.1|  BnaC03g09060D                                          268   3e-82   
emb|CDY29996.1|  BnaC01g40120D                                          269   3e-82   Brassica napus [oilseed rape]
ref|XP_003590989.1|  Glycogenin-1                                       269   3e-82   Medicago truncatula
ref|XP_004494729.1|  PREDICTED: putative glucuronosyltransferase ...    268   5e-82   Cicer arietinum [garbanzo]
ref|NP_001146086.1|  uncharacterized protein LOC100279618 precursor     268   6e-82   Zea mays [maize]
gb|KEH24575.1|  glucuronosyltransferase PGSIP8                          268   7e-82   Medicago truncatula
ref|XP_008661816.1|  PREDICTED: uncharacterized protein LOC100279...    267   9e-82   Zea mays [maize]
emb|CDY02625.1|  BnaC02g08100D                                          267   9e-82   
dbj|BAJ88570.1|  predicted protein                                      265   5e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004495592.1|  PREDICTED: putative glucuronosyltransferase ...    266   5e-81   Cicer arietinum [garbanzo]
ref|XP_004976232.1|  PREDICTED: putative glucuronosyltransferase ...    268   6e-81   Setaria italica
ref|XP_009131669.1|  PREDICTED: putative glucuronosyltransferase ...    265   9e-81   Brassica rapa
gb|AFK39755.1|  unknown                                                 265   1e-80   Lotus japonicus
gb|KHN43170.1|  Glycogenin-1                                            274   2e-80   Glycine soja [wild soybean]
ref|XP_006648850.1|  PREDICTED: putative glucuronosyltransferase ...    263   3e-80   Oryza brachyantha
ref|NP_001047475.1|  Os02g0624400                                       263   6e-80   
ref|XP_003580141.1|  PREDICTED: inositol phosphorylceramide glucu...    260   5e-79   Brachypodium distachyon [annual false brome]
gb|EEC73629.1|  hypothetical protein OsI_08135                          260   5e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_010104622.1|  hypothetical protein L484_021999                   262   3e-78   
ref|XP_002962043.1|  hypothetical protein SELMODRAFT_62883              255   7e-78   
ref|XP_002971046.1|  hypothetical protein SELMODRAFT_62885              255   9e-78   
ref|XP_010235727.1|  PREDICTED: LOW QUALITY PROTEIN: inositol pho...    257   1e-77   
ref|XP_010104620.1|  hypothetical protein L484_021997                   255   3e-77   Morus notabilis
dbj|BAK04525.1|  predicted protein                                      254   7e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001784830.1|  predicted protein                                  254   1e-76   
ref|XP_001759731.1|  predicted protein                                  243   4e-72   
gb|KJB44790.1|  hypothetical protein B456_007G273500                    210   5e-61   Gossypium raimondii
gb|KHN14829.1|  Glycogenin-1                                            212   9e-61   Glycine soja [wild soybean]
gb|EMS55946.1|  Glycogenin-1                                            211   1e-60   Triticum urartu
gb|ADY38797.1|  plant glycogenin-like starch initiation protein         201   3e-57   Coffea arabica [arabica coffee]
gb|KGN61301.1|  hypothetical protein Csa_2G078050                       196   3e-55   Cucumis sativus [cucumbers]
ref|XP_011620535.1|  PREDICTED: LOW QUALITY PROTEIN: inositol pho...    187   2e-51   
gb|ERM98542.1|  hypothetical protein AMTR_s01134p00004530               183   3e-50   Amborella trichopoda
gb|KDD73670.1|  hypothetical protein H632_c1943p0                       179   6e-50   Helicosporidium sp. ATCC 50920
gb|EMT33175.1|  hypothetical protein F775_16539                         184   1e-49   
ref|XP_006408154.1|  hypothetical protein EUTSA_v10021780mg             168   2e-48   
ref|XP_003591002.1|  hypothetical protein MTR_1g080670                  162   3e-46   
gb|EMS47724.1|  Glycogenin-1                                            169   1e-45   Triticum urartu
ref|XP_002954821.1|  hypothetical protein VOLCADRAFT_106550             168   4e-44   Volvox carteri f. nagariensis
emb|CBN79165.1|  Glycosyltransferase, family GT8                        152   1e-37   Ectocarpus siliculosus
ref|XP_005844956.1|  hypothetical protein CHLNCDRAFT_138328             147   2e-36   Chlorella variabilis
gb|EPS60482.1|  hypothetical protein M569_14321                         119   1e-27   Genlisea aurea
ref|XP_002992480.1|  hypothetical protein SELMODRAFT_135481             119   3e-27   
ref|XP_010921631.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    118   2e-26   Elaeis guineensis
ref|XP_010921630.1|  PREDICTED: putative UDP-glucuronate:xylan al...    118   2e-26   Elaeis guineensis
ref|XP_009771065.1|  PREDICTED: putative glucuronosyltransferase ...    115   4e-26   Nicotiana sylvestris
ref|XP_011405481.1|  PREDICTED: inositol phosphorylceramide glucu...    115   5e-26   Amphimedon queenslandica
ref|XP_002990211.1|  hypothetical protein SELMODRAFT_131094             115   1e-25   
ref|XP_011406812.1|  PREDICTED: inositol phosphorylceramide glucu...    114   2e-25   Amphimedon queenslandica
ref|XP_010428781.1|  PREDICTED: putative UDP-glucuronate:xylan al...    115   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010416641.1|  PREDICTED: putative UDP-glucuronate:xylan al...    115   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010471900.1|  PREDICTED: putative UDP-glucuronate:xylan al...    115   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006302009.1|  hypothetical protein CARUB_v10019986mg             115   4e-25   Capsella rubella
ref|XP_011466789.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    114   8e-25   Fragaria vesca subsp. vesca
gb|AIA95663.1|  Glyco_transf_8                                          107   9e-25   uncultured bacterium
gb|KCW62287.1|  hypothetical protein EUGRSUZ_H04942                     113   1e-24   Eucalyptus grandis [rose gum]
ref|XP_010025567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    113   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010040896.1|  PREDICTED: putative UDP-glucuronate:xylan al...    110   2e-24   
gb|KCW44877.1|  hypothetical protein EUGRSUZ_L01540                     110   3e-24   Eucalyptus grandis [rose gum]
ref|XP_005708044.1|  transferase, transferring glycosyl groups / ...    112   4e-24   Galdieria sulphuraria
ref|XP_002889125.1|  hypothetical protein ARALYDRAFT_476876             112   4e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010674823.1|  PREDICTED: putative UDP-glucuronate:xylan al...    110   4e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006858468.1|  PREDICTED: putative UDP-glucuronate:xylan al...    112   4e-24   Amborella trichopoda
ref|XP_010040834.1|  PREDICTED: putative UDP-glucuronate:xylan al...    111   4e-24   Eucalyptus grandis [rose gum]
ref|XP_010040835.1|  PREDICTED: putative UDP-glucuronate:xylan al...    111   4e-24   Eucalyptus grandis [rose gum]
ref|NP_177838.2|  putative UDP-glucuronate:xylan alpha-glucuronos...    111   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803691.1|  PREDICTED: putative UDP-glucuronate:xylan al...    112   5e-24   
tpg|DAA44094.1|  TPA: hypothetical protein ZEAMMB73_670696              110   5e-24   
ref|XP_010680250.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    111   7e-24   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ87020.1|  predicted protein                                      108   8e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006383614.1|  hypothetical protein POPTR_0005s21030g             109   1e-23   
ref|XP_003568405.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    110   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_010040839.1|  PREDICTED: putative UDP-glucuronate:xylan al...    110   1e-23   Eucalyptus grandis [rose gum]
dbj|BAJ87861.1|  predicted protein                                      107   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA56540.1|  TPA: hypothetical protein ZEAMMB73_374443              110   1e-23   
ref|XP_008674740.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    110   2e-23   
ref|XP_002456736.1|  hypothetical protein SORBIDRAFT_03g041660          110   2e-23   Sorghum bicolor [broomcorn]
gb|AAC34345.1|  Unknown protein                                         111   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564767.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    110   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_002517237.1|  glycogenin, putative                               110   2e-23   
ref|XP_002969245.1|  hypothetical protein SELMODRAFT_1169               108   2e-23   
ref|XP_008373921.1|  PREDICTED: putative UDP-glucuronate:xylan al...    109   2e-23   Malus domestica [apple tree]
gb|KCW71171.1|  hypothetical protein EUGRSUZ_F04263                     107   2e-23   Eucalyptus grandis [rose gum]
ref|XP_002960603.1|  hypothetical protein SELMODRAFT_1168               107   2e-23   
gb|KHN09596.1|  Glycogenin-1                                            109   2e-23   Glycine soja [wild soybean]
ref|XP_008373920.1|  PREDICTED: putative UDP-glucuronate:xylan al...    109   3e-23   Malus domestica [apple tree]
ref|XP_008441557.1|  PREDICTED: putative UDP-glucuronate:xylan al...    109   3e-23   Cucumis melo [Oriental melon]
ref|XP_009348497.1|  PREDICTED: putative UDP-glucuronate:xylan al...    109   3e-23   Pyrus x bretschneideri [bai li]
ref|XP_004148815.1|  PREDICTED: putative UDP-glucuronate:xylan al...    109   3e-23   Cucumis sativus [cucumbers]
ref|XP_006645120.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    109   3e-23   Oryza brachyantha
gb|EMS55920.1|  Glycogenin-1                                            109   3e-23   Triticum urartu
emb|CDM85463.1|  unnamed protein product                                109   3e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010999819.1|  PREDICTED: putative UDP-glucuronate:xylan al...    109   4e-23   Populus euphratica
ref|XP_011625863.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   4e-23   
ref|XP_002997946.1|  glycosyl transferase, putative                     108   4e-23   Phytophthora infestans T30-4
dbj|BAJ87677.1|  predicted protein                                      109   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT19434.1|  Glycogenin-1                                            109   4e-23   
gb|AAS90653.1|  putative glycogenin                                     109   4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79261.1|  hypothetical protein OsI_20036                          109   4e-23   Oryza sativa Indica Group [Indian rice]
gb|EYU29759.1|  hypothetical protein MIMGU_mgv1a017852mg                107   4e-23   Erythranthe guttata [common monkey flower]
ref|XP_006581757.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    108   4e-23   Glycine max [soybeans]
gb|EEE63788.1|  hypothetical protein OsJ_18611                          109   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404954.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007019401.1|  Plant glycogenin-like starch initiation prot...    108   4e-23   
ref|XP_009404956.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   4e-23   
ref|XP_002307480.2|  hypothetical protein POPTR_0005s21030g             108   5e-23   Populus trichocarpa [western balsam poplar]
gb|KHG12057.1|  Glycogenin-2                                            108   5e-23   Gossypium arboreum [tree cotton]
ref|XP_010110483.1|  hypothetical protein L484_003529                   108   5e-23   
gb|KHN31133.1|  Glycogenin-2                                            108   5e-23   Glycine soja [wild soybean]
ref|XP_004290562.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   5e-23   Fragaria vesca subsp. vesca
ref|XP_010911800.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   5e-23   Elaeis guineensis
ref|XP_010911799.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   5e-23   Elaeis guineensis
ref|XP_006578795.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    108   5e-23   Glycine max [soybeans]
gb|KJB59999.1|  hypothetical protein B456_009G284700                    108   5e-23   Gossypium raimondii
ref|XP_006406580.1|  hypothetical protein EUTSA_v10020243mg             108   5e-23   Eutrema salsugineum [saltwater cress]
gb|KJB60000.1|  hypothetical protein B456_009G284700                    108   5e-23   Gossypium raimondii
gb|AGT16755.1|  glycogenin                                              108   6e-23   Saccharum hybrid cultivar R570
ref|XP_010110482.1|  hypothetical protein L484_003528                   108   6e-23   
ref|XP_002307022.2|  hypothetical protein POPTR_0005s06280g             108   7e-23   
ref|XP_002441128.1|  hypothetical protein SORBIDRAFT_09g020930          108   7e-23   Sorghum bicolor [broomcorn]
ref|XP_008891806.1|  hypothetical protein PPTG_02471                    107   7e-23   Phytophthora parasitica INRA-310
ref|XP_008654538.1|  PREDICTED: uncharacterized protein LOC100272...    108   7e-23   
ref|XP_012087641.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    108   7e-23   Jatropha curcas
gb|KHG20951.1|  Glycogenin-1                                            106   8e-23   Gossypium arboreum [tree cotton]
ref|XP_011073953.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   8e-23   Sesamum indicum [beniseed]
gb|KDP24792.1|  hypothetical protein JCGZ_25413                         108   8e-23   Jatropha curcas
dbj|BAG90458.1|  unnamed protein product                                107   8e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85213.1|  predicted protein                                      108   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT13493.1|  Glycogenin-1                                            108   8e-23   
gb|KFK44245.1|  hypothetical protein AALP_AA1G233800                    108   8e-23   Arabis alpina [alpine rockcress]
gb|ERN12676.1|  hypothetical protein AMTR_s00025p00245930               107   8e-23   Amborella trichopoda
gb|KFK44246.1|  hypothetical protein AALP_AA1G233800                    108   8e-23   Arabis alpina [alpine rockcress]
ref|XP_008237654.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   8e-23   Prunus mume [ume]
ref|XP_007199738.1|  hypothetical protein PRUPE_ppa002694mg             108   8e-23   Prunus persica
ref|XP_010539695.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   9e-23   Tarenaya hassleriana [spider flower]
ref|XP_008647982.1|  PREDICTED: LOC100286027 isoform X2                 107   9e-23   
ref|XP_009776713.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    108   9e-23   Nicotiana sylvestris
ref|XP_009776712.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    108   9e-23   Nicotiana sylvestris
ref|XP_010244025.1|  PREDICTED: putative UDP-glucuronate:xylan al...    107   9e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009776715.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   9e-23   Nicotiana sylvestris
ref|XP_009776714.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   1e-22   Nicotiana sylvestris
ref|XP_010539696.1|  PREDICTED: putative UDP-glucuronate:xylan al...    108   1e-22   Tarenaya hassleriana [spider flower]
emb|CDP04731.1|  unnamed protein product                                107   1e-22   Coffea canephora [robusta coffee]
gb|EAZ14371.1|  hypothetical protein OsJ_04291                          107   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011007558.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   1e-22   Populus euphratica
gb|EEC71899.1|  hypothetical protein OsI_04661                          107   1e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001044991.1|  Os01g0880200                                       107   1e-22   
ref|XP_010244020.1|  PREDICTED: putative UDP-glucuronate:xylan al...    107   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010063886.1|  PREDICTED: putative UDP-glucuronate:xylan al...    107   1e-22   Eucalyptus grandis [rose gum]
ref|XP_008647980.1|  PREDICTED: LOC100286027 isoform X1                 107   1e-22   Zea mays [maize]
emb|CDP18299.1|  unnamed protein product                                107   1e-22   Coffea canephora [robusta coffee]
ref|XP_010487789.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   1e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001152387.1|  LOC100286027                                       107   1e-22   Zea mays [maize]
ref|XP_002885270.1|  hypothetical protein ARALYDRAFT_479372             107   1e-22   
ref|XP_010465976.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   1e-22   Camelina sativa [gold-of-pleasure]
gb|EPS63087.1|  hypothetical protein M569_11696                         104   1e-22   Genlisea aurea
gb|KJB80585.1|  hypothetical protein B456_013G105100                    106   1e-22   Gossypium raimondii
ref|NP_566615.1|  plant glycogenin-like starch initiation protein 1     107   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007557.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   1e-22   Populus euphratica
ref|NP_001189927.1|  plant glycogenin-like starch initiation prot...    107   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007559.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   2e-22   Populus euphratica
ref|NP_001030722.1|  plant glycogenin-like starch initiation prot...    107   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EGT40433.1|  hypothetical protein CAEBREN_07033                      105   2e-22   Caenorhabditis brenneri
ref|XP_006297149.1|  hypothetical protein CARUB_v10013152mg             107   2e-22   Capsella rubella
ref|XP_006416296.1|  hypothetical protein EUTSA_v10007050mg             107   2e-22   
gb|EPS59757.1|  hypothetical protein M569_15049                         106   2e-22   Genlisea aurea
ref|XP_002280832.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   2e-22   Vitis vinifera
emb|CDX96589.1|  BnaA08g21320D                                          107   2e-22   
ref|XP_010507061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   2e-22   Camelina sativa [gold-of-pleasure]
emb|CCA16211.1|  glycosyl transferase putative                          106   2e-22   Albugo laibachii Nc14
emb|CDY18535.1|  BnaA01g26600D                                          107   2e-22   Brassica napus [oilseed rape]
emb|CAN81983.1|  hypothetical protein VITISV_042631                     106   2e-22   Vitis vinifera
gb|EYU18058.1|  hypothetical protein MIMGU_mgv1a018384mg                107   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_009149665.1|  PREDICTED: putative UDP-glucuronate:xylan al...    107   2e-22   Brassica rapa
gb|KFK39187.1|  hypothetical protein AALP_AA3G211300                    108   2e-22   Arabis alpina [alpine rockcress]
ref|XP_009112560.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   2e-22   Brassica rapa
gb|KJB80584.1|  hypothetical protein B456_013G105100                    107   2e-22   Gossypium raimondii
ref|XP_009112567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    107   2e-22   Brassica rapa
ref|XP_009149666.1|  PREDICTED: putative UDP-glucuronate:xylan al...    107   2e-22   
emb|CDY04633.1|  BnaC05g16710D                                          107   2e-22   
ref|XP_003602583.1|  Secondary cell wall-related glycosyltransfer...    107   2e-22   Medicago truncatula
ref|XP_007199740.1|  hypothetical protein PRUPE_ppa002697mg             107   2e-22   Prunus persica
ref|XP_007137705.1|  hypothetical protein PHAVU_009G148800g             107   2e-22   Phaseolus vulgaris [French bean]
gb|KHG05573.1|  Glycogenin-2                                            107   2e-22   Gossypium arboreum [tree cotton]
gb|KHG03827.1|  Glycogenin-2                                            106   2e-22   Gossypium arboreum [tree cotton]
ref|XP_010245814.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   3e-22   Nelumbo nucifera [Indian lotus]
gb|KIH50970.1|  glycosyltransferase, family 8                           102   3e-22   Ancylostoma duodenale
ref|XP_001756144.1|  predicted protein                                  105   3e-22   
ref|XP_006427798.1|  hypothetical protein CICLE_v10025272mg             106   3e-22   
ref|XP_011022956.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   Populus euphratica
emb|CDY38807.1|  BnaC08g19810D                                          106   3e-22   Brassica napus [oilseed rape]
ref|XP_006350978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   Solanum tuberosum [potatoes]
ref|XP_004985459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   3e-22   Setaria italica
ref|XP_010312475.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   Solanum lycopersicum
ref|XP_004249893.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_011022955.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_008798993.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   3e-22   
ref|XP_010550280.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_011022957.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_004498382.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   3e-22   
gb|KDO83632.1|  hypothetical protein CISIN_1g043696mg                   105   3e-22   
ref|XP_009396821.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_010550282.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_011022954.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_011022958.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
gb|EYU36701.1|  hypothetical protein MIMGU_mgv1a005329mg                105   3e-22   
ref|XP_010680014.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   3e-22   
ref|XP_004237736.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   3e-22   
ref|XP_008798991.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   3e-22   
ref|XP_006350977.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   3e-22   
ref|XP_006464622.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   4e-22   
gb|AAX33316.1|  secondary cell wall-related glycosyltransferase f...    106   4e-22   
ref|XP_009360736.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   4e-22   
gb|KDO58344.1|  hypothetical protein CISIN_1g006648mg                   106   4e-22   
ref|XP_009360735.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   4e-22   
ref|XP_010649390.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   4e-22   
ref|XP_009392557.1|  PREDICTED: putative UDP-glucuronate:xylan al...    106   4e-22   
emb|CDY50243.1|  BnaA06g15200D                                          107   4e-22   
ref|XP_004502919.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    106   4e-22   
emb|CDY53768.1|  BnaC01g43920D                                          106   4e-22   
ref|XP_003544084.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
ref|XP_002310513.2|  hypothetical protein POPTR_0007s04030g             105   5e-22   
ref|XP_010664886.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
ref|XP_003518352.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
ref|XP_009594279.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   5e-22   
gb|AAX33317.1|  secondary cell wall-related glycosyltransferase f...    105   5e-22   
ref|XP_006434392.1|  hypothetical protein CICLE_v10003328mg             105   5e-22   
ref|XP_004972256.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   5e-22   
ref|XP_010664887.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
ref|XP_009392550.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
ref|XP_002275240.2|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   5e-22   
ref|XP_009594278.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   5e-22   
ref|XP_009594277.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   5e-22   
ref|XP_009594275.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   5e-22   
gb|KJB71319.1|  hypothetical protein B456_011G116600                    105   5e-22   
ref|XP_006472929.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
ref|XP_010674757.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
gb|KHN34064.1|  Glycogenin-2                                            105   5e-22   
gb|KHN41007.1|  Glycogenin-2                                            105   5e-22   
ref|XP_006356282.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   5e-22   
ref|XP_003525117.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   5e-22   
gb|KEH40452.1|  UDP-glucuronate:xylan alpha-glucuronosyltransferase     105   6e-22   
ref|XP_006485174.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   6e-22   
ref|XP_004985458.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    105   6e-22   
ref|XP_006356283.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   6e-22   
ref|XP_012066075.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   6e-22   
ref|XP_012066076.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   6e-22   
gb|KHN04164.1|  Glycogenin-2                                            105   6e-22   
gb|KJB71320.1|  hypothetical protein B456_011G116600                    105   6e-22   
ref|XP_009629284.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   7e-22   
emb|CCI45428.1|  unnamed protein product                                104   7e-22   
gb|KHG15344.1|  Glycogenin-2                                            105   7e-22   
ref|XP_006607044.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   8e-22   
ref|XP_007161486.1|  hypothetical protein PHAVU_001G073100g             105   8e-22   
ref|XP_010062155.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   8e-22   
ref|XP_010062154.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   8e-22   
gb|KCW69223.1|  hypothetical protein EUGRSUZ_F02737                     105   8e-22   
ref|XP_008454698.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   8e-22   
ref|XP_008454693.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   8e-22   
ref|XP_009360737.1|  PREDICTED: putative UDP-glucuronate:xylan al...    105   8e-22   
ref|XP_002526157.1|  glycogenin, putative                               105   1e-21   
gb|EMS63875.1|  Glycogenin-2                                            104   1e-21   
emb|CDX92257.1|  BnaA05g21500D                                          104   1e-21   
gb|KHG14645.1|  Glycogenin-2                                            104   1e-21   
ref|XP_009348499.1|  PREDICTED: putative UDP-glucuronate:xylan al...    104   1e-21   
ref|XP_008441030.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    104   1e-21   
ref|XP_011657761.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    104   2e-21   
ref|XP_011099765.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    104   2e-21   
gb|KJB40458.1|  hypothetical protein B456_007G064800                    104   2e-21   
ref|XP_011099766.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    104   2e-21   
ref|XP_009145872.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    104   2e-21   
emb|CDJ94496.1|  Glycosyl transferase domain containing protein         102   2e-21   
ref|XP_009414973.1|  PREDICTED: putative UDP-glucuronate:xylan al...    104   2e-21   
dbj|BAJ97980.1|  predicted protein                                      104   2e-21   
ref|XP_010090867.1|  hypothetical protein L484_020727                   103   2e-21   
gb|AIA93768.1|  mannosyl_trans3                                       97.4    2e-21   
ref|XP_009763873.1|  PREDICTED: putative UDP-glucuronate:xylan al...    103   2e-21   
ref|XP_008373924.1|  PREDICTED: putative UDP-glucuronate:xylan al...    103   2e-21   
ref|XP_002453984.1|  hypothetical protein SORBIDRAFT_04g022700          103   2e-21   
ref|XP_008373923.1|  PREDICTED: putative UDP-glucuronate:xylan al...    103   2e-21   
ref|XP_008373922.1|  PREDICTED: putative UDP-glucuronate:xylan al...    103   3e-21   
ref|XP_007048325.1|  Plant glycogenin-like starch initiation prot...    103   3e-21   
ref|XP_009414600.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    103   3e-21   
emb|CBK20303.2|  unnamed protein product                              99.8    3e-21   
ref|XP_011097058.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    103   3e-21   
ref|XP_001702759.1|  predicted protein                                97.1    3e-21   
ref|XP_008237655.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    103   3e-21   
ref|XP_011097062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    103   4e-21   
ref|XP_008786543.1|  PREDICTED: putative UDP-glucuronate:xylan al...    103   4e-21   
emb|CDP15517.1|  unnamed protein product                                102   4e-21   
ref|XP_006306168.1|  hypothetical protein CARUB_v10011725mg             102   4e-21   
ref|XP_001783069.1|  predicted protein                                  102   4e-21   
ref|XP_009420264.1|  PREDICTED: putative UDP-glucuronate:xylan al...    103   4e-21   
ref|XP_007048327.1|  Plant glycogenin-like starch initiation prot...    102   5e-21   
ref|NP_001049188.2|  Os03g0184300                                       102   5e-21   
ref|XP_004139358.1|  PREDICTED: putative UDP-glucuronate:xylan al...    102   5e-21   
ref|XP_008673893.1|  PREDICTED: hypothetical protein isoform X1         102   5e-21   
ref|XP_007048326.1|  Plant glycogenin-like starch initiation prot...    102   5e-21   
ref|XP_006654430.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    102   6e-21   
ref|XP_008237675.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    103   6e-21   
ref|XP_002969246.1|  hypothetical protein SELMODRAFT_91619              101   7e-21   
gb|EPS62267.1|  hypothetical protein M569_12523                         101   7e-21   
ref|XP_001777541.1|  predicted protein                                  102   7e-21   
ref|NP_001130837.1|  hypothetical protein                               102   7e-21   
ref|XP_010930628.1|  PREDICTED: putative UDP-glucuronate:xylan al...    102   7e-21   
ref|XP_005828606.1|  hypothetical protein GUITHDRAFT_48194            97.1    7e-21   
ref|XP_010475720.1|  PREDICTED: putative UDP-glucuronate:xylan al...    102   7e-21   
tpg|DAA43741.1|  TPA: hypothetical protein ZEAMMB73_319049              101   7e-21   
ref|XP_009408314.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    102   8e-21   
gb|AAK92624.1|AC079633_4  Putative glycogenin                           102   8e-21   
gb|EAY88814.1|  hypothetical protein OsI_10286                          102   8e-21   
gb|ERN12678.1|  hypothetical protein AMTR_s00025p00246110             99.8    8e-21   
ref|XP_010489606.1|  PREDICTED: putative UDP-glucuronate:xylan al...    101   1e-20   
ref|XP_010458168.1|  PREDICTED: putative UDP-glucuronate:xylan al...    101   1e-20   
ref|XP_009411206.1|  PREDICTED: putative UDP-glucuronate:xylan al...    101   1e-20   
ref|XP_002468380.1|  hypothetical protein SORBIDRAFT_01g044930          101   1e-20   
ref|NP_172373.3|  plant glycogenin-like starch initiation protein 5     101   2e-20   
ref|XP_008345680.1|  PREDICTED: putative UDP-glucuronate:xylan al...    101   2e-20   
ref|XP_002889728.1|  hypothetical protein ARALYDRAFT_470978             100   2e-20   
ref|XP_002960604.1|  hypothetical protein SELMODRAFT_73856              100   2e-20   
ref|XP_008805263.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    100   3e-20   
ref|XP_004952800.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    100   3e-20   
ref|XP_009404013.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  99.8    3e-20   
ref|XP_010549836.1|  PREDICTED: putative UDP-glucuronate:xylan al...    100   3e-20   
gb|KDP23521.1|  hypothetical protein JCGZ_23354                       97.8    4e-20   
ref|XP_011625865.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  99.8    4e-20   
ref|XP_009404011.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  99.8    5e-20   
ref|XP_008645791.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  99.8    5e-20   
ref|XP_004304997.2|  PREDICTED: putative UDP-glucuronate:xylan al...  99.8    5e-20   
ref|XP_006417624.1|  hypothetical protein EUTSA_v10007230mg           99.8    5e-20   
ref|XP_009384289.1|  PREDICTED: putative UDP-glucuronate:xylan al...  99.8    5e-20   
ref|XP_005536455.1|  similar to glycogenin                              100   5e-20   
ref|XP_001885899.1|  glycosyltransferase family 8 protein             97.1    6e-20   
ref|XP_010255960.1|  PREDICTED: putative UDP-glucuronate:xylan al...  99.4    6e-20   
ref|XP_002458785.1|  hypothetical protein SORBIDRAFT_03g040240        99.8    6e-20   
ref|XP_006473886.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  99.4    7e-20   
ref|XP_004499061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  99.4    8e-20   
gb|KDO84195.1|  hypothetical protein CISIN_1g007705mg                 99.0    9e-20   
ref|XP_006434785.1|  hypothetical protein CICLE_v10000658mg           99.0    9e-20   
emb|CEP13961.1|  hypothetical protein                                 99.8    9e-20   
ref|XP_004499062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  98.6    1e-19   
ref|XP_009600657.1|  PREDICTED: putative UDP-glucuronate:xylan al...  98.6    1e-19   
gb|KGN61304.1|  hypothetical protein Csa_2G078080                     91.7    1e-19   
ref|NP_510518.2|  Protein T10B10.8                                    97.1    2e-19   
gb|ERN14432.1|  hypothetical protein AMTR_s01206p00007610             90.9    2e-19   
ref|XP_008782340.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  97.8    2e-19   
gb|EYC40759.1|  hypothetical protein Y032_0599g478                    97.1    2e-19   
gb|KJB58472.1|  hypothetical protein B456_009G211400                  97.8    2e-19   
emb|CDP04730.1|  unnamed protein product                              97.8    2e-19   
emb|CDP18101.1|  unnamed protein product                              97.8    3e-19   
ref|XP_009390902.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  97.1    3e-19   
ref|XP_003589197.1|  Glycogenin glucosyltransferase                   97.4    3e-19   
ref|XP_012089446.1|  PREDICTED: putative UDP-glucuronate:xylan al...  97.4    3e-19   
ref|XP_010108604.1|  hypothetical protein L484_006335                 97.4    3e-19   
ref|XP_009390901.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  97.4    3e-19   
ref|XP_003589198.1|  Glycogenin glucosyltransferase                   97.1    4e-19   
ref|XP_003544459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  97.1    4e-19   
ref|XP_006578023.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.7    5e-19   
ref|XP_010916626.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.7    5e-19   
ref|XP_010916627.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.3    5e-19   
ref|XP_003523601.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.7    6e-19   
gb|AFW58865.1|  hypothetical protein ZEAMMB73_149865                  89.4    6e-19   
ref|XP_006828387.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.7    6e-19   
gb|KHG15663.1|  Glycogenin-1                                          96.3    7e-19   
dbj|GAN01011.1|  alpha-1,4-N-acetylglucosaminyltransferase EXTL3 ...  96.7    7e-19   
ref|XP_008388964.1|  PREDICTED: putative UDP-glucuronate:xylan al...  96.3    7e-19   
ref|XP_010926388.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.3    7e-19   
emb|CAP27514.2|  Protein CBG07620                                     95.1    8e-19   
ref|XP_009390259.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.3    8e-19   
ref|XP_007160847.1|  hypothetical protein PHAVU_001G021800g           96.3    8e-19   
ref|XP_008676217.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  96.3    9e-19   
tpg|DAA56781.1|  TPA: hypothetical protein ZEAMMB73_553946            96.3    9e-19   
ref|XP_011036785.1|  PREDICTED: putative UDP-glucuronate:xylan al...  95.9    9e-19   
ref|XP_002510223.1|  glycogenin, putative                             95.9    9e-19   
ref|XP_009770796.1|  PREDICTED: putative UDP-glucuronate:xylan al...  95.5    1e-18   
ref|XP_011078977.1|  PREDICTED: putative UDP-glucuronate:xylan al...  95.5    1e-18   
gb|EPS69985.1|  plant glycogenin-like starch initiation protein 3     95.5    1e-18   
ref|WP_034939146.1|  glycosyl transferase                             92.8    1e-18   
ref|XP_006361899.1|  PREDICTED: putative UDP-glucuronate:xylan al...  95.1    1e-18   
ref|XP_005830179.1|  hypothetical protein GUITHDRAFT_110924           93.2    1e-18   
gb|KDR09903.1|  hypothetical protein L798_00340                       93.2    1e-18   
ref|XP_010312667.1|  PREDICTED: putative UDP-glucuronate:xylan al...  95.1    1e-18   
ref|XP_006374946.1|  hypothetical protein POPTR_0014s02980g           95.1    1e-18   
ref|XP_003549400.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  95.5    2e-18   
ref|XP_006601291.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  95.1    2e-18   
ref|XP_010692786.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  95.1    2e-18   
gb|KHN12781.1|  Glycogenin-1                                          95.1    2e-18   
ref|XP_010692787.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.7    2e-18   
ref|XP_011030042.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.7    2e-18   
ref|XP_011030050.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.4    2e-18   
ref|XP_004291114.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.7    2e-18   
ref|XP_006382602.1|  hypothetical protein POPTR_0005s03650g           94.7    2e-18   
ref|XP_010320334.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.7    3e-18   
ref|XP_010437776.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.7    3e-18   
ref|XP_011458935.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.7    3e-18   
ref|XP_009113408.1|  PREDICTED: putative UDP-glucuronate:xylan al...  94.7    3e-18   
ref|XP_011077916.1|  PREDICTED: putative UDP-glucuronate:xylan al...  94.0    3e-18   
ref|XP_010437777.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.4    3e-18   
gb|ABK25357.1|  unknown                                               94.4    4e-18   
ref|XP_008375992.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  94.0    4e-18   
ref|XP_008375994.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  93.6    4e-18   
emb|CDM85169.1|  unnamed protein product                              94.0    4e-18   
gb|KJB63829.1|  hypothetical protein B456_010G019500                  93.6    5e-18   
gb|KJB63830.1|  hypothetical protein B456_010G019500                  94.0    5e-18   
ref|XP_012071987.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  93.6    6e-18   
gb|KDP38342.1|  hypothetical protein JCGZ_04267                       93.2    6e-18   
gb|EMT12992.1|  Glycogenin-1                                          90.1    6e-18   
emb|CDX95254.1|  BnaC09g16160D                                        93.6    6e-18   
ref|XP_010263571.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  93.6    6e-18   
ref|XP_010263572.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  93.2    7e-18   
ref|XP_010274299.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  93.2    7e-18   
emb|CEG63458.1|  hypothetical protein RMATCC62417_00600               93.2    7e-18   
ref|XP_007017252.1|  Glycogenin, putative isoform 2                   93.2    7e-18   
emb|CAB38791.1|  putative protein                                     90.9    8e-18   
ref|XP_010447256.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  93.2    8e-18   



>ref|XP_006361429.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Solanum tuberosum]
Length=533

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 160/178 (90%), Gaps = 8/178 (4%)
 Frame = +3

Query  291  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  470
            RFGV++L L  C++  YC         SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  471  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVV  650
            MVVLVSDGVS YAKQLLQADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVV
Sbjct  59   MVVLVSDGVSQYAKQLLQADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTTYKKVV  118

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS++VFNDMMSKV TL SY
Sbjct  119  YLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSEKVFNDMMSKVTTLPSY  176



>ref|XP_006361430.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Solanum tuberosum]
Length=527

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 160/178 (90%), Gaps = 8/178 (4%)
 Frame = +3

Query  291  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  470
            RFGV++L L  C++  YC         SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  471  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVV  650
            MVVLVSDGVS YAKQLLQADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVV
Sbjct  59   MVVLVSDGVSQYAKQLLQADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTTYKKVV  118

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS++VFNDMMSKV TL SY
Sbjct  119  YLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSEKVFNDMMSKVTTLPSY  176



>ref|XP_004236792.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like isoform X1 [Solanum lycopersicum]
Length=533

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 159/178 (89%), Gaps = 8/178 (4%)
 Frame = +3

Query  291  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  470
            RFGV++L L  C++  YC         S+EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSDEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  471  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVV  650
            MVVLVSDGVS YAK LLQADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVV
Sbjct  59   MVVLVSDGVSQYAKHLLQADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTTYKKVV  118

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS++VFNDMMSKV TL SY
Sbjct  119  YLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSEKVFNDMMSKVTTLPSY  176



>ref|XP_010319283.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like isoform X2 [Solanum lycopersicum]
Length=527

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 159/178 (89%), Gaps = 8/178 (4%)
 Frame = +3

Query  291  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  470
            RFGV++L L  C++  YC         S+EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD
Sbjct  7    RFGVLFL-LCNCLIGAYC-------SKSDEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKD  58

Query  471  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVV  650
            MVVLVSDGVS YAK LLQADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVV
Sbjct  59   MVVLVSDGVSQYAKHLLQADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTTYKKVV  118

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS++VFNDMMSKV TL SY
Sbjct  119  YLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSEKVFNDMMSKVTTLPSY  176



>ref|XP_009779488.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
sylvestris]
Length=533

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            + LI+ +  NY V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIR++G+TKDMVVLVS
Sbjct  11   ISLIMFLSCNYWVIGASKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRESGSTKDMVVLVS  70

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS YA  LL+ADGWIVE+I+LL+NPNQVRP RFWGVYTKLK+FNMT+YKKVVYLDADT
Sbjct  71   DGVSQYANDLLRADGWIVEKISLLSNPNQVRPTRFWGVYTKLKVFNMTKYKKVVYLDADT  130

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVK+IEDLFKCGKFCANLKHSERLNSGVMV+EPS+EVF DMMSKV TL SY
Sbjct  131  IVVKSIEDLFKCGKFCANLKHSERLNSGVMVIEPSEEVFKDMMSKVTTLPSY  182



>gb|KDP23737.1| hypothetical protein JCGZ_23570 [Jatropha curcas]
Length=539

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 159/184 (86%), Gaps = 7/184 (4%)
 Frame = +3

Query  273  MGSFSGRFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRD  452
            +  FS  F VV L LI             RSQ +++AYVTLLYGDEFLLGVRVLGKSIRD
Sbjct  3    LSKFSALFIVVALVLIQS-------GASLRSQRTQQAYVTLLYGDEFLLGVRVLGKSIRD  55

Query  453  TGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMT  632
            TG+TKDMVVLVSDGVS YA +LL+ADGWIVE+I+LLANPN+VRPKRFWGVYTKLKIFNMT
Sbjct  56   TGSTKDMVVLVSDGVSDYAVKLLEADGWIVEKISLLANPNRVRPKRFWGVYTKLKIFNMT  115

Query  633  RYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNT  812
             YKKVVYLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS+ VF+DMMSKVNT
Sbjct  116  NYKKVVYLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSQLVFDDMMSKVNT  175

Query  813  LHSY  824
            LHSY
Sbjct  176  LHSY  179



>ref|XP_004239742.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Solanum lycopersicum]
Length=533

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  315  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  494
              L  L++  V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDG
Sbjct  12   FFLMFLSSNWVIGAIKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDG  71

Query  495  VSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIV  674
            VS YA  LL+ADGWIVE+I+LL+NPNQVRPKRFWGVYTKLK+FNMT+YKKVVYLDADTIV
Sbjct  72   VSQYANDLLRADGWIVEKISLLSNPNQVRPKRFWGVYTKLKVFNMTKYKKVVYLDADTIV  131

Query  675  VKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VK+IEDLFKCGKFCANLKHSERLNSGVMV+EPS EVF DMMSKV TL SY
Sbjct  132  VKSIEDLFKCGKFCANLKHSERLNSGVMVIEPSDEVFKDMMSKVTTLPSY  181



>ref|XP_009606765.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
tomentosiformis]
Length=535

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            + LI+ +  NY V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIR++G+TKDMVVLVS
Sbjct  11   ISLIMFLSCNYWVIGASKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRESGSTKDMVVLVS  70

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS YA  LL+ADGWIVE+I+LL+NPNQVRP RFWGVYTKLK+FNMT+YKKVVYLDADT
Sbjct  71   DGVSQYANDLLRADGWIVEKISLLSNPNQVRPTRFWGVYTKLKVFNMTKYKKVVYLDADT  130

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVK+IEDLFKCGKFCANLKHSERLNSGVMV+EPS+EV+ DMMSKV TL SY
Sbjct  131  IVVKSIEDLFKCGKFCANLKHSERLNSGVMVIEPSEEVYKDMMSKVTTLPSY  182



>ref|XP_006346008.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Solanum 
tuberosum]
Length=533

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = +3

Query  291  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  470
            R+G +     L  L++  V G  +SQS+EEAYVTLLYGDEFLLGVRVLGKSIR+TG+TKD
Sbjct  7    RYGFL---FFLMFLSSNWVIGAIKSQSTEEAYVTLLYGDEFLLGVRVLGKSIRNTGSTKD  63

Query  471  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVV  650
            MVVLVSDGVS YA  LL+ADGWIVE+I+LL+NPNQVRPKRFWGVYTKLK+FNMT+YKKVV
Sbjct  64   MVVLVSDGVSQYANDLLRADGWIVEKISLLSNPNQVRPKRFWGVYTKLKVFNMTKYKKVV  123

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMV+EPS EVF DMMSKV TL SY
Sbjct  124  YLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVIEPSDEVFKDMMSKVTTLPSY  181



>ref|XP_006437461.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50701.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
Length=387

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIV+KNIEDLFKC KFCAN
Sbjct  86   EKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVIKNIEDLFKCRKFCAN  145

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  VFNDMM+KVNTL SY
Sbjct  146  LKHSERLNSGVMVVEPSAAVFNDMMTKVNTLGSY  179



>emb|CAN77613.1| hypothetical protein VITISV_036932 [Vitis vinifera]
Length=587

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = +3

Query  306  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  485
            W  LIL     +  +  P   S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLV
Sbjct  9    WFLLILLA---WIRSPSPVRASGSEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLV  65

Query  486  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDAD  665
            SDGVS YAK+LLQADGWIVE I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDAD
Sbjct  66   SDGVSDYAKKLLQADGWIVELISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDAD  125

Query  666  TIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            TIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS+ VFNDMMSKV TL SY
Sbjct  126  TIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSETVFNDMMSKVKTLPSY  178



>ref|XP_002266145.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Vitis vinifera]
 emb|CBI22393.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = +3

Query  306  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  485
            W  LIL     +  +  P   S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLV
Sbjct  9    WFLLILLA---WIRSPSPVRASGSEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLV  65

Query  486  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDAD  665
            SDGVS YAK+LLQADGWIVE I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDAD
Sbjct  66   SDGVSDYAKKLLQADGWIVELISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDAD  125

Query  666  TIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            TIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS+ VFNDMMSKV TL SY
Sbjct  126  TIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSETVFNDMMSKVKTLPSY  178



>gb|KDO49229.1| hypothetical protein CISIN_1g008931mg [Citrus sinensis]
Length=387

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LL NPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIV+KNIEDLFKC KFCAN
Sbjct  86   EKISLLENPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVIKNIEDLFKCRKFCAN  145

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  VFNDMM+KVNTL SY
Sbjct  146  LKHSERLNSGVMVVEPSAAVFNDMMTKVNTLGSY  179



>ref|XP_009599298.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
tomentosiformis]
Length=530

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 158/179 (88%), Gaps = 7/179 (4%)
 Frame = +3

Query  291  RFGVV-WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTK  467
            R GV+ +L  +LC     C  G   S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TK
Sbjct  7    RLGVLLFLIFMLCD----CFIGA--SCKSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTK  60

Query  468  DMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKV  647
            DMVVLVSDGVS YAK+LL ADGWIVE+I+LLANPNQVRPKRFWGVYTKLK+FNMT YKKV
Sbjct  61   DMVVLVSDGVSQYAKELLLADGWIVEKISLLANPNQVRPKRFWGVYTKLKVFNMTSYKKV  120

Query  648  VYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VYLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMV+EPS++VFNDMMSKV TL SY
Sbjct  121  VYLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVIEPSEKVFNDMMSKVTTLPSY  179



>ref|XP_007030331.1| Plant glycogenin-like starch initiation protein 6 isoform 2 [Theobroma 
cacao]
 gb|EOY10833.1| Plant glycogenin-like starch initiation protein 6 isoform 2 [Theobroma 
cacao]
Length=525

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            + ++L  + +  V G     SS  AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVS
Sbjct  10   ILVVLITIQSKAVLGTKVQSSSTNAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVS  69

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS YAK+LL+ADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADT
Sbjct  70   DGVSDYAKRLLKADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADT  129

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVK+IEDLFKC KFCANLKHSERLNSGVMVVEPS+ VFNDMM KVNTL SY
Sbjct  130  IVVKSIEDLFKCEKFCANLKHSERLNSGVMVVEPSEAVFNDMMGKVNTLPSY  181



>ref|XP_007030330.1| Plant glycogenin-like starch initiation protein 6 isoform 1 [Theobroma 
cacao]
 gb|EOY10832.1| Plant glycogenin-like starch initiation protein 6 isoform 1 [Theobroma 
cacao]
Length=536

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            + ++L  + +  V G     SS  AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVS
Sbjct  10   ILVVLITIQSKAVLGTKVQSSSTNAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVS  69

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS YAK+LL+ADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADT
Sbjct  70   DGVSDYAKRLLKADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADT  129

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVK+IEDLFKC KFCANLKHSERLNSGVMVVEPS+ VFNDMM KVNTL SY
Sbjct  130  IVVKSIEDLFKCEKFCANLKHSERLNSGVMVVEPSEAVFNDMMGKVNTLPSY  181



>gb|KJB82307.1| hypothetical protein B456_013G188300 [Gossypium raimondii]
Length=409

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G     SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+T+DMVVLVSDGVS YAK+LL+AD
Sbjct  24   GVKAQSSSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSTRDMVVLVSDGVSDYAKKLLKAD  83

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW+VE I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC K
Sbjct  84   GWMVEMISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKSIEDLFKCQK  143

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS+ VFNDMMSKVNTL SY
Sbjct  144  FCANLKHSERLNSGVMVVEPSEAVFNDMMSKVNTLPSY  181



>gb|KHG12487.1| Glycogenin-1 [Gossypium arboreum]
Length=542

 Score =   286 bits (731),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G     SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDGVS YAK+LL+AD
Sbjct  24   GVKAQSSSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDGVSDYAKKLLKAD  83

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GWIVE I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC K
Sbjct  84   GWIVEMISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKSIEDLFKCQK  143

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS+ VFNDMMSKVNTL SY
Sbjct  144  FCANLKHSERLNSGVMVVEPSEAVFNDMMSKVNTLPSY  181



>ref|XP_006437460.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50700.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
Length=548

 Score =   286 bits (731),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIV+KNIEDLFKC KFCAN
Sbjct  86   EKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVIKNIEDLFKCRKFCAN  145

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  VFNDMM+KVNTL SY
Sbjct  146  LKHSERLNSGVMVVEPSAAVFNDMMTKVNTLGSY  179



>ref|XP_002319122.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 ref|XP_006375861.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 gb|EEE95045.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 gb|ERP53658.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
Length=546

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  321  LCVLNNYCVAGE-PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV  497
            L +++  C+A    RSQ +EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD+VVLVSDGV
Sbjct  15   LNLISYTCLAASIQRSQRTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDIVVLVSDGV  74

Query  498  SSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVV  677
            S YAK+LL ADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVV
Sbjct  75   SDYAKKLLLADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVV  134

Query  678  KNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            K+IEDLFKC KFCANLKHSERLNSGVMVVEPS+ VFN+MMSKV TL SY
Sbjct  135  KSIEDLFKCAKFCANLKHSERLNSGVMVVEPSETVFNNMMSKVTTLPSY  183



>ref|XP_006484615.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Citrus 
sinensis]
Length=548

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIV+KNIEDLFKC KFCAN
Sbjct  86   EKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVIKNIEDLFKCRKFCAN  145

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  VFNDMM+KVNTL SY
Sbjct  146  LKHSERLNSGVMVVEPSAAVFNDMMTKVNTLGSY  179



>ref|XP_012089482.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Jatropha curcas]
Length=765

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 159/184 (86%), Gaps = 7/184 (4%)
 Frame = +3

Query  273  MGSFSGRFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRD  452
            +  FS  F VV L LI             RSQ +++AYVTLLYGDEFLLGVRVLGKSIRD
Sbjct  229  LSKFSALFIVVALVLIQS-------GASLRSQRTQQAYVTLLYGDEFLLGVRVLGKSIRD  281

Query  453  TGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMT  632
            TG+TKDMVVLVSDGVS YA +LL+ADGWIVE+I+LLANPN+VRPKRFWGVYTKLKIFNMT
Sbjct  282  TGSTKDMVVLVSDGVSDYAVKLLEADGWIVEKISLLANPNRVRPKRFWGVYTKLKIFNMT  341

Query  633  RYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNT  812
             YKKVVYLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS+ VF+DMMSKVNT
Sbjct  342  NYKKVVYLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSQLVFDDMMSKVNT  401

Query  813  LHSY  824
            LHSY
Sbjct  402  LHSY  405



>ref|XP_011038458.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 isoform X1 [Populus euphratica]
Length=549

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  321  LCVLNNYCVAGE-PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV  497
            L +++  C+A    RSQ +EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD+VVLVSDGV
Sbjct  15   LNLISYTCLAASIQRSQRTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDIVVLVSDGV  74

Query  498  SSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVV  677
            S YAK+LL ADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVV
Sbjct  75   SDYAKKLLLADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVV  134

Query  678  KNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            K+IEDLFKC KFCANLKHSERLNSGVMVVEPS+ VFN+MMSKV TL SY
Sbjct  135  KSIEDLFKCVKFCANLKHSERLNSGVMVVEPSETVFNNMMSKVTTLPSY  183



>ref|XP_011038459.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 isoform X2 [Populus euphratica]
Length=543

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  321  LCVLNNYCVAGE-PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV  497
            L +++  C+A    RSQ +EEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKD+VVLVSDGV
Sbjct  15   LNLISYTCLAASIQRSQRTEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDIVVLVSDGV  74

Query  498  SSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVV  677
            S YAK+LL ADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVV
Sbjct  75   SDYAKKLLLADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVV  134

Query  678  KNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            K+IEDLFKC KFCANLKHSERLNSGVMVVEPS+ VFN+MMSKV TL SY
Sbjct  135  KSIEDLFKCVKFCANLKHSERLNSGVMVVEPSETVFNNMMSKVTTLPSY  183



>ref|XP_008218517.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Prunus mume]
Length=510

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 152/180 (84%), Gaps = 6/180 (3%)
 Frame = +3

Query  303  VWLCLILCVL------NNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT  464
            VW  LI  VL      N    +   R Q+S EAYVTLLYGDEFLLGVRVLG SIRDTG+T
Sbjct  8    VWFVLIALVLAATIRPNGAFESSSSRHQTSTEAYVTLLYGDEFLLGVRVLGNSIRDTGST  67

Query  465  KDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKK  644
            KDMV LVSDGVS+YA +LL+ADGWIVE+I+LLANPNQVRP RFWGVYTKLKIFNMT YKK
Sbjct  68   KDMVALVSDGVSNYAMKLLEADGWIVEKISLLANPNQVRPSRFWGVYTKLKIFNMTNYKK  127

Query  645  VVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VVYLDADTIVVKNIEDLFKC KFCANLKHSERLNSGVMVVEPS+ VFNDMM +V+TL SY
Sbjct  128  VVYLDADTIVVKNIEDLFKCSKFCANLKHSERLNSGVMVVEPSETVFNDMMRQVSTLPSY  187



>gb|KJB82306.1| hypothetical protein B456_013G188300 [Gossypium raimondii]
Length=542

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G     SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+T+DMVVLVSDGVS YAK+LL+AD
Sbjct  24   GVKAQSSSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSTRDMVVLVSDGVSDYAKKLLKAD  83

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW+VE I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC K
Sbjct  84   GWMVEMISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKSIEDLFKCQK  143

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS+ VFNDMMSKVNTL SY
Sbjct  144  FCANLKHSERLNSGVMVVEPSEAVFNDMMSKVNTLPSY  181



>gb|KDO49228.1| hypothetical protein CISIN_1g008931mg [Citrus sinensis]
Length=548

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGWIV
Sbjct  26   SQSTDQAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWIV  85

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LL NPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIV+KNIEDLFKC KFCAN
Sbjct  86   EKISLLENPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVIKNIEDLFKCRKFCAN  145

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  VFNDMM+KVNTL SY
Sbjct  146  LKHSERLNSGVMVVEPSAAVFNDMMTKVNTLGSY  179



>ref|XP_010102196.1| hypothetical protein L484_024477 [Morus notabilis]
 gb|EXB93139.1| hypothetical protein L484_024477 [Morus notabilis]
Length=561

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +3

Query  303  VWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVL  482
            V + L L  + +  V G PR Q S+EAYVTLLYGDEFLLGVRVLGKSIRDT +TKDMVVL
Sbjct  9    VLVTLALVWIPSNGVFGSPR-QKSDEAYVTLLYGDEFLLGVRVLGKSIRDTRSTKDMVVL  67

Query  483  VSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDA  662
            VSDGVS YA +LL+ADGWIV +I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDA
Sbjct  68   VSDGVSDYAMKLLEADGWIVTKISLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDA  127

Query  663  DTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            DTIVVK+IEDLFKCGKFCANLKHSERLNSGVMVVE S++VF+DMMSKVNTL SY
Sbjct  128  DTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVVESSQKVFDDMMSKVNTLESY  181



>gb|KHN31485.1| Glycogenin-1 [Glycine soja]
Length=551

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 154/179 (86%), Gaps = 8/179 (4%)
 Frame = +3

Query  306  WLCLIL------CVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTK  467
            WLC IL      CV    CVA   +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ K
Sbjct  9    WLCSILVCIVLVCVQFEGCVAS--KTKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNK  66

Query  468  DMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKV  647
            DMVVLVSDGVS YAK LL+ADGWIVE I+LLANPN+VRPKRFWGVYTKLKIFNMT YKKV
Sbjct  67   DMVVLVSDGVSDYAKSLLRADGWIVEMISLLANPNRVRPKRFWGVYTKLKIFNMTDYKKV  126

Query  648  VYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VYLDADTIVV+NI+DLFKCGKFCANLKHSERLNSGVMVVEPS  +FNDMMSK+ T  SY
Sbjct  127  VYLDADTIVVRNIDDLFKCGKFCANLKHSERLNSGVMVVEPSATLFNDMMSKIKTTASY  185



>ref|XP_006604859.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Glycine max]
Length=551

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 153/177 (86%), Gaps = 4/177 (2%)
 Frame = +3

Query  306  WLCLILCVLNNYCVAGE----PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  473
            WLC IL  +   CV  E     +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ KDM
Sbjct  9    WLCSILFCIVLVCVQFEGCVGSKTKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNKDM  68

Query  474  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVY  653
            VVLVSDGVS YAK LL+ADGWIVE I+LLANPN+VRPKRFWGVYTKLKIFNMT YKKVVY
Sbjct  69   VVLVSDGVSDYAKSLLRADGWIVEMISLLANPNRVRPKRFWGVYTKLKIFNMTDYKKVVY  128

Query  654  LDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LDADTIVVKNI+DLFKCGKFCANLKHSERLNSGVMVVEPS  +FNDMMSK+ T  SY
Sbjct  129  LDADTIVVKNIDDLFKCGKFCANLKHSERLNSGVMVVEPSATLFNDMMSKIKTTASY  185



>ref|XP_006604858.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Glycine max]
Length=552

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 153/177 (86%), Gaps = 4/177 (2%)
 Frame = +3

Query  306  WLCLILCVLNNYCVAGE----PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  473
            WLC IL  +   CV  E     +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ KDM
Sbjct  9    WLCSILFCIVLVCVQFEGCVGSKTKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNKDM  68

Query  474  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVY  653
            VVLVSDGVS YAK LL+ADGWIVE I+LLANPN+VRPKRFWGVYTKLKIFNMT YKKVVY
Sbjct  69   VVLVSDGVSDYAKSLLRADGWIVEMISLLANPNRVRPKRFWGVYTKLKIFNMTDYKKVVY  128

Query  654  LDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LDADTIVVKNI+DLFKCGKFCANLKHSERLNSGVMVVEPS  +FNDMMSK+ T  SY
Sbjct  129  LDADTIVVKNIDDLFKCGKFCANLKHSERLNSGVMVVEPSATLFNDMMSKIKTTASY  185



>ref|XP_011101631.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Sesamum indicum]
Length=785

 Score =   287 bits (734),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G   SQ+SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS+YAK+LLQAD
Sbjct  26   GALGSQNSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSNYAKKLLQAD  85

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GWIV+ I+LL NPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC K
Sbjct  86   GWIVKTISLLENPNQVRPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCQK  145

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS+EVF DMM+KVNT++SY
Sbjct  146  FCANLKHSERLNSGVMVVEPSEEVFKDMMTKVNTMYSY  183



>ref|XP_004152810.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Cucumis sativus]
Length=545

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +3

Query  375  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            +EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV L+SDGVS YAK+LL+ADGWIVE+I+
Sbjct  35   DEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVALISDGVSEYAKKLLEADGWIVEKIS  94

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
            LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC KFCANLKHS
Sbjct  95   LLANPNQVRPSRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCSKFCANLKHS  154

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ERLNSGVMVVEPS+ +FNDMMSKVNTL SY
Sbjct  155  ERLNSGVMVVEPSETIFNDMMSKVNTLPSY  184



>gb|ABZ89190.1| hypothetical protein 46C02.16 [Coffea canephora]
Length=546

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
             S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YAK+LL+ADGWIVE
Sbjct  36   SSKGEAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSDYAKKLLKADGWIVE  95

Query  546  EITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANL  725
            +I+LLANPNQVRPKRFWGVYTKLKIFNMT+YKKVVYLDADTIVVKNI+DLFKC KFCANL
Sbjct  96   KISLLANPNQVRPKRFWGVYTKLKIFNMTKYKKVVYLDADTIVVKNIDDLFKCRKFCANL  155

Query  726  KHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            KHSERLNSGVMVVEPS+EVF DMM +VNTL SY
Sbjct  156  KHSERLNSGVMVVEPSEEVFKDMMRQVNTLPSY  188



>emb|CDO99980.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
             S  EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YAK+LL+ADGWIVE
Sbjct  36   SSKGEAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSHYAKKLLKADGWIVE  95

Query  546  EITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANL  725
            +I+LLANPNQVRPKRFWGVYTKLKIFNMT+YKKVVYLDADTIVVKNI+DLFKC KFCANL
Sbjct  96   KISLLANPNQVRPKRFWGVYTKLKIFNMTKYKKVVYLDADTIVVKNIDDLFKCRKFCANL  155

Query  726  KHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            KHSERLNSGVMVVEPS+EVF DMM +VNTL SY
Sbjct  156  KHSERLNSGVMVVEPSEEVFKDMMRQVNTLPSY  188



>gb|EPS68223.1| hypothetical protein M569_06549, partial [Genlisea aurea]
Length=515

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +3

Query  312  CLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSD  491
            CLI        VAG   SQ+S EAYVTLLYGDEFLLGVRVLGKSIRD+G+TKDMV LVSD
Sbjct  4    CLIAAGFGWKGVAG---SQNSGEAYVTLLYGDEFLLGVRVLGKSIRDSGSTKDMVALVSD  60

Query  492  GVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTI  671
            GVS YAK+LLQADGWIV  I+LL NPNQVRPKRFWGVYTKLKIFNMT Y+KVVYLDADTI
Sbjct  61   GVSDYAKKLLQADGWIVRAISLLENPNQVRPKRFWGVYTKLKIFNMTNYRKVVYLDADTI  120

Query  672  VVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VVKNI+DLFKC KFCANLKHSERLNSGVMVVEPS++VF DM++K++T++SY
Sbjct  121  VVKNIDDLFKCHKFCANLKHSERLNSGVMVVEPSEDVFKDMIAKISTMYSY  171



>ref|XP_006606473.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Glycine max]
Length=517

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S+ ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YA  LLQADGWIV
Sbjct  23   SERTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYANTLLQADGWIV  82

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIE+LFKCGKFCAN
Sbjct  83   EKISLLANPNQVRPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEELFKCGKFCAN  142

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVV+PS  VFNDMMSKV TL SY
Sbjct  143  LKHSERLNSGVMVVQPSATVFNDMMSKVKTLPSY  176



>ref|XP_009384656.1| PREDICTED: LOW QUALITY PROTEIN: putative glucuronosyltransferase 
PGSIP6 [Musa acuminata subsp. malaccensis]
Length=544

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 155/172 (90%), Gaps = 4/172 (2%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            L ++L VL    V+G  R+++ E+AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVS
Sbjct  11   LMMVLVVLG---VSGCGRAKT-EDAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVS  66

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS YAK+LL ADGWIV+ I+LLANPN VRPKRFWGVYTKLKIFNMT Y+KVVYLDADT
Sbjct  67   DGVSEYAKKLLDADGWIVQHISLLANPNHVRPKRFWGVYTKLKIFNMTDYRKVVYLDADT  126

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVK+IEDLFKCGKFCANLKHSERLNSGVMVVEPS+  F DMMS+VN+L+SY
Sbjct  127  IVVKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSESTFRDMMSQVNSLYSY  178



>ref|XP_009401946.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 157/184 (85%), Gaps = 6/184 (3%)
 Frame = +3

Query  273  MGSFSGRFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRD  452
            MGS   R G  +L ++L VL      G  R+++ E+AYVTLLYGDEFLLGVRVLGKSIRD
Sbjct  1    MGSPVARLG--FLAMVLLVLG---ATGCGRAKT-EDAYVTLLYGDEFLLGVRVLGKSIRD  54

Query  453  TGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMT  632
            TG+TKDMVVLVSDGVS YA +LL ADGWIVE I+LLANPN VRP RFWGVYTKLKIFNMT
Sbjct  55   TGSTKDMVVLVSDGVSDYAMKLLHADGWIVEHISLLANPNHVRPTRFWGVYTKLKIFNMT  114

Query  633  RYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNT  812
             Y+KVVYLDADTIV+K+IEDLFKCGKFCANLKHSERLNSGVMVVEPS+  F DMMS+VN+
Sbjct  115  NYRKVVYLDADTIVIKSIEDLFKCGKFCANLKHSERLNSGVMVVEPSESTFKDMMSQVNS  174

Query  813  LHSY  824
            L+SY
Sbjct  175  LYSY  178



>ref|XP_008441775.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Cucumis melo]
Length=546

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +3

Query  375  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            +EAYVTLLYGDEFLLGVRVLGKSIRDTG++KDMV L+SDGVS YAK+LL+ADGWIVE+I+
Sbjct  35   DEAYVTLLYGDEFLLGVRVLGKSIRDTGSSKDMVALISDGVSEYAKRLLEADGWIVEKIS  94

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
            LLANPNQVRP RFWGVYTKLKIFNMT Y+KVVYLDADTIV+KNIEDLFKC KFCANLKHS
Sbjct  95   LLANPNQVRPSRFWGVYTKLKIFNMTDYRKVVYLDADTIVLKNIEDLFKCSKFCANLKHS  154

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ERLNSGVMVVEPS+ +FNDMMSKVNTL SY
Sbjct  155  ERLNSGVMVVEPSETIFNDMMSKVNTLPSY  184



>ref|XP_003556480.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Glycine max]
 gb|KHN14713.1| Glycogenin-1 [Glycine soja]
Length=541

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S+ ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YA  LLQADGWIV
Sbjct  23   SERTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYANTLLQADGWIV  82

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIE+LFKCGKFCAN
Sbjct  83   EKISLLANPNQVRPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEELFKCGKFCAN  142

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVV+PS  VFNDMMSKV TL SY
Sbjct  143  LKHSERLNSGVMVVQPSATVFNDMMSKVKTLPSY  176



>ref|XP_010675056.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   278 bits (712),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = +3

Query  315  LILCVL---NNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  485
            LILC L   ++       RSQS++EAYVTLLYGDEF+LGVRVLGKSIRDTG+ KDMVVLV
Sbjct  13   LILCFLLLQSSILRIDAKRSQSTKEAYVTLLYGDEFVLGVRVLGKSIRDTGSKKDMVVLV  72

Query  486  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDAD  665
            SDGVS YAK LL+ADGWIVE I+LL NPN+VRP RFWGVYTKLKIFNMT Y+KVVYLDAD
Sbjct  73   SDGVSDYAKTLLEADGWIVEMISLLQNPNRVRPTRFWGVYTKLKIFNMTNYEKVVYLDAD  132

Query  666  TIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            TIV+KNIEDLFKCGKFCANLKHSERLNSGV+VVEPSK +FNDM+ KV TL SY
Sbjct  133  TIVIKNIEDLFKCGKFCANLKHSERLNSGVLVVEPSKMLFNDMLKKVGTLPSY  185



>ref|XP_008366883.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Malus domestica]
Length=549

 Score =   278 bits (712),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS YA +LLQADGWI
Sbjct  33   RRQTSVEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSDYAMKLLQADGWI  92

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            VE+I+LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC KFCA
Sbjct  93   VEKISLLANPNQVRPTRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKSIEDLFKCSKFCA  152

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  153  NLKHSERLNSGVMVVEPSETLFNDMMRKVTTLPSY  187



>ref|XP_009379742.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Pyrus x bretschneideri]
Length=549

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS YA +LLQADGWI
Sbjct  33   RRQTSVEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSDYAMKLLQADGWI  92

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            VE+I+LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADT+VVK+IEDLFKC KFCA
Sbjct  93   VEKISLLANPNQVRPTRFWGVYTKLKIFNMTNYKKVVYLDADTVVVKSIEDLFKCSKFCA  152

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  153  NLKHSERLNSGVMVVEPSETLFNDMMRKVTTLPSY  187



>ref|XP_007143949.1| hypothetical protein PHAVU_007G116100g [Phaseolus vulgaris]
 gb|ESW15943.1| hypothetical protein PHAVU_007G116100g [Phaseolus vulgaris]
Length=551

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S+ S+ AYVTLLYGDEFLLG+RVLGKSIRDTG+ KDMVVLVSDGVS YA  +L+ADGWI+
Sbjct  32   SERSDVAYVTLLYGDEFLLGIRVLGKSIRDTGSNKDMVVLVSDGVSDYANNVLKADGWII  91

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKCGKFCAN
Sbjct  92   EKISLLANPNQVRPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCGKFCAN  151

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVV+PS  VFNDMMSK+NTL SY
Sbjct  152  LKHSERLNSGVMVVQPSAAVFNDMMSKINTLPSY  185



>gb|KCW61484.1| hypothetical protein EUGRSUZ_H04216 [Eucalyptus grandis]
Length=395

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            R  S  EAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV+ YAK+LL+ADGWI
Sbjct  34   RPSSLGEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVTDYAKKLLKADGWI  93

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            VE+I+LLANPNQ RP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC KFCA
Sbjct  94   VEKISLLANPNQKRPARFWGVYTKLKIFNMTSYKKVVYLDADTIVVKSIEDLFKCEKFCA  153

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSERLNSGVMVVEPS+ +FNDM+ KV TL SY
Sbjct  154  NLKHSERLNSGVMVVEPSETLFNDMIGKVQTLPSY  188



>ref|XP_008370762.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Malus domestica]
Length=549

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVSDGVS+YA +LLQADGWI
Sbjct  33   RRQTSPEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSNYAMKLLQADGWI  92

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            VE+I+LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADT+VVK+IEDLFKC KFCA
Sbjct  93   VEKISLLANPNQVRPTRFWGVYTKLKIFNMTNYKKVVYLDADTVVVKSIEDLFKCSKFCA  152

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSERLNSGVMVVEPS+ +FNDMM +V TL SY
Sbjct  153  NLKHSERLNSGVMVVEPSETLFNDMMRQVTTLPSY  187



>ref|XP_008807617.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Phoenix dactylifera]
 ref|XP_008807625.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Phoenix dactylifera]
Length=544

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  321  LCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVS  500
            L VL    +AG   +++ +EAYVTLLYGDEFLLGVRVLGKSIRDT +TKDMVVLVSDGVS
Sbjct  11   LAVLVAALMAGSCWAKT-DEAYVTLLYGDEFLLGVRVLGKSIRDTRSTKDMVVLVSDGVS  69

Query  501  SYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVK  680
             YAK+LLQADGWIVE I+LLANPN VRPKRFWGVYTKLKIFN+T+Y+KVVYLDADTIV+K
Sbjct  70   DYAKKLLQADGWIVEPISLLANPNLVRPKRFWGVYTKLKIFNLTKYRKVVYLDADTIVLK  129

Query  681  NIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NI+DLF CG+FCANLKHSERLNSGVMVVEPS+ VF DMMSKVNTL SY
Sbjct  130  NIDDLFNCGRFCANLKHSERLNSGVMVVEPSENVFEDMMSKVNTLSSY  177



>ref|XP_010247242.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Nelumbo nucifera]
Length=546

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 151/178 (85%), Gaps = 6/178 (3%)
 Frame = +3

Query  291  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKD  470
            RF VV   L L  L +  +       S +EAY TLLYGDEFLLGVRVLGKSIRDT TTKD
Sbjct  9    RFLVVLFALFLFGLTDRVLG------SQKEAYATLLYGDEFLLGVRVLGKSIRDTRTTKD  62

Query  471  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVV  650
            MVVLVSDGVS YAK+LL+ADGWIVE I+LLANPNQVRPKRFWGVYTKLKIFNMT YKKVV
Sbjct  63   MVVLVSDGVSDYAKKLLKADGWIVEPISLLANPNQVRPKRFWGVYTKLKIFNMTDYKKVV  122

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIV+K+IEDLFKCGKFCANLKHSER+NSGVMVVEPS E FNDMMS+V TL SY
Sbjct  123  YLDADTIVLKSIEDLFKCGKFCANLKHSERMNSGVMVVEPSVERFNDMMSQVTTLPSY  180



>ref|XP_009343790.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Pyrus x bretschneideri]
Length=549

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            R Q+S EAYVTLLYGDEFLLGVRVLGKSIRDTG TKDMV LVSDGVS+YA +LL+ADGWI
Sbjct  33   RRQTSPEAYVTLLYGDEFLLGVRVLGKSIRDTGATKDMVALVSDGVSNYAMKLLRADGWI  92

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            VE+I+LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC KFCA
Sbjct  93   VEKISLLANPNQVRPTRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKSIEDLFKCSKFCA  152

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSERLNSGVMVVEPS+ +FNDMM +V TL SY
Sbjct  153  NLKHSERLNSGVMVVEPSETLFNDMMRQVTTLPSY  187



>ref|NP_197349.2| plant glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 sp|Q8GWB7.1|GUX6_ARATH RecName: Full=Inositol phosphorylceramide glucuronosyltransferase 
1; AltName: Full=Glycogenin-like protein 6; AltName: Full=Plant 
glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 dbj|BAC43531.1| unknown protein [Arabidopsis thaliana]
 gb|AED92569.1| plant glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 gb|AHL38620.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=537

 Score =   275 bits (704),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            L ++L  L +  + G   S+SS+ AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVS
Sbjct  8    LWVLLLALVSIQLNGSFGSESSKVAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVS  67

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS Y+K+LL+ADGW VE+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADT
Sbjct  68   DGVSDYSKKLLKADGWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADT  127

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVKNIEDLFKC KFCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  128  IVVKNIEDLFKCSKFCANLKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  179



>gb|AAL58891.1|AF462795_1 AT5g18480/F20L16_200 [Arabidopsis thaliana]
 gb|AAN28860.1| At5g18480/F20L16_200 [Arabidopsis thaliana]
Length=537

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            L ++L  L +  + G   S+SS+ AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMV LVS
Sbjct  8    LWVLLLALVSIQLNGSFGSESSKVAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVS  67

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS Y+K+LL+ADGW VE+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADT
Sbjct  68   DGVSDYSKKLLKADGWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADT  127

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVKNIEDLFKC KFCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  128  IVVKNIEDLFKCSKFCANLKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  179



>ref|XP_006400396.1| hypothetical protein EUTSA_v10013196mg [Eutrema salsugineum]
 gb|ESQ41849.1| hypothetical protein EUTSA_v10013196mg [Eutrema salsugineum]
Length=540

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = +3

Query  303  VWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVL  482
            +W+ L    L +  + G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ +DMV L
Sbjct  8    LWVILFSIALVSIQMKGSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNRDMVAL  67

Query  483  VSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDA  662
            VSDGVS Y+K+LL+ADGW VE+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDA
Sbjct  68   VSDGVSGYSKKLLKADGWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTNYKKVVYLDA  127

Query  663  DTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            DTIVVKNI+DLFKC KFCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  128  DTIVVKNIDDLFKCSKFCANLKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  181



>emb|CAH67224.1| OSIGBa0145M07.6 [Oryza sativa Indica Group]
Length=372

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV  I
Sbjct  32   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVSHI  91

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRPKRFWGVYTKLKIFNMT Y+KVVYLDADT+VVK+IEDLFKCGKFC NLKH
Sbjct  92   TLLANPNQVRPKRFWGVYTKLKIFNMTSYRKVVYLDADTVVVKSIEDLFKCGKFCGNLKH  151

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ VF DMM +++TL SY
Sbjct  152  SERMNSGVMVVEPSETVFKDMMRQIDTLPSY  182



>ref|XP_004302108.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Fragaria vesca subsp. vesca]
Length=539

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
            Q + EAYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDGVS YA  LL+ADGWIVE
Sbjct  29   QRTPEAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDGVSGYAMSLLKADGWIVE  88

Query  546  EITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANL  725
            +I+LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK++EDLF+C KFCANL
Sbjct  89   KISLLANPNQVRPTRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKSVEDLFECSKFCANL  148

Query  726  KHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            KHSERLNSGVMVVEPS+ VF DMM KV TL SY
Sbjct  149  KHSERLNSGVMVVEPSERVFQDMMGKVTTLESY  181



>ref|XP_007205021.1| hypothetical protein PRUPE_ppa003817mg [Prunus persica]
 gb|EMJ06220.1| hypothetical protein PRUPE_ppa003817mg [Prunus persica]
Length=546

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +3

Query  378  EAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITL  557
            EAYVTLLYGDEFLLGVRVLG SIRDTG+TKDMV LVSDGVS+YA +LL+ADGWIVE+I+L
Sbjct  36   EAYVTLLYGDEFLLGVRVLGNSIRDTGSTKDMVALVSDGVSNYAMKLLEADGWIVEKISL  95

Query  558  LANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSE  737
            LANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC KFCANLKHSE
Sbjct  96   LANPNQVRPSRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKNIEDLFKCSKFCANLKHSE  155

Query  738  RLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            RLNSGVMVVEPS+ VFNDMM +V+TL SY
Sbjct  156  RLNSGVMVVEPSETVFNDMMRQVSTLPSY  184



>ref|XP_010485804.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW +
Sbjct  28   SASTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKI  87

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+D+FKC KFCAN
Sbjct  88   EKISLLANPNQVHPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDMFKCSKFCAN  147

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  148  LKHSERLNSGVMVVEPSEALFNDMMKKVKTLSSY  181



>ref|XP_010024933.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Eucalyptus 
grandis]
Length=538

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            R  S  EAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGV+ YAK+LL+ADGWI
Sbjct  34   RPSSLGEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVTDYAKKLLKADGWI  93

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            VE+I+LLANPNQ RP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC KFCA
Sbjct  94   VEKISLLANPNQKRPARFWGVYTKLKIFNMTSYKKVVYLDADTIVVKSIEDLFKCEKFCA  153

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSERLNSGVMVVEPS+ +FNDM+ KV TL SY
Sbjct  154  NLKHSERLNSGVMVVEPSETLFNDMIGKVQTLPSY  188



>ref|XP_009126256.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=533

 Score =   273 bits (697),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  315  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  494
            L L V +   + G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDG
Sbjct  11   LWLLVFSIALLKGSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDG  70

Query  495  VSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIV  674
            VS Y+K+LL+ADGW VE+I+LLANPNQV P RFWGVYTKLKIFNMT Y KVVYLDADTIV
Sbjct  71   VSDYSKKLLKADGWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYNKVVYLDADTIV  130

Query  675  VKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VKNI+DLFKC KFCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  131  VKNIDDLFKCSKFCANLKHSERLNSGVMVVEPSQALFNDMMRKVKTLSSY  180



>ref|XP_010922963.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Elaeis guineensis]
Length=543

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+TKDMVVLVSDGVS +AK+LL+ADGWIVE I
Sbjct  27   TDGAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVVLVSDGVSDHAKKLLRADGWIVEPI  86

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            +LLANPNQVRPKRFWGVYTKLKIFN+T Y+KVVYLDADTIV+KNI+DLF CG+FCANLKH
Sbjct  87   SLLANPNQVRPKRFWGVYTKLKIFNLTSYRKVVYLDADTIVLKNIDDLFNCGRFCANLKH  146

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SERLNSGVMVVEPS+ VF DMMSKVN+L SY
Sbjct  147  SERLNSGVMVVEPSETVFKDMMSKVNSLPSY  177



>ref|XP_010463911.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW +
Sbjct  28   SESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKI  87

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+D+FKC KFCAN
Sbjct  88   EKISLLANPNQVHPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDMFKCSKFCAN  147

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM +V TL SY
Sbjct  148  LKHSERLNSGVMVVEPSEALFNDMMKQVKTLSSY  181



>emb|CDX88935.1| BnaA03g07140D [Brassica napus]
Length=534

 Score =   273 bits (697),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+AD
Sbjct  21   GSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKAD  80

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW VE+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+DLFKC K
Sbjct  81   GWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDLFKCSK  140

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  141  FCANLKHSERLNSGVMVVEPSQALFNDMMRKVKTLSSY  178



>ref|XP_010413938.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   273 bits (697),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW +
Sbjct  28   SASTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKI  87

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+D+FKC KFCAN
Sbjct  88   EKISLLANPNQVHPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDMFKCSKFCAN  147

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  148  LKHSERLNSGVMVVEPSEALFNDMMMKVKTLSSY  181



>emb|CDY58112.1| BnaA02g35140D [Brassica napus]
Length=530

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            LCL+L  +    + G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVS
Sbjct  8    LCLLLFSIA--LLKGSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVS  65

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS Y+K LL+ADGW VE I+LLANPNQV P RFWGVYTKLKIFNMT Y KVVYLDADT
Sbjct  66   DGVSDYSKNLLKADGWKVERISLLANPNQVHPTRFWGVYTKLKIFNMTDYNKVVYLDADT  125

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVKNI+DLFKC KFCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  126  IVVKNIDDLFKCSKFCANLKHSERLNSGVMVVEPSQALFNDMMRKVKTLSSY  177



>ref|XP_006297372.1| hypothetical protein CARUB_v10013391mg [Capsella rubella]
 gb|EOA30270.1| hypothetical protein CARUB_v10013391mg [Capsella rubella]
Length=548

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW  
Sbjct  28   SESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYSKKLLKADGWKA  87

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+D+FKC KFCAN
Sbjct  88   EKISLLANPNQVHPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDMFKCSKFCAN  147

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  148  LKHSERLNSGVMVVEPSEALFNDMMKKVKTLSSY  181



>ref|XP_002522004.1| glycogenin, putative [Ricinus communis]
 gb|EEF40408.1| glycogenin, putative [Ricinus communis]
Length=776

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            R Q +++AYVTLLYGDEFLLGVRVLGKSI+DTG+ KD VVLVSDGVS YA +LL+ADGWI
Sbjct  264  RLQKTDKAYVTLLYGDEFLLGVRVLGKSIKDTGSKKDRVVLVSDGVSDYAMKLLEADGWI  323

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            VE+ITLLANPNQ RPKRFWGVYTKLKIFNMT Y+KVV+LDADTIVV++IEDLFKCGKFCA
Sbjct  324  VEKITLLANPNQARPKRFWGVYTKLKIFNMTNYRKVVFLDADTIVVRSIEDLFKCGKFCA  383

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSER NSGVMV+EPS+ VFNDMMSKVNTLHSY
Sbjct  384  NLKHSERFNSGVMVLEPSQSVFNDMMSKVNTLHSY  418



>ref|XP_002873897.1| hypothetical protein ARALYDRAFT_488728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50156.1| hypothetical protein ARALYDRAFT_488728 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  315  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  494
            L+L ++++  + G   S+ S+ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDG
Sbjct  11   LLLALVSSIQLKGSFGSEPSKVAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVALVSDG  70

Query  495  VSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIV  674
            VS Y+K+LL+ADGW VE+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIV
Sbjct  71   VSDYSKKLLKADGWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIV  130

Query  675  VKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VKNIEDLFKC KFCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  131  VKNIEDLFKCSKFCANLKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  180



>emb|CDY21129.1| BnaA01g33600D [Brassica napus]
Length=546

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G   SQS+ EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL AD
Sbjct  22   GSFASQSTNEAYVTLLYGDEFLLGVRVLGKSIRDTGSHKDMVVLVSDGVSDYSKKLLMAD  81

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW VE+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC K
Sbjct  82   GWKVEKISLLANPNQVHPKRFWGVYTKLKIFNMTAYKKVVYLDADTIVVKNIEDLFKCSK  141

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS  +F+DM+ +V TL SY
Sbjct  142  FCANLKHSERLNSGVMVVEPSAALFDDMVKQVKTLSSY  179



>ref|XP_010420611.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=535

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  24   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  83

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC KFCAN
Sbjct  84   EKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCSKFCAN  143

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  144  LKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  177



>gb|ABR16625.1| unknown [Picea sitchensis]
Length=567

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  357  PRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGW  536
            PRS+ + EAY TLLYGDEFLLGVRVLGKSIRDTGTT+DMV LVSDGVS YA QLLQADGW
Sbjct  39   PRSRKTLEAYATLLYGDEFLLGVRVLGKSIRDTGTTRDMVALVSDGVSPYAVQLLQADGW  98

Query  537  IVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
            IVE I LLANPNQ RPKRFWGVYTKLKIFNMT YKKVVYLDADT+V+++I+DLF+C KFC
Sbjct  99   IVEHIGLLANPNQKRPKRFWGVYTKLKIFNMTNYKKVVYLDADTVVLRSIDDLFQCRKFC  158

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ANLKHSERLNSGVMVVEPS+ VF DMM+KV TL SY
Sbjct  159  ANLKHSERLNSGVMVVEPSESVFKDMMAKVTTLPSY  194



>ref|XP_009125000.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=546

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G   SQS+ EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL AD
Sbjct  22   GSFASQSTNEAYVTLLYGDEFLLGVRVLGKSIRDTGSHKDMVVLVSDGVSDYSKKLLMAD  81

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW VE+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC K
Sbjct  82   GWKVEKISLLANPNQVHPKRFWGVYTKLKIFNMTAYKKVVYLDADTIVVKNIEDLFKCSK  141

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS  +F+DM+ +V TL SY
Sbjct  142  FCANLKHSERLNSGVMVVEPSAALFDDMVKQVKTLSSY  179



>ref|XP_010492852.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Camelina sativa]
Length=535

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  24   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  83

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC KFCAN
Sbjct  84   EKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCSKFCAN  143

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  144  LKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  177



>emb|CAE05448.4| OSJNBa0073E02.8 [Oryza sativa Japonica Group]
Length=479

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV  I
Sbjct  32   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVSHI  91

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRPKRFWGVYTKLKIFNMT Y+KVVYLDADT+VVK+IEDLFKCGKFC NLKH
Sbjct  92   TLLANPNQVRPKRFWGVYTKLKIFNMTSYRKVVYLDADTVVVKSIEDLFKCGKFCGNLKH  151

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ VF DMM +++TL SY
Sbjct  152  SERMNSGVMVVEPSETVFKDMMRQIDTLPSY  182



>ref|XP_010454088.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=535

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  24   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  83

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC KFCAN
Sbjct  84   EKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCSKFCAN  143

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  144  LKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  177



>ref|XP_010558734.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Tarenaya hassleriana]
Length=549

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = +3

Query  306  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  485
            W+ LI   L +        SQS+++AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLV
Sbjct  9    WVFLISIALLSTQFGVSVGSQSTKQAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLV  68

Query  486  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDAD  665
            SDGVS Y+K+LL+ADGW VE+I+LL NPNQV PKRFWGVYTKLKIFNMT Y KVVYLDAD
Sbjct  69   SDGVSDYSKKLLKADGWKVEKISLLENPNQVHPKRFWGVYTKLKIFNMTEYTKVVYLDAD  128

Query  666  TIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            TIVVKNIEDLFKC KFCANLKHSERLNSGVMVVEPS+ +FNDMM +V TL SY
Sbjct  129  TIVVKNIEDLFKCSKFCANLKHSERLNSGVMVVEPSEALFNDMMRQVKTLSSY  181



>ref|XP_002446789.1| hypothetical protein SORBIDRAFT_06g022680 [Sorghum bicolor]
 gb|EES11117.1| hypothetical protein SORBIDRAFT_06g022680 [Sorghum bicolor]
Length=536

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LGVRVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  28   TEEAYVTLLYGDEFVLGVRVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  87

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKCGKFC NLKH
Sbjct  88   TLLANPNQVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKSIEDLFKCGKFCGNLKH  147

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ +FNDM++KV  L SY
Sbjct  148  SERMNSGVMVVEPSETLFNDMINKVGQLPSY  178



>gb|EYU19884.1| hypothetical protein MIMGU_mgv1a004141mg [Erythranthe guttata]
Length=542

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
            QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS  A++ LQADGWIV+
Sbjct  32   QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVALVSDGVSLSAQKQLQADGWIVK  91

Query  546  EITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANL  725
             I+LL NPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKC KFCANL
Sbjct  92   TISLLENPNQVRPTRFWGVYTKLKIFNMTEYKKVVYLDADTIVVKSIEDLFKCRKFCANL  151

Query  726  KHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            KHSERLNSGVMVVEPS +VF DMM+KVNT++SY
Sbjct  152  KHSERLNSGVMVVEPSGQVFKDMMTKVNTMYSY  184



>ref|XP_006287478.1| hypothetical protein CARUB_v10000689mg [Capsella rubella]
 gb|EOA20376.1| hypothetical protein CARUB_v10000689mg [Capsella rubella]
Length=531

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S  SEEAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+ADGW V
Sbjct  23   SFGSEEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKADGWKV  82

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+DLFKC KFCAN
Sbjct  83   EKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDLFKCSKFCAN  142

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  143  LKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSY  176



>gb|EEC77645.1| hypothetical protein OsI_16652 [Oryza sativa Indica Group]
 gb|EEE61342.1| hypothetical protein OsJ_15472 [Oryza sativa Japonica Group]
Length=544

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV  I
Sbjct  32   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVSHI  91

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRPKRFWGVYTKLKIFNMT Y+KVVYLDADT+VVK+IEDLFKCGKFC NLKH
Sbjct  92   TLLANPNQVRPKRFWGVYTKLKIFNMTSYRKVVYLDADTVVVKSIEDLFKCGKFCGNLKH  151

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ VF DMM +++TL SY
Sbjct  152  SERMNSGVMVVEPSETVFKDMMRQIDTLPSY  182



>gb|KFK37856.1| hypothetical protein AALP_AA3G038100 [Arabis alpina]
Length=545

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S S++EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL+ADGW V
Sbjct  25   SVSTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSKKDMVVLVSDGVSQYSKKLLKADGWKV  84

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC KFCAN
Sbjct  85   EKISLLANPNQVHPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCSKFCAN  144

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDM+ +V TL SY
Sbjct  145  LKHSERLNSGVMVVEPSEALFNDMVKQVKTLSSY  178



>ref|XP_006653601.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Oryza 
brachyantha]
Length=539

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +D+VVLVSDGVS Y+++LLQADGWIV+ I
Sbjct  27   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDLVVLVSDGVSDYSRKLLQADGWIVKHI  86

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRPKRFWGVYTKLKIFNMT Y+KVVYLDADT+VVK+IEDLFKCGKFC NLKH
Sbjct  87   TLLANPNQVRPKRFWGVYTKLKIFNMTSYRKVVYLDADTVVVKSIEDLFKCGKFCGNLKH  146

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ VF DMM ++++L SY
Sbjct  147  SERMNSGVMVVEPSETVFKDMMRQIDSLPSY  177



>gb|AIL52751.1| putative glucuronosyltransferase PGSIP6-like protein [Dendrobium 
catenatum]
Length=549

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S  SEEAYVTLLYGDE +LG RVLGKSIRDTG++KDMVVLVSDGVS YAK LLQADGW V
Sbjct  24   SARSEEAYVTLLYGDELVLGARVLGKSIRDTGSSKDMVVLVSDGVSDYAKMLLQADGWKV  83

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E I+LL NPNQVRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLF+C +FCAN
Sbjct  84   ELISLLTNPNQVRPKRFWGVYTKLKIFNMTMYKKVVYLDADTIVVKNIEDLFQCRRFCAN  143

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  +F DMMSKVN+L SY
Sbjct  144  LKHSERLNSGVMVVEPSDSLFKDMMSKVNSLPSY  177



>ref|XP_006408197.1| hypothetical protein EUTSA_v10020458mg [Eutrema salsugineum]
 gb|ESQ49650.1| hypothetical protein EUTSA_v10020458mg [Eutrema salsugineum]
Length=545

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 150/174 (86%), Gaps = 4/174 (2%)
 Frame = +3

Query  306  WLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT-KDMVVL  482
            W+ +IL  +      G   S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG++ KDMVVL
Sbjct  8    WVIIILLSIQ---FKGSFGSESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSSNKDMVVL  64

Query  483  VSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDA  662
            VSDGVS Y+K LL+ADGW VE ITLLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDA
Sbjct  65   VSDGVSDYSKLLLKADGWRVENITLLANPNQVHPKRFWGVYTKLKIFNMTDYKKVVYLDA  124

Query  663  DTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            DTIVVKNIEDLFKC KFCANLKHSERLNSGVMVVEPS+ +F+DMM +V TL SY
Sbjct  125  DTIVVKNIEDLFKCSKFCANLKHSERLNSGVMVVEPSEALFSDMMKQVKTLSSY  178



>ref|XP_007147201.1| hypothetical protein PHAVU_006G104100g, partial [Phaseolus vulgaris]
 gb|ESW19195.1| hypothetical protein PHAVU_006G104100g, partial [Phaseolus vulgaris]
Length=531

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  342  CVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLL  521
            CV    +++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG++KDMVVLVSDGVS YAK LL
Sbjct  6    CVGS--KTKRTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSSKDMVVLVSDGVSDYAKSLL  63

Query  522  QADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFK  701
            +ADGWIVE I+LLANPN+VRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVK+I+DLFK
Sbjct  64   RADGWIVELISLLANPNRVRPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKSIDDLFK  123

Query  702  CGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            C KFCANLKHSERLNSGVMVVEPS+ VFNDM+SK+ T  SY
Sbjct  124  CVKFCANLKHSERLNSGVMVVEPSQTVFNDMISKIKTTASY  164



>gb|KFK26089.1| hypothetical protein AALP_AA8G201300 [Arabis alpina]
Length=539

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +3

Query  351  GEPRSQSSEEA-YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G   S+SS+EA YVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+A
Sbjct  21   GSFGSESSKEAAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVALVSDGVSEYSKKLLKA  80

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
            DGW VE+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC 
Sbjct  81   DGWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCS  140

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            KFCANLKHSERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  141  KFCANLKHSERLNSGVMVVEPSEVLFNDMMRKVKTLSSY  179



>emb|CDX70822.1| BnaC03g09060D [Brassica napus]
Length=532

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G   S+SS+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K+LL+AD
Sbjct  21   GSFGSESSKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKKLLKAD  80

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW VE+I+LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVK I+DLFKC K
Sbjct  81   GWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKKIDDLFKCSK  140

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS+ +FNDM+ KV TL SY
Sbjct  141  FCANLKHSERLNSGVMVVEPSQALFNDMIRKVKTLSSY  178



>emb|CDY29996.1| BnaC01g40120D [Brassica napus]
Length=546

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G   S S+ EAYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS Y+K+LL AD
Sbjct  22   GSLGSISTNEAYVTLLYGDEFLLGVRVLGKSIRDTGSHKDMVVLVSDGVSDYSKKLLMAD  81

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW VE+I+LLANPNQV PKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLFKC K
Sbjct  82   GWKVEKISLLANPNQVHPKRFWGVYTKLKIFNMTAYKKVVYLDADTIVVKNIEDLFKCSK  141

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS  +F+DM+ +V TL SY
Sbjct  142  FCANLKHSERLNSGVMVVEPSAALFDDMVKQVKTLSSY  179



>ref|XP_003590989.1| Glycogenin-1 [Medicago truncatula]
 gb|AES61240.1| glucuronosyltransferase PGSIP8 [Medicago truncatula]
Length=541

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S+ +E AY +LLYGDEFLLGVRVLGKSIRDT + KDMVVLVSDGVS YAK LL+ADGWIV
Sbjct  21   SKRTEVAYASLLYGDEFLLGVRVLGKSIRDTRSNKDMVVLVSDGVSDYAKNLLKADGWIV  80

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LL NPNQVRPKRFWGVYTKLKIFNMT Y KVVYLDADTIVV+NIE+LFKCGKFCAN
Sbjct  81   EKISLLENPNQVRPKRFWGVYTKLKIFNMTNYNKVVYLDADTIVVRNIEELFKCGKFCAN  140

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  +FNDMMSKV TL SY
Sbjct  141  LKHSERLNSGVMVVEPSTTLFNDMMSKVKTLPSY  174



>ref|XP_004494729.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cicer 
arietinum]
Length=551

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVS  488
            LC I+ +L+          + +++AYVTLLYGDEFLLGVRVLGKSIRDT + KDMVVLVS
Sbjct  13   LCFIISLLSLQFQGCFGSIKKTDDAYVTLLYGDEFLLGVRVLGKSIRDTRSNKDMVVLVS  72

Query  489  DGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADT  668
            DGVS YAK LL ADGWIVE+I+LLANPN+VRPKRFWGVYTKLKIFNMT YKKVVYLDADT
Sbjct  73   DGVSDYAKNLLTADGWIVEQISLLANPNRVRPKRFWGVYTKLKIFNMTNYKKVVYLDADT  132

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            IVVKNI+DLFKC KFCANLKHSERLNSGVMVVEPS+ VFNDM++K+ T  SY
Sbjct  133  IVVKNIDDLFKCRKFCANLKHSERLNSGVMVVEPSETVFNDMVNKIKTTKSY  184



>ref|NP_001146086.1| uncharacterized protein LOC100279618 precursor [Zea mays]
 gb|ACL53184.1| unknown [Zea mays]
 gb|ACN34651.1| unknown [Zea mays]
 gb|AFW58864.1| hypothetical protein ZEAMMB73_149865 [Zea mays]
Length=536

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LG RVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  28   TEEAYVTLLYGDEFVLGARVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  87

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQ RPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKCGKFC NLKH
Sbjct  88   TLLANPNQFRPKRFWGVYTKLKIFNMTSYKKVVYLDADTIVVKSIEDLFKCGKFCGNLKH  147

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ +FNDM+ K++ L SY
Sbjct  148  SERMNSGVMVVEPSETLFNDMIKKMDQLPSY  178



>gb|KEH24575.1| glucuronosyltransferase PGSIP8 [Medicago truncatula]
Length=549

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
              + EEAYVTLLYGDEFLLGVRVLGKSIRDT + KDMVVLVSDGVS++AK LL+ADGWIV
Sbjct  30   GSNDEEAYVTLLYGDEFLLGVRVLGKSIRDTRSNKDMVVLVSDGVSNFAKNLLRADGWIV  89

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+ITLLANPN+VRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+DLFKC KFCAN
Sbjct  90   EQITLLANPNRVRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVVKNIDDLFKCRKFCAN  149

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS+ +FNDM++K+ T  SY
Sbjct  150  LKHSERLNSGVMVVEPSETLFNDMVNKIKTTKSY  183



>ref|XP_008661816.1| PREDICTED: uncharacterized protein LOC100279618 isoform X1 [Zea 
mays]
Length=523

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LG RVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  28   TEEAYVTLLYGDEFVLGARVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  87

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQ RPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLFKCGKFC NLKH
Sbjct  88   TLLANPNQFRPKRFWGVYTKLKIFNMTSYKKVVYLDADTIVVKSIEDLFKCGKFCGNLKH  147

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ +FNDM+ K++ L SY
Sbjct  148  SERMNSGVMVVEPSETLFNDMIKKMDQLPSY  178



>emb|CDY02625.1| BnaC02g08100D [Brassica napus]
Length=533

 Score =   267 bits (683),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            G   S+SS+EAY+TLLYGDEFLLGVRVLGKSIRDTG+ KDMV LVSDGVS Y+K LL+AD
Sbjct  23   GSFGSESSKEAYITLLYGDEFLLGVRVLGKSIRDTGSDKDMVALVSDGVSDYSKNLLKAD  82

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW VE+I+LLANPNQV P RFWGVYTKLKIFNMT Y KVVYLDADTIVVKNI+DLFKC K
Sbjct  83   GWKVEKISLLANPNQVHPTRFWGVYTKLKIFNMTDYNKVVYLDADTIVVKNIDDLFKCSK  142

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FCANLKHSERLNSGVMVVEPS+ +F+DMM KV TL SY
Sbjct  143  FCANLKHSERLNSGVMVVEPSQALFSDMMRKVKTLSSY  180



>dbj|BAJ88570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LGVRVLGKSIRDTGT +DMVVLVSDGVS Y++ LL+ADGWIV  I
Sbjct  29   TEEAYVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRGLLEADGWIVNRI  88

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADT+VVK+IED+FKCGKFC NLKH
Sbjct  89   TLLANPNQVRPTRFWGVYTKLKIFNMTSYKKVVYLDADTVVVKSIEDVFKCGKFCGNLKH  148

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ VF DM+S+V+ L SY
Sbjct  149  SERMNSGVMVVEPSETVFKDMISQVDRLPSY  179



>ref|XP_004495592.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cicer 
arietinum]
Length=546

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = +3

Query  300  VVWLCLILCV-LNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMV  476
            ++W   I  + +N+ C  G   S+ ++ AY +LLYGDEFLLGVRVLGKSIRDT + KDMV
Sbjct  5    LLWFITIFILSVNSKCGFGS-ESKRTDVAYASLLYGDEFLLGVRVLGKSIRDTRSNKDMV  63

Query  477  VLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYL  656
            VLVSDGVS YA  LL+ADGWIVE+I+LL NPNQVRPKRFWGVYTKLKIFNMT YKKVVYL
Sbjct  64   VLVSDGVSDYANNLLEADGWIVEKISLLENPNQVRPKRFWGVYTKLKIFNMTDYKKVVYL  123

Query  657  DADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            DADTIVV+NIE+LFKCGKFCANLKHSERLNSGVMVV+PS  +FNDM+SKV TL SY
Sbjct  124  DADTIVVRNIEELFKCGKFCANLKHSERLNSGVMVVQPSTTLFNDMLSKVKTLPSY  179



>ref|XP_004976232.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Setaria 
italica]
Length=637

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            +EEAYVTLLYGDEF+LGVRVLGKS+RDTGT +DMVVLVSDGVS Y+++LLQADGWIV  I
Sbjct  128  TEEAYVTLLYGDEFVLGVRVLGKSLRDTGTRRDMVVLVSDGVSEYSRKLLQADGWIVNRI  187

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRPKRFWGVYTKLKIFNMT +KKVVYLDADTIVVK+I+DLFKCG+FC NLKH
Sbjct  188  TLLANPNQVRPKRFWGVYTKLKIFNMTSFKKVVYLDADTIVVKSIDDLFKCGQFCGNLKH  247

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ +FNDM+++V +L SY
Sbjct  248  SERMNSGVMVVEPSETLFNDMINQVGSLPSY  278



>ref|XP_009131669.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=539

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            S+EAYVTLLYGDEFLLGVRVLGKSIRDTG+ K MV LVSDGVS Y+K+LL+ADGW VE+I
Sbjct  33   SKEAYVTLLYGDEFLLGVRVLGKSIRDTGSDKYMVALVSDGVSDYSKKLLKADGWKVEKI  92

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            +LLANPNQV P RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+DLFKC KFCANLKH
Sbjct  93   SLLANPNQVHPTRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDLFKCSKFCANLKH  152

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SERLNSGVMVVEPS+ +FNDMM KV TL SY
Sbjct  153  SERLNSGVMVVEPSQALFNDMMRKVKTLSSY  183



>gb|AFK39755.1| unknown [Lotus japonicus]
Length=535

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  315  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDG  494
            L+ CV    C +    S+ ++EAYVTLLYGDEFLLGVRVLGKSI  T + KDMVVLVSDG
Sbjct  17   LVFCVQFQGCDSLGSTSKKNDEAYVTLLYGDEFLLGVRVLGKSICITRSNKDMVVLVSDG  76

Query  495  VSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIV  674
            VS YAK LL+ADGWIVE+I+LLANPN+VRP RFWGVYTKL+IFNMT YKKVVYLDADT+V
Sbjct  77   VSDYAKNLLRADGWIVEKISLLANPNRVRPTRFWGVYTKLRIFNMTNYKKVVYLDADTVV  136

Query  675  VKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VKNI+DLFKCGKFCANLKHSERLNSGVMVVEPS+ +FNDM+ K+ T  SY
Sbjct  137  VKNIDDLFKCGKFCANLKHSERLNSGVMVVEPSETIFNDMVGKIKTTASY  186



>gb|KHN43170.1| Glycogenin-1 [Glycine soja]
Length=1248

 Score =   274 bits (700),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++ ++EAYVTLLYGDEFLLGVRVLGKSIR+TG+ KDMVVLVSDGVS YAK LL+ADGWIV
Sbjct  746  TKKTDEAYVTLLYGDEFLLGVRVLGKSIRNTGSNKDMVVLVSDGVSDYAKSLLRADGWIV  805

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E I+LLANPN+VRPKRFWGVYTKLKIFNMT YKKVVYLDADTIVVKNI+DLFKCGKFCAN
Sbjct  806  EMISLLANPNRVRPKRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIDDLFKCGKFCAN  865

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVVEPS  +FNDMMSK+ T  SY
Sbjct  866  LKHSERLNSGVMVVEPSATLFNDMMSKIKTTASY  899



>ref|XP_006648850.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Oryza 
brachyantha]
Length=524

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            ++EAYVTLLYGDEF+LGVRVLGKSIRD GT++D+VVLVSDGVS Y+++LL+ADG+IV+ I
Sbjct  13   ADEAYVTLLYGDEFVLGVRVLGKSIRDAGTSRDLVVLVSDGVSEYSRKLLEADGFIVKHI  72

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
            TLLANPNQVRP RFWGVYTKLKIFNMT YKKV YLDADTIVVK+IED+F CGKFCANLKH
Sbjct  73   TLLANPNQVRPSRFWGVYTKLKIFNMTSYKKVAYLDADTIVVKSIEDIFNCGKFCANLKH  132

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            SER+NSGVMVVEPS+ +F+DMM KVN+L SY
Sbjct  133  SERMNSGVMVVEPSETLFSDMMDKVNSLPSY  163



>ref|NP_001047475.1| Os02g0624400 [Oryza sativa Japonica Group]
 dbj|BAD23777.1| putative glycogenin 1 [Oryza sativa Japonica Group]
 dbj|BAF09389.1| Os02g0624400 [Oryza sativa Japonica Group]
 gb|EEE57402.1| hypothetical protein OsJ_07584 [Oryza sativa Japonica Group]
Length=547

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  375  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            +EAYVTLLYGDEF+LGVRVLGKSIRDT T++D+VVLVSDGVS Y+++LL+ADG+IV+ IT
Sbjct  37   DEAYVTLLYGDEFVLGVRVLGKSIRDTDTSRDLVVLVSDGVSEYSRKLLEADGFIVKHIT  96

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
            LLANPNQVRP RFWGVYTKLKIFNMT YKKV YLDADTIVVK+IED+F CGKFCANLKHS
Sbjct  97   LLANPNQVRPTRFWGVYTKLKIFNMTSYKKVAYLDADTIVVKSIEDIFNCGKFCANLKHS  156

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ER+NSGVMVVEPS+ +FNDMM KVN+L SY
Sbjct  157  ERMNSGVMVVEPSETLFNDMMDKVNSLPSY  186



>ref|XP_003580141.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=544

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  384  YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLA  563
            YVTLLYGDEF+LGVRVLGKSIRDTGT +DMVVLVSDGVS Y++ LL+ADGWIV+ ITLLA
Sbjct  35   YVTLLYGDEFVLGVRVLGKSIRDTGTRRDMVVLVSDGVSEYSRGLLEADGWIVKRITLLA  94

Query  564  NPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERL  743
            NPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IED+FKCGKFC NLKHSER+
Sbjct  95   NPNQVRPTRFWGVYTKLKIFNMTSYKKVVYLDADTIVVKSIEDVFKCGKFCGNLKHSERM  154

Query  744  NSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NSGVMVVEPS+ VF DM+S+V+ L SY
Sbjct  155  NSGVMVVEPSETVFKDMISQVDRLPSY  181



>gb|EEC73629.1| hypothetical protein OsI_08135 [Oryza sativa Indica Group]
Length=547

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  375  EEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            +EAYVTLLYGDEF+LGVRVLGKSIRDT T++D+VVLVSDGVS Y+++LL+ADG+IV+ IT
Sbjct  37   DEAYVTLLYGDEFVLGVRVLGKSIRDTDTSRDLVVLVSDGVSEYSRKLLEADGFIVKHIT  96

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
            LLANPNQVRP RFWGVYTKLKIFNMT YKKV YLDADTIVVK+IED+F CGKFCANLKHS
Sbjct  97   LLANPNQVRPTRFWGVYTKLKIFNMTSYKKVAYLDADTIVVKSIEDIFNCGKFCANLKHS  156

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ER+NSGVMVVEPS+ +F+DMM KVN+L SY
Sbjct  157  ERMNSGVMVVEPSETLFSDMMDKVNSLPSY  186



>ref|XP_010104622.1| hypothetical protein L484_021999 [Morus notabilis]
 gb|EXC01428.1| hypothetical protein L484_021999 [Morus notabilis]
Length=683

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 154/178 (87%), Gaps = 2/178 (1%)
 Frame = +3

Query  294  FGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  473
            F +V L L+L +  N  V G PR Q ++EAYVTLLYG++FLLG RVLGKSI+DTG+TKDM
Sbjct  7    FVLVTLSLVLNIPFNGLVFGLPR-QKTDEAYVTLLYGNDFLLGARVLGKSIQDTGSTKDM  65

Query  474  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPN-QVRPKRFWGVYTKLKIFNMTRYKKVV  650
            V LV+DGVS YAK+LL+ADGWIV ++ L+ NPN +VRP+R WGVYTKL+IFNMT YKKVV
Sbjct  66   VALVTDGVSDYAKKLLEADGWIVTKVGLVENPNYEVRPRRLWGVYTKLRIFNMTNYKKVV  125

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIVV+NIE++FKCGKFCANLKHSER NSGV+VVEPS++VF+DM+SKV TL SY
Sbjct  126  YLDADTIVVRNIENMFKCGKFCANLKHSERFNSGVLVVEPSRKVFDDMISKVKTLESY  183



>ref|XP_002962043.1| hypothetical protein SELMODRAFT_62883, partial [Selaginella moellendorffii]
 gb|EFJ37303.1| hypothetical protein SELMODRAFT_62883, partial [Selaginella moellendorffii]
Length=473

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  381  AYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLL  560
            AYVTLLYGDEFLLGVRVLGKSIRDTGT+KD+ VLVSDGVS  A +LL+ADGWIVE I LL
Sbjct  1    AYVTLLYGDEFLLGVRVLGKSIRDTGTSKDLAVLVSDGVSMDAIRLLEADGWIVERIELL  60

Query  561  ANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSER  740
            +NPNQ RP RFWGVYTKLKIFNMT+Y+KVVYLDADTIVVK+IEDLF+C KFCANLKHSER
Sbjct  61   SNPNQQRPARFWGVYTKLKIFNMTQYQKVVYLDADTIVVKDIEDLFQCQKFCANLKHSER  120

Query  741  LNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LNSGVMVVEPS E+F+DM+ KV+TL SY
Sbjct  121  LNSGVMVVEPSAELFDDMLKKVSTLPSY  148



>ref|XP_002971046.1| hypothetical protein SELMODRAFT_62885, partial [Selaginella moellendorffii]
 gb|EFJ27644.1| hypothetical protein SELMODRAFT_62885, partial [Selaginella moellendorffii]
Length=473

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  381  AYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLL  560
            AYVTLLYGDEFLLGVRVLGKSIRDTGT+KD+ VLVSDGVS  A +LL+ADGWIVE I LL
Sbjct  1    AYVTLLYGDEFLLGVRVLGKSIRDTGTSKDLAVLVSDGVSMDAIRLLEADGWIVERIELL  60

Query  561  ANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSER  740
            +NPNQ RP RFWGVYTKLKIFNMT+Y+KVVYLDADTIVVK+IEDLF+C KFCANLKHSER
Sbjct  61   SNPNQQRPARFWGVYTKLKIFNMTQYQKVVYLDADTIVVKDIEDLFQCQKFCANLKHSER  120

Query  741  LNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LNSGVMVVEPS E+F+DM+ KV+TL SY
Sbjct  121  LNSGVMVVEPSAELFDDMLKKVSTLPSY  148



>ref|XP_010235727.1| PREDICTED: LOW QUALITY PROTEIN: inositol phosphorylceramide glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=567

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  384  YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLA  563
            YVTLLYGDEF+LGVRVLGKSIRD GT +D+VVLVSDGVS Y+++LLQADG+IV+ ITLLA
Sbjct  32   YVTLLYGDEFVLGVRVLGKSIRDAGTRRDLVVLVSDGVSEYSRKLLQADGFIVKHITLLA  91

Query  564  NPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERL  743
            NPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVK+IEDLF CGKFCANLKHSER+
Sbjct  92   NPNQVRPTRFWGVYTKLKIFNMTSYKKVVYLDADTIVVKSIEDLFNCGKFCANLKHSERM  151

Query  744  NSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NSGVMVVEPS+ +F DMM+KV++L SY
Sbjct  152  NSGVMVVEPSETLFKDMMNKVDSLPSY  178



>ref|XP_010104620.1| hypothetical protein L484_021997 [Morus notabilis]
 gb|EXC01426.1| hypothetical protein L484_021997 [Morus notabilis]
Length=541

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 152/178 (85%), Gaps = 2/178 (1%)
 Frame = +3

Query  294  FGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDM  473
            F +V L L+L +  N  + G PR Q +EEAYVTLLYG++FLLG RVLGKSI+DTG+TKDM
Sbjct  7    FVLVTLSLVLNIPFNGLIFGLPR-QKTEEAYVTLLYGNDFLLGARVLGKSIQDTGSTKDM  65

Query  474  VVLVSDGVSSYAKQLLQADGWIVEEITLLANPN-QVRPKRFWGVYTKLKIFNMTRYKKVV  650
            V LV+DGVS YA +LL+ADGWIV ++ L+ NPN +VRP+R WGVYTKL+IFNMT YKKVV
Sbjct  66   VALVTDGVSDYAMKLLEADGWIVTKVGLVENPNYEVRPRRLWGVYTKLRIFNMTNYKKVV  125

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            YLDADTIVV+NIE++FKCGKFCA LKHSER N+GV+VVEPS++VF+DM+SKV TL SY
Sbjct  126  YLDADTIVVRNIENMFKCGKFCAILKHSERFNAGVLVVEPSRKVFDDMISKVKTLESY  183



>dbj|BAK04525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  384  YVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLA  563
            YVTLLYGDEF+LGVRVLGKSIRD GT +D+VVLVSDGVS Y+++LL+ADG+IV+ ITLLA
Sbjct  39   YVTLLYGDEFVLGVRVLGKSIRDMGTRRDLVVLVSDGVSDYSRKLLEADGFIVKHITLLA  98

Query  564  NPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERL  743
            NPNQVRP RFWGVYTKLKIFNMT Y+KVVYLDADT+VVK+IEDLF CGKFCANLKHSER+
Sbjct  99   NPNQVRPTRFWGVYTKLKIFNMTTYRKVVYLDADTVVVKSIEDLFNCGKFCANLKHSERM  158

Query  744  NSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NSGVMVVEPS+ +F DMM+KV++L SY
Sbjct  159  NSGVMVVEPSETLFKDMMNKVDSLPSY  185



>ref|XP_001784830.1| predicted protein [Physcomitrella patens]
 gb|EDQ50340.1| predicted protein [Physcomitrella patens]
Length=560

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +3

Query  345  VAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  524
            +AG+ RS   E AY TLLYGDEFLLGVRVLGKSIRDTG TKDMV LVSDGVS    +LL+
Sbjct  42   IAGQSRS---EHAYATLLYGDEFLLGVRVLGKSIRDTGVTKDMVALVSDGVSDAGIRLLE  98

Query  525  ADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKC  704
            ADGWIV+ I LLANPN  RP RFWGVYTKLKIFNMT Y+KVVYLDADTIV ++IEDLF+C
Sbjct  99   ADGWIVQRIELLANPNSKRPTRFWGVYTKLKIFNMTDYRKVVYLDADTIVTRSIEDLFEC  158

Query  705  GKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              FCANLKHSERLNSGVMVVEPS+++F DMMSKV   +SY
Sbjct  159  QSFCANLKHSERLNSGVMVVEPSRDLFEDMMSKVGNTYSY  198



>ref|XP_001759731.1| predicted protein [Physcomitrella patens]
 gb|EDQ75643.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + + S +AY TLLYGDEFLLGVRVLGKSIR+TG  KDMV LVSDGVS    +LL+ADGWI
Sbjct  44   QQKRSGQAYATLLYGDEFLLGVRVLGKSIRNTGVAKDMVALVSDGVSETGIRLLKADGWI  103

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            V+ I LLANPN  RP RFWGVYTKLKIFNMT Y KVVYLDADTIV ++IEDLF+C  FCA
Sbjct  104  VQRIKLLANPNSKRPTRFWGVYTKLKIFNMTEYSKVVYLDADTIVTRSIEDLFECQGFCA  163

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            NLKHSERLNSGVMVVEPS  +F DM+SKV T +SY
Sbjct  164  NLKHSERLNSGVMVVEPSSSLFEDMISKVQTTYSY  198



>gb|KJB44790.1| hypothetical protein B456_007G273500 [Gossypium raimondii]
Length=419

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 127/180 (71%), Gaps = 30/180 (17%)
 Frame = +3

Query  291  RFGVVWLC--LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT  464
            +F  +W+   ++L  + +    G     SS++AYVTLLYGD              DTG+T
Sbjct  2    KFPKLWILFLVLLVTIQSKLALGAKAQYSSKQAYVTLLYGDG-------------DTGST  48

Query  465  KDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKK  644
            K+MVVLVSDGVS YAK+LL+ADGWIVE I+LL NPNQVRPKRFWGVYTKLKIFNMT YKK
Sbjct  49   KEMVVLVSDGVSDYAKKLLEADGWIVENISLLVNPNQVRPKRFWGVYTKLKIFNMTNYKK  108

Query  645  VVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
                           DLFKC KFCANLKHSERLNSGVMVVEPS+ VFNDMMSKVNTL SY
Sbjct  109  ---------------DLFKCEKFCANLKHSERLNSGVMVVEPSEAVFNDMMSKVNTLPSY  153



>gb|KHN14829.1| Glycogenin-1 [Glycine soja]
Length=519

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 119/154 (77%), Gaps = 22/154 (14%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            S+ ++ AYVTLLYGDEFLLGVRVLGKSIRDTG+ KDMVVLVSDGVS YA   LQADGWIV
Sbjct  23   SERTDVAYVTLLYGDEFLLGVRVLGKSIRDTGSNKDMVVLVSDGVSDYANTHLQADGWIV  82

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            E+I+LLANPNQV                      +VY DADTIVVKNIE+L KCGKFCAN
Sbjct  83   EKISLLANPNQV----------------------LVYFDADTIVVKNIEELLKCGKFCAN  120

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LKHSERLNSGVMVV+PS  +FNDMMSKV TL SY
Sbjct  121  LKHSERLNSGVMVVQPSATIFNDMMSKVKTLPSY  154



>gb|EMS55946.1| Glycogenin-1 [Triticum urartu]
Length=480

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  456  GTTKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTR  635
            GT +D+VVLVSDGVS Y+++LL+ADG+IV+ ITLLANPNQVRP RFWGVYTKLKIFNMT 
Sbjct  2    GTRRDLVVLVSDGVSDYSRKLLEADGFIVKHITLLANPNQVRPTRFWGVYTKLKIFNMTT  61

Query  636  YKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTL  815
            Y+KVVYLDADT+VVK+IEDLF CGKFCANLKHSER+NSGVMVVEPS+ +F DMM+KV++L
Sbjct  62   YRKVVYLDADTVVVKSIEDLFNCGKFCANLKHSERMNSGVMVVEPSETLFKDMMNKVDSL  121

Query  816  HSY  824
             SY
Sbjct  122  PSY  124



>gb|ADY38797.1| plant glycogenin-like starch initiation protein [Coffea arabica]
Length=461

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  516  LLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDL  695
             +QADGWIVE+I+LLANPNQVRPKRFWGVYTKLKIFNMT+YKKVVYLDADTIVVKNIEDL
Sbjct  1    FVQADGWIVEKISLLANPNQVRPKRFWGVYTKLKIFNMTKYKKVVYLDADTIVVKNIEDL  60

Query  696  FKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            FKCGKFCANLKHSERLNSGVMVVEPS+EVF DMM +VNTL SY
Sbjct  61   FKCGKFCANLKHSERLNSGVMVVEPSEEVFKDMMRQVNTLPSY  103



>gb|KGN61301.1| hypothetical protein Csa_2G078050 [Cucumis sativus]
Length=463

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  519  LQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLF  698
            + ADGWIVE+I+LLANPNQVRP RFWGVYTKLKIFNMT YKKVVYLDADTIVVKNIEDLF
Sbjct  1    MHADGWIVEKISLLANPNQVRPSRFWGVYTKLKIFNMTDYKKVVYLDADTIVVKNIEDLF  60

Query  699  KCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            KC KFCANLKHSERLNSGVMVVEPS+ +FNDMMSKVNTL SY
Sbjct  61   KCSKFCANLKHSERLNSGVMVVEPSETIFNDMMSKVNTLPSY  102



>ref|XP_011620535.1| PREDICTED: LOW QUALITY PROTEIN: inositol phosphorylceramide glucuronosyltransferase 
1 [Amborella trichopoda]
Length=503

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  519  LQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLF  698
            LQADGWI+E I+LLANPN  RPKRFWGVYTKLKIFNMT YKKVVYLDADTIV+++IEDLF
Sbjct  38   LQADGWILERISLLANPNLKRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVLRSIEDLF  97

Query  699  KCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            KCGKFCANLKHSER+NSGVMVVEPS+E+F DM+ KVNTL SY
Sbjct  98   KCGKFCANLKHSERMNSGVMVVEPSEELFKDMVGKVNTLPSY  139



>gb|ERM98542.1| hypothetical protein AMTR_s01134p00004530 [Amborella trichopoda]
Length=484

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  525  ADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKC  704
            ADGWI+E I+LLANPN  RPKRFWGVYTKLKIFNMT YKKVVYLDADTIV+++IEDLFKC
Sbjct  28   ADGWILERISLLANPNLKRPKRFWGVYTKLKIFNMTNYKKVVYLDADTIVLRSIEDLFKC  87

Query  705  GKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            GKFCANLKHSER+NSGVMVVEPS+E+F DM+ KVNTL SY
Sbjct  88   GKFCANLKHSERMNSGVMVVEPSEELFKDMVGKVNTLPSY  127



>gb|KDD73670.1| hypothetical protein H632_c1943p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=339

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 127/177 (72%), Gaps = 11/177 (6%)
 Frame = +3

Query  315  LILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVL-VSD  491
            L +C++   C AG    +SS+ AYV+LLYGD+FLL +RVLG+S+++T +T+DMV L VSD
Sbjct  9    LFVCIV---CCAGFVVGKSSQ-AYVSLLYGDDFLLALRVLGQSLKETDSTRDMVALAVSD  64

Query  492  GVSSYAKQLLQADGWIVEEITLLANPNQ------VRPKRFWGVYTKLKIFNMTRYKKVVY  653
             VS+ A+++L  +GW V  ++ ++NP +        P RFW VYTKL  FN+T Y +VVY
Sbjct  65   SVSAEAEEILSLEGWHVRRVSAISNPGRWTGADAAFPPRFWAVYTKLLAFNLTEYTRVVY  124

Query  654  LDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            LDADTIV ++++ LF C  FCA ++HSERLNSGVMV++PS   F DM+++V +  SY
Sbjct  125  LDADTIVRRSLDPLFLCDGFCAVMRHSERLNSGVMVLQPSARRFWDMLARVASTPSY  181



>gb|EMT33175.1| hypothetical protein F775_16539 [Aegilops tauschii]
Length=713

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 107/131 (82%), Gaps = 14/131 (11%)
 Frame = +3

Query  456  GTTKDMVVLVSDGVSSYAKQLLQ--------ADGWIVEEITLLANPNQVRPKRFWGVYTK  611
            GT +D+VVLVSDGVS Y+++LL+        ADG+IV+ I LLANPNQVRP RFWGVYTK
Sbjct  2    GTRRDLVVLVSDGVSDYSRKLLEGIDRETRGADGFIVKHIILLANPNQVRPTRFWGVYTK  61

Query  612  LKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFND  791
            LKIFNMT Y+K      DT+VVK+IEDLF CGKFCANLKHSER+NSGVMVVEPS+ +F D
Sbjct  62   LKIFNMTTYRK------DTVVVKSIEDLFNCGKFCANLKHSERMNSGVMVVEPSETLFKD  115

Query  792  MMSKVNTLHSY  824
            MMSKV++L SY
Sbjct  116  MMSKVDSLPSY  126



>ref|XP_006408154.1| hypothetical protein EUTSA_v10021780mg [Eutrema salsugineum]
 gb|ESQ49607.1| hypothetical protein EUTSA_v10021780mg [Eutrema salsugineum]
Length=121

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = +3

Query  291  RFGVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTT-K  467
            + G  W+ +IL  +      G   S+S++EAYVTLLYGDEFLLGVRVLGKSIRDTG++ K
Sbjct  3    KLGSFWVIIILLSIQ---FKGSFGSESTKEAYVTLLYGDEFLLGVRVLGKSIRDTGSSNK  59

Query  468  DMVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKK  644
            DMVVLVSDGVS Y+K LL+ADGW VE ITLLANPNQV PKRFWGVYTKLKIFNMT YKK
Sbjct  60   DMVVLVSDGVSDYSKLLLKADGWRVENITLLANPNQVHPKRFWGVYTKLKIFNMTDYKK  118



>ref|XP_003591002.1| hypothetical protein MTR_1g080670 [Medicago truncatula]
Length=129

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = +3

Query  297  GVVWLCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMV  476
             ++W  +++  +N+        S+ +E AY +LLYGDEFLLGVRVLGKSIRDT + KDMV
Sbjct  3    ALLWFMILVFSVNSLG----SESKRTEVAYASLLYGDEFLLGVRVLGKSIRDTRSNKDMV  58

Query  477  VLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKK  644
            VLVSDGVS YAK LL+ADGWIVE+I+LL NPNQVRPKRFWGVYTKLKIFNMT Y K
Sbjct  59   VLVSDGVSDYAKNLLKADGWIVEKISLLENPNQVRPKRFWGVYTKLKIFNMTNYNK  114



>gb|EMS47724.1| Glycogenin-1 [Triticum urartu]
Length=390

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 13/118 (11%)
 Frame = +3

Query  471  MVVLVSDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVV  650
            MVVLVSDGVS Y+++LL       E ITLLANPNQVRP RFWGVYTKLKIFNMT YKK  
Sbjct  1    MVVLVSDGVSEYSRELL-------ERITLLANPNQVRPTRFWGVYTKLKIFNMTSYKK--  51

Query  651  YLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
                DT+VVK+IED+FKCGKFC NLKHSER+NSGVMVVEPS+ VF DM+S+V+ L SY
Sbjct  52   ----DTVVVKSIEDVFKCGKFCGNLKHSERMNSGVMVVEPSETVFKDMISQVDRLPSY  105



>ref|XP_002954821.1| hypothetical protein VOLCADRAFT_106550 [Volvox carteri f. nagariensis]
 gb|EFJ44020.1| hypothetical protein VOLCADRAFT_106550 [Volvox carteri f. nagariensis]
Length=599

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 111/156 (71%), Gaps = 5/156 (3%)
 Frame = +3

Query  372  SEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
            S EAY TL+YG++F+L  RVLG+S+R++GTT+DMV L +  + + ++  L ADGW V  +
Sbjct  32   SSEAYATLVYGEDFVLAARVLGQSLRESGTTRDMVALTTGSLKASSELTLAADGWRVVHV  91

Query  552  TLLANPNQVR-----PKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              + NP         P RF  VYTKL IF MT YKK+V+LDAD +V++N++ +FKC  FC
Sbjct  92   APVKNPGTGPQPTGFPPRFAYVYTKLYIFQMTEYKKIVFLDADVLVIRNMDVIFKCPGFC  151

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A L+HSER N+GVM + PS E+++DMM+K+ ++ SY
Sbjct  152  AALRHSERFNTGVMSLVPSLEMYDDMMAKMRSMPSY  187



>emb|CBN79165.1| Glycosyltransferase, family GT8 [Ectocarpus siliculosus]
Length=837

 Score =   152 bits (383),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 76/155 (49%), Positives = 103/155 (66%), Gaps = 2/155 (1%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            +Q S  AY TLLY D F+ G R LG+S+R++GT+ D VVLV+  V    +Q L  DGWIV
Sbjct  102  AQPSRRAYATLLYSD-FIEGTRALGQSLRESGTSADTVVLVTPDVRQETRQKLAEDGWIV  160

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTR-YKKVVYLDADTIVVKNIEDLFKCGKFCA  719
              + +  NPNQ    R   VYTKL I  M   Y ++V+LDADT+V++NI++LF+C  FCA
Sbjct  161  RPVAVETNPNQNFQSRLVFVYTKLLIVEMEEEYDRIVFLDADTLVLENIDELFECEPFCA  220

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             ++HSE LNSGV+V+ PSKE++  M   +  L SY
Sbjct  221  VMRHSELLNSGVVVITPSKELYGHMHDLIGELDSY  255



>ref|XP_005844956.1| hypothetical protein CHLNCDRAFT_138328 [Chlorella variabilis]
 gb|EFN52854.1| hypothetical protein CHLNCDRAFT_138328 [Chlorella variabilis]
Length=650

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 110/181 (61%), Gaps = 22/181 (12%)
 Frame = +3

Query  348  AGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            AG     ++ EA+ TL+Y D FLLG RVLG+S+R+TGTT+D+V LV++ VS  A   L  
Sbjct  42   AGARIHPTAAEAFATLVYSDLFLLGARVLGQSLRETGTTRDLVALVTESVSQQAADTLAL  101

Query  528  DGWIVEEITLLAN-------PNQVRPKRFWGVYTKLKIFNMTRYKK------VVYLDADT  668
            DGW V+ + L+ N       P+Q  P RFWGV+TKL IFN+T          +VYLDADT
Sbjct  102  DGWKVQRVGLVTNPGTWTQDPDQRFPPRFWGVFTKLLIFNLTHSPLSAVITCMVYLDADT  161

Query  669  IVVKNIEDLFKCGKFCANLKHSERLNSG---------VMVVEPSKEVFNDMMSKVNTLHS  821
            I  +++++LF     CA ++ +ER+N+G         VMV+ PS  +F  MM+ V +  S
Sbjct  162  IASRSLDELFLFDGLCAVMRAAERVNTGARRLARQQRVMVLTPSAALFRAMMAAVPSTPS  221

Query  822  Y  824
            Y
Sbjct  222  Y  222



>gb|EPS60482.1| hypothetical protein M569_14321, partial [Genlisea aurea]
Length=317

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 95/158 (60%), Gaps = 1/158 (1%)
 Frame = +3

Query  354  EPRSQSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            E       EAY T+L+ GD ++ G  V  +SIR TG+T+D+V LV + +S Y K  L+  
Sbjct  3    EDLGNGKREAYATILHSGDGYVCGAIVSAQSIRMTGSTRDLVALVDESISEYHKSGLREA  62

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW +  +  + NP   +  ++   Y+K +++ +  Y K+V++DAD ++++NI+ LF+  +
Sbjct  63   GWKIRPLEPIMNPKSEKHAQYAWSYSKFRVWELIEYDKIVFIDADLLILRNIDFLFRLPE  122

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              A   H+   NSGVMV+EPSK  F  +M ++N + SY
Sbjct  123  MSAAGNHASLFNSGVMVIEPSKCTFQLLMDRINDIDSY  160



>ref|XP_002992480.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
 gb|EFJ06418.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
Length=516

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 100/159 (63%), Gaps = 5/159 (3%)
 Frame = +3

Query  357  PRSQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADG  533
            PR  +S EAY T+L+  +F + G   L +SIR +G+ +D+V+LV + +  + ++ L+A G
Sbjct  178  PRKHASREAYATILHSAQFYVCGAISLARSIRMSGSKRDLVILVDENIHPHHREGLEAAG  237

Query  534  WIVEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
            W V +I  + NP +  P+ +  W  Y+K +++ +T Y K++Y+DAD I+++N++ LF+  
Sbjct  238  WRVIQIQRIRNP-KAEPESYNEWN-YSKFRLWQLTEYHKLIYIDADIILLRNMDFLFQMP  295

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   H    NSGVMV+EPS   F  +M ++N + SY
Sbjct  296  EISATGNHESMFNSGVMVIEPSNCTFEMLMQQINEVESY  334



>ref|XP_010921631.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
 ref|XP_010921632.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
Length=633

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = +3

Query  357  PRSQSSE-EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            PRS++ + EAYVT+L+  D ++ G     +SIR TG+TKD+V+LV + +S++ +  L+A 
Sbjct  305  PRSKTGQREAYVTILHSADAYVCGAITAAQSIRLTGSTKDLVILVDETISNHHRSGLEAA  364

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW V  I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +
Sbjct  365  GWKVRTIQRIRNPKAKRDAYNEWNYSKFRLWQLTDYDKIIFIDADMLILRNIDFLFTMPE  424

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              A   ++   NSGVMV+EPS   F  +M ++N + SY
Sbjct  425  ITATENNATLFNSGVMVIEPSNCTFQLLMERINEIESY  462



>ref|XP_010921630.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=659

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = +3

Query  357  PRSQSSE-EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            PRS++ + EAYVT+L+  D ++ G     +SIR TG+TKD+V+LV + +S++ +  L+A 
Sbjct  331  PRSKTGQREAYVTILHSADAYVCGAITAAQSIRLTGSTKDLVILVDETISNHHRSGLEAA  390

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW V  I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +
Sbjct  391  GWKVRTIQRIRNPKAKRDAYNEWNYSKFRLWQLTDYDKIIFIDADMLILRNIDFLFTMPE  450

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              A   ++   NSGVMV+EPS   F  +M ++N + SY
Sbjct  451  ITATENNATLFNSGVMVIEPSNCTFQLLMERINEIESY  488



>ref|XP_009771065.1| PREDICTED: putative glucuronosyltransferase PGSIP6, partial [Nicotiana 
sylvestris]
Length=417

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  645  VVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            VVYLDADTIVVK+IEDLFKCGKFCANLKHSERLNSGVMV+EPS++VFNDMMSKV TL SY
Sbjct  7    VVYLDADTIVVKSIEDLFKCGKFCANLKHSERLNSGVMVIEPSEKVFNDMMSKVTTLPSY  66



>ref|XP_011405481.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Amphimedon queenslandica]
Length=408

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 88/136 (65%), Gaps = 4/136 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
            ++  +A VT+L+G  F LGVRVLG+SIR++ T  D VV+ +  V     Q+L+ DGW + 
Sbjct  31   KNKPDAIVTILFGKGFELGVRVLGQSIRESKTKLDYVVMCTHDVPPETIQVLKKDGWKIR  90

Query  546  EITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANL  725
             I        V   +F     K+K++ +T Y++++++DAD I+V+NI+ L +CG FCA  
Sbjct  91   MIDYF----DVGKAKFDNRIYKMKMWTLTEYRRIIWIDADAILVQNIDHLVRCGNFCATY  146

Query  726  KHSERLNSGVMVVEPS  773
            +HS+  NSG+MVV+PS
Sbjct  147  RHSDLFNSGIMVVKPS  162



>ref|XP_002990211.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
 gb|EFJ08771.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
Length=528

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 99/157 (63%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + +S EAY T+L+  +F + G   L +SIR +G+ +D+V+LV + +  + ++ L+A GW 
Sbjct  192  AHASREAYATILHSAQFYVCGAISLARSIRMSGSKRDLVILVDENIHPHHREGLEAAGWR  251

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            V +I  + NP +  P+ +  W  Y+K +++ +T Y K++Y+DAD I+++N++ LF+  + 
Sbjct  252  VIQIQRIRNP-KAEPESYNEWN-YSKFRLWQLTEYHKLIYIDADIILLRNMDFLFQMPEI  309

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   H    NSGVMV+EPS   F  +M ++N + SY
Sbjct  310  SATGNHESMFNSGVMVIEPSNCTFEMLMQQINEVESY  346



>ref|XP_011406812.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Amphimedon queenslandica]
Length=478

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 102/165 (62%), Gaps = 7/165 (4%)
 Frame = +3

Query  315  LILCVLNNYCVAGEPRSQSSEE---AYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLV  485
            LI+ +L  Y   G    ++ E+   A VT+LYG  F LGVRVLG+SIR++ TT + VV+ 
Sbjct  8    LIILLLTFYFSEGVEYIKNEEQPRGALVTILYGTGFELGVRVLGQSIRESKTTLEYVVMC  67

Query  486  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDAD  665
            +  V      +L+ DGW ++ I    +P +    +F G   K++++ +T Y +++++DAD
Sbjct  68   TRDVPQETIAVLKKDGWKIKMIDRF-DPGK---AKFDGSIHKMQMWTLTEYNRILWVDAD  123

Query  666  TIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMS  800
             ++V+NI+ L +CG FC   +HS+  N+G+MVV+PS +    +MS
Sbjct  124  AVLVQNIDHLTRCGNFCVTFRHSDLFNAGIMVVKPSLDELKRIMS  168



>ref|XP_010428781.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 98/157 (62%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            ++    + NPN V P  +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  340  IQMFQRIRNPNAV-PNAYNEWN-YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEI  397

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSG+MVVEPS   F  +M  +N + SY
Sbjct  398  SAIGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSY  434



>ref|XP_010416641.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 98/157 (62%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            ++    + NPN V P  +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  340  IQMFQRIRNPNAV-PNAYNEWN-YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEI  397

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSG+MVVEPS   F  +M  +N + SY
Sbjct  398  SAIGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSY  434



>ref|XP_010471900.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 98/157 (62%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            ++    + NPN V P  +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  340  IQMFQRIRNPNAV-PNAYNEWN-YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEI  397

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSG+MVVEPS   F  +M  +N + SY
Sbjct  398  SAIGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSY  434



>ref|XP_006302009.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
 gb|EOA34907.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
Length=618

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 95/157 (61%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            +    EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  LQA GW 
Sbjct  280  ASEKREAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDSISEYHKSGLQAAGWK  339

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            +     + NPN + P  +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  340  IHMFQRIRNPNAI-PNAYNEWN-YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEI  397

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSG+MVVEPS   F  +M  +N + SY
Sbjct  398  SATGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSY  434



>ref|XP_011466789.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Fragaria vesca subsp. vesca]
Length=634

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 92/154 (60%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
             +  EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + +S Y +  LQA GWIV
Sbjct  297  NARREAYATILHSADVYVCGAISAAQSIRMAGSTRDLVILVDETISGYHRSGLQAAGWIV  356

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            + I  + NP   +       Y+K +++ +T Y K++++DAD +++KNI+ LF   +  A 
Sbjct  357  KTIQRIRNPKAEKDAYNEWNYSKFRLWQLTEYDKIIFIDADLLILKNIDILFSMPEISAT  416

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               +   NSGVMV+EPS   F+ +M  +N + SY
Sbjct  417  GNDATLFNSGVMVIEPSNCTFHLLMDHINEIESY  450



>gb|AIA95663.1| Glyco_transf_8, partial [uncultured bacterium]
Length=134

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = +3

Query  477  VLVSDGVSSYAKQLLQADGWIVEEITLLANP------NQVRPKRFWGVYTKLKIFNMTRY  638
            +++ D VS    +L+ +DGW V  +  + NP      ++  P RFW VYTKL ++N+T Y
Sbjct  1    MVIGDQVSESNVRLVASDGWKVVRVGAIQNPGRWTNAHRAFPPRFWAVYTKLLVWNLTDY  60

Query  639  KKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLH  818
            ++VVYLDADTI  ++++ +F C   C  ++HSER N+GV+ + P   + +DM+ ++    
Sbjct  61   ERVVYLDADTIAARSLDPIFGCDGICCVIRHSERCNTGVLALTPDSAMLDDMLGRIAETP  120

Query  819  SY  824
            SY
Sbjct  121  SY  122



>gb|KCW62287.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=633

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +3

Query  369  SSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
            +  EAY T+L+  D ++ G     +SIR  G+T+D+V+LV D +S+Y +  L+A GW + 
Sbjct  298  ARREAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDDSISNYHRSGLEAAGWKIR  357

Query  546  EITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANL  725
             I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A  
Sbjct  358  TIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFAMPEISATG  417

Query  726  KHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             ++   NSGVMV+EPS   FN +M  +N + SY
Sbjct  418  NNATLFNSGVMVIEPSNCTFNLLMKHINEIESY  450



>ref|XP_010025567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 ref|XP_010025568.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 gb|KCW62286.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=639

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +3

Query  369  SSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
            +  EAY T+L+  D ++ G     +SIR  G+T+D+V+LV D +S+Y +  L+A GW + 
Sbjct  304  ARREAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDDSISNYHRSGLEAAGWKIR  363

Query  546  EITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANL  725
             I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A  
Sbjct  364  TIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFAMPEISATG  423

Query  726  KHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             ++   NSGVMV+EPS   FN +M  +N + SY
Sbjct  424  NNATLFNSGVMVIEPSNCTFNLLMKHINEIESY  456



>ref|XP_010040896.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
4, partial [Eucalyptus grandis]
Length=437

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 94/150 (63%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  + 
Sbjct  211  EAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHMQ  270

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + +PN  +       ++KL+++ +T+Y KV+++DAD +V++N+++ F   +  A   + 
Sbjct  271  RIRSPNAKKGAYNEWNFSKLRVWQLTQYDKVIFIDADLLVLRNLDEFFVYPQLSAAPNNG  330

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSG+MV+EPS  VF D+MSK   L SY
Sbjct  331  VLFNSGIMVIEPSNCVFEDLMSKSFKLDSY  360



>gb|KCW44877.1| hypothetical protein EUGRSUZ_L01540, partial [Eucalyptus grandis]
Length=482

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 94/151 (62%), Gaps = 1/151 (1%)
 Frame = +3

Query  375  EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
             EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  I
Sbjct  207  REAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHI  266

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
              + +PN  +       ++KL+++ +T+Y KV+++DAD IV++N+++ F   +  A   +
Sbjct  267  HRIRSPNAKKGAYNEWNFSKLRVWQLTQYDKVIFIDADLIVLRNLDEFFVYPQLSAVPNN  326

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
                NSG+MV+EPS  VF D+MSK   L SY
Sbjct  327  GVLFNSGIMVIEPSNCVFEDLMSKSFKLDSY  357



>ref|XP_005708044.1| transferase, transferring glycosyl groups / transferase, transferring 
hexosyl groups [Galdieria sulphuraria]
 gb|EME31524.1| transferase, transferring glycosyl groups / transferase, transferring 
hexosyl groups [Galdieria sulphuraria]
Length=614

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 92/165 (56%), Gaps = 8/165 (5%)
 Frame = +3

Query  342  CVAGEPRSQSSEEAYVTLLYGDEFLLGVRVLGKSIR-DTGTTKDMVVLVSDGVSSYAKQL  518
            C+ G         AYVTLLYG  +LL VRV+ +S+R ++      +VLV+  VS  A   
Sbjct  76   CIQG----THDRHAYVTLLYGSSYLLPVRVMMQSLRVNSPDNFRKIVLVTSDVSENAIAQ  131

Query  519  LQADGWIVEEITLLANPNQVRPK---RFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIE  689
            L ++G    +I+ + NP     K   RF  V  KL IFNMT    VVY+DAD++V   + 
Sbjct  132  LHSEGIETRKISSVNNPYAKDSKYDARFDEVMAKLTIFNMTDLDSVVYIDADSLVFGPLG  191

Query  690  DLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            DLF C  FCA   +    NSGVM ++PS+ VF DMM K+  L SY
Sbjct  192  DLFHCADFCAAFINPCLFNSGVMALKPSRTVFEDMMQKLPILPSY  236



>ref|XP_002889125.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65384.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
Length=618

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 96/157 (61%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV D +S Y K  L A GW 
Sbjct  280  ASAKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDDTISEYHKSGLVAAGWK  339

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            +     + NPN + P  +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  340  IHMFQRIRNPNAI-PNAYNEWN-YSKFRLWQLTEYSKIIFIDADMLILRNIDFLFEFPEI  397

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSG+MVVEPS   F  +M  +N + SY
Sbjct  398  SATGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSY  434



>ref|XP_010674823.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
4 [Beta vulgaris subsp. vulgaris]
Length=513

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 98/155 (63%), Gaps = 3/155 (2%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
              S EAYVT+L+  ++ + G   L +SI  T TTKD+V+L    +S +++Q L+A GW V
Sbjct  221  HKSREAYVTVLHSSQYYVCGAITLAQSILQTNTTKDLVLLADRTISKHSRQGLEAAGWKV  280

Query  543  EEITLLANPN-QVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            + I  + +PN +V     W  Y+KL+++ +T Y KV+++D+D IV+ NI+  F   +  A
Sbjct  281  KRIDRIRSPNAKVDAYNEWN-YSKLRVWQLTDYDKVMFIDSDFIVLHNIDHFFDYPQLSA  339

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  +    NSG+M++EPS+  F+++MSK  TL SY
Sbjct  340  SPNNKWLFNSGIMILEPSECFFDNLMSKRYTLKSY  374



>ref|XP_006858468.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Amborella trichopoda]
 ref|XP_011628566.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Amborella trichopoda]
 ref|XP_011628567.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Amborella trichopoda]
 gb|ERN19935.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
Length=640

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 95/160 (59%), Gaps = 5/160 (3%)
 Frame = +3

Query  348  AGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  524
            AG PR     EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +SS+ +  L 
Sbjct  305  AGNPR----REAYATILHSAHIYVCGAIAAAQSIRLTGSTRDLVILVDETISSHHRSGLA  360

Query  525  ADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKC  704
            A GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF+ 
Sbjct  361  AAGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEM  420

Query  705  GKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             +  A   ++   NSGVMV+EPS   FN +M  +N + SY
Sbjct  421  PEITATGNNATLFNSGVMVLEPSNCTFNLLMDHINEIESY  460



>ref|XP_010040834.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
5 isoform X1 [Eucalyptus grandis]
Length=592

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 94/151 (62%), Gaps = 1/151 (1%)
 Frame = +3

Query  375  EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
             EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  I
Sbjct  295  REAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHI  354

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
              + +PN  +       ++KL+++ +T+Y KV+++DAD IV++N+++ F   +  A   +
Sbjct  355  HRIRSPNAKKGAYNEWNFSKLRVWQLTQYDKVIFIDADLIVLRNLDEFFVYPQLSAVPNN  414

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
                NSG+MV+EPS  VF D+MSK   L SY
Sbjct  415  GVLFNSGIMVIEPSNCVFEDLMSKSFKLDSY  445



>ref|XP_010040835.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
5 isoform X2 [Eucalyptus grandis]
Length=584

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 94/151 (62%), Gaps = 1/151 (1%)
 Frame = +3

Query  375  EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
             EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  I
Sbjct  287  REAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHI  346

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
              + +PN  +       ++KL+++ +T+Y KV+++DAD IV++N+++ F   +  A   +
Sbjct  347  HRIRSPNAKKGAYNEWNFSKLRVWQLTQYDKVIFIDADLIVLRNLDEFFVYPQLSAVPNN  406

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
                NSG+MV+EPS  VF D+MSK   L SY
Sbjct  407  GVLFNSGIMVIEPSNCVFEDLMSKSFKLDSY  437



>ref|NP_177838.2| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 sp|Q8W4A7.1|GUX3_ARATH RecName: Full=Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3; Short=UDP-GlcA:xylan glucuronyltransferase 
3; AltName: Full=Glycogenin-like protein 3; AltName: Full=Plant 
glycogenin-like starch initiation protein 2; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 3; Short=AtGUX3 
[Arabidopsis thaliana]
 gb|AAL32773.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47996.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35939.1| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 gb|AHL38869.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=618

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 104/175 (59%), Gaps = 10/175 (6%)
 Frame = +3

Query  309  LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLV  485
            L + L   +N+  AG     + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV
Sbjct  267  LSVPLQAKDNFYSAG-----AKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILV  321

Query  486  SDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLD  659
             + +S Y K  L A GW ++    + NPN V P  +  W  Y+K +++ +T Y K++++D
Sbjct  322  DETISEYHKSGLVAAGWKIQMFQRIRNPNAV-PNAYNEWN-YSKFRLWQLTEYSKIIFID  379

Query  660  ADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            AD ++++NI+ LF+  +  A   ++   NSG+MVVEPS   F  +M  +N + SY
Sbjct  380  ADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSY  434



>ref|XP_008803691.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Phoenix dactylifera]
Length=746

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = +3

Query  354  EPRSQSS-EEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            +P S++   EAY T+L+  D ++ G     +SIR TG+T+D+V+LV + +S++ +  L+A
Sbjct  433  QPYSKTGLREAYATVLHSADVYVCGAITAAQSIRLTGSTRDLVILVDETISNHHRSGLEA  492

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW V  I  + NP   R       Y+K +++ +T Y K++++DAD I+++NI+ LF   
Sbjct  493  AGWKVRTIQRIRNPKAQRDAYNEWNYSKFRLWQLTDYDKIIFIDADMIILRNIDFLFTMP  552

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  553  EITATENNATLFNSGVMVIEPSNCTFQLLMEHINEIESY  591



>tpg|DAA44094.1| TPA: hypothetical protein ZEAMMB73_670696 [Zea mays]
Length=503

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  362

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++NI+ LF   +  A   ++
Sbjct  363  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNIDFLFAMPEITATGNNA  422

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  423  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  452



>ref|XP_010680250.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010680251.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=644

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 93/159 (58%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G PR     EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + +S+Y +  L+A
Sbjct  306  GNPR----REAYATILHSADVYVCGAIAAAQSIRMVGSTRDLVILVDESISAYYRSGLEA  361

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++N++ LF   
Sbjct  362  AGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNMDFLFSMP  421

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A    +   NSGVMV+EPS   FN +M  +N + SY
Sbjct  422  EISATGNDATLFNSGVMVIEPSNCTFNLLMDHINEIESY  460



>dbj|BAJ87020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  35   EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  94

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  95   RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNA  154

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  155  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  184



>ref|XP_006383614.1| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
 gb|ERP61411.1| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
Length=495

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 91/155 (59%), Gaps = 1/155 (1%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
             ++  EAY T+L+   F + G     +SIR  G+T+D+V+LV + ++ Y ++ L A GW 
Sbjct  158  ERAHREAYATILHSANFYVCGAIAAAQSIRMAGSTRDLVILVDETITDYHREGLAAAGWK  217

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            +  I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A
Sbjct  218  IHTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISA  277

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  278  TGNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  312



>ref|XP_003568405.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=628

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I 
Sbjct  300  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDSISDHHRKGLEAAGWKVRIIQ  359

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  360  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  419

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  420  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  449



>ref|XP_010040839.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
4 [Eucalyptus grandis]
Length=585

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 94/151 (62%), Gaps = 1/151 (1%)
 Frame = +3

Query  375  EEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEI  551
             EAY T+L+  E ++ G   L +SIR TG+TKD+V+L  D ++S +   L+A GW +  +
Sbjct  288  REAYATVLHSSEAYVCGAISLAQSIRRTGSTKDLVLLADDSITSKSLAGLRAAGWKIRHM  347

Query  552  TLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
              + +PN  +       ++KL+++ +T+Y KV+++DAD +V++N+++ F   +  A   +
Sbjct  348  QRIRSPNAKKGAYNEWNFSKLRVWQLTQYDKVIFIDADLLVLRNLDEFFVYPQLSAAPNN  407

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
                NSG+MV+EPS  VF D+MSK   L SY
Sbjct  408  GVLFNSGIMVIEPSNCVFEDLMSKSFKLDSY  438



>dbj|BAJ87861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  19   EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIE  78

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  79   RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  138

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  139  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  168



>tpg|DAA56540.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=640

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  309  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  368

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++NI+ LF   +  A   ++
Sbjct  369  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNIDFLFAMPEITATGNNA  428

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  429  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  458



>ref|XP_008674740.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Zea mays]
 tpg|DAA56541.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=634

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  362

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++NI+ LF   +  A   ++
Sbjct  363  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNIDFLFAMPEITATGNNA  422

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  423  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  452



>ref|XP_002456736.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
 gb|EES01856.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
Length=633

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIE  362

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++NI+ LF   +  A   ++
Sbjct  363  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNIDFLFAMPEITATGNNA  422

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  423  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  452



>gb|AAC34345.1| Unknown protein [Arabidopsis thaliana]
Length=1201

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 104/175 (59%), Gaps = 10/175 (6%)
 Frame = +3

Query  309   LCLILCVLNNYCVAGEPRSQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLV  485
             L + L   +N+  AG     + +EAY T+L+  +F + G     +SIR +G+T+D+V+LV
Sbjct  850   LSVPLQAKDNFYSAG-----AKKEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILV  904

Query  486   SDGVSSYAKQLLQADGWIVEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLD  659
              + +S Y K  L A GW ++    + NPN V P  +  W  Y+K +++ +T Y K++++D
Sbjct  905   DETISEYHKSGLVAAGWKIQMFQRIRNPNAV-PNAYNEWN-YSKFRLWQLTEYSKIIFID  962

Query  660   ADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             AD ++++NI+ LF+  +  A   ++   NSG+MVVEPS   F  +M  +N + SY
Sbjct  963   ADMLILRNIDFLFEFPEISATGNNATLFNSGLMVVEPSNSTFQLLMDNINEVVSY  1017


 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 94/156 (60%), Gaps = 3/156 (2%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + + +EAY T+L+ D+ F+ G   + +SIR +G+T+++V+LV D +S Y +  L++ GW 
Sbjct  256  ANAKKEAYATILHSDDAFVCGAIAVAQSIRMSGSTRNLVILVDDSISEYHRSGLESAGWK  315

Query  540  VEEITLLANPN-QVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
            +     + NP  +      W  Y+K +++ +T Y K++++DAD ++++N++ LF+  +  
Sbjct  316  IHTFQRIRNPKAEANAYNQWN-YSKFRLWELTEYNKIIFIDADMLILRNMDFLFEYPEIS  374

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
                     NSG+MV+EPS   F  +M  +N ++SY
Sbjct  375  TTGNDGTLFNSGLMVIEPSNSTFQLLMDHINDINSY  410



>ref|XP_003564767.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=632

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L+A GW V  I 
Sbjct  304  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDDTISEHHRKGLEAAGWKVRIIE  363

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  364  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFAMPEITATGNNA  423

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  424  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  453



>ref|XP_002517237.1| glycogenin, putative [Ricinus communis]
 gb|EEF45137.1| glycogenin, putative [Ricinus communis]
Length=630

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 94/159 (59%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G PR     EAY T+L+    ++ G     +SIR +G+T+D+++LV + +S Y K  L+A
Sbjct  292  GNPR----REAYATILHSAHVYVCGAIAAAQSIRLSGSTRDLIILVDESISVYHKSGLEA  347

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y+K++++DAD ++++NI+ LF   
Sbjct  348  AGWKIRIIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYEKIIFIDADLLILRNIDFLFSMP  407

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   ++   NSGVMV+EPS   FN +M  +N + SY
Sbjct  408  EISATGNNATLFNSGVMVIEPSNCTFNLLMEHINEIESY  446



>ref|XP_002969245.1| hypothetical protein SELMODRAFT_1169, partial [Selaginella moellendorffii]
 gb|EFJ29333.1| hypothetical protein SELMODRAFT_1169, partial [Selaginella moellendorffii]
Length=439

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 94/154 (61%), Gaps = 5/154 (3%)
 Frame = +3

Query  372  SEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEE  548
            S EAY T+L+    ++ G  +L  SIR +G+T+D+++++   ++   +Q L+A GW +  
Sbjct  179  SREAYATILHSVKSYVCGAVLLAHSIRKSGSTRDLILVIDQHINLEDRQGLEAAGWKIHH  238

Query  549  ITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            I  + NP + RP  +  W  Y+K +++ +T+Y KVV++DAD +V +N++ LF   +  A 
Sbjct  239  IERIRNP-RARPDAYNEWN-YSKFRLWQLTQYDKVVFIDADVVVTRNMDFLFDLPELSAA  296

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              H    NSGVMV+EPS   FN ++  ++ + SY
Sbjct  297  RNHKSVFNSGVMVIEPSNCTFNLLVDGISRIKSY  330



>ref|XP_008373921.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Malus domestica]
Length=548

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 95/152 (63%), Gaps = 5/152 (3%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + ++ Y ++ L+A GW +  I 
Sbjct  216  EAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKIHTIQ  275

Query  555  LLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLK  728
             + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   
Sbjct  276  RIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGN  333

Query  729  HSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  334  NATLFNSGVMVVEPSNCTFQLLMDHINEIVSY  365



>gb|KCW71171.1| hypothetical protein EUGRSUZ_F04263 [Eucalyptus grandis]
Length=396

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+  + ++ G     +SIR  G+T+D+V+LV + +S + +  L+A GW V
Sbjct  60   RAHREAYATILHSANVYVCGAITAAQSIRMAGSTRDLVILVDETISEHHRTGLEAAGWKV  119

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP + +P  +  W  Y+K +++ +T Y K++++DAD +V++NI+ LF   +  
Sbjct  120  HTIQRIRNP-KAQPDAYNEWN-YSKFRLWQLTDYDKIIFIDADQLVLRNIDFLFGMPELS  177

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMV+EPS   F  +M+ +N + SY
Sbjct  178  ATGNNASLFNSGVMVIEPSNCTFKLLMNHINEIESY  213



>ref|XP_002960603.1| hypothetical protein SELMODRAFT_1168, partial [Selaginella moellendorffii]
 gb|EFJ38142.1| hypothetical protein SELMODRAFT_1168, partial [Selaginella moellendorffii]
Length=439

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 93/154 (60%), Gaps = 5/154 (3%)
 Frame = +3

Query  372  SEEAYVTLLYG-DEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEE  548
            S EAY T+L+    ++ G  +L  SIR TG+T+D+++++   ++   +Q L+  GW +  
Sbjct  179  SREAYATILHSVKSYVCGAVLLAHSIRKTGSTRDLIMVIDQHINLEDRQGLEGAGWKIHH  238

Query  549  ITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
            I  + NP + RP  +  W  Y+K +++ +T+Y KVV++DAD +V +N++ LF   +  A 
Sbjct  239  IERIRNP-RARPDAYNEWN-YSKFRLWQLTQYDKVVFIDADVVVTRNMDFLFDLPELSAA  296

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              H    NSGVMV+EPS   FN ++  ++ + SY
Sbjct  297  RNHKSVFNSGVMVIEPSNCTFNLLVDGISRIKSY  330



>gb|KHN09596.1| Glycogenin-1 [Glycine soja]
Length=639

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 92/154 (60%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
             ++ EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V
Sbjct  303  NAAREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKV  362

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A 
Sbjct  363  RTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITAT  422

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  423  GNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  456



>ref|XP_008373920.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 95/152 (63%), Gaps = 5/152 (3%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + ++ Y ++ L+A GW +  I 
Sbjct  314  EAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKIHTIQ  373

Query  555  LLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLK  728
             + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   
Sbjct  374  RIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGN  431

Query  729  HSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  432  NATLFNSGVMVVEPSNCTFQLLMDHINEIVSY  463



>ref|XP_008441557.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Cucumis melo]
Length=634

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 93/155 (60%), Gaps = 1/155 (1%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
             +++ EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +S Y +  L+A GW 
Sbjct  296  ERANREAYATILHSAHIYVCGAIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWK  355

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            +  I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A
Sbjct  356  IFTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEITA  415

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  416  TGNNATLFNSGVMVIEPSNCTFQLLMDHINEIESY  450



>ref|XP_009348497.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348516.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=646

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 95/152 (63%), Gaps = 5/152 (3%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  D ++ G     +SIR  G+T+D+V+LV + ++ Y ++ L+A GW +  I 
Sbjct  314  EAYATILHSADVYVCGAIAAAQSIRMAGSTRDLVILVDETITQYHRRGLEAAGWKIHTIQ  373

Query  555  LLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLK  728
             + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   
Sbjct  374  RIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEISATGN  431

Query  729  HSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  432  NATLFNSGVMVVEPSNCTFQLLMDHINEIVSY  463



>ref|XP_004148815.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Cucumis sativus]
 ref|XP_011657307.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Cucumis sativus]
 gb|KGN47482.1| hypothetical protein Csa_6G338140 [Cucumis sativus]
Length=634

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 93/155 (60%), Gaps = 1/155 (1%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
             +++ EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +S Y +  L+A GW 
Sbjct  296  ERANREAYATILHSAHMYVCGAIAAAQSIRMTGSTRDLVILVDETISEYHRGGLEAAGWK  355

Query  540  VEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
            +  I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A
Sbjct  356  ILTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEITA  415

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  416  TGNNATLFNSGVMVIEPSNCTFQLLMDHINEIESY  450



>ref|XP_006645120.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Oryza brachyantha]
Length=636

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L+A GW V  I 
Sbjct  307  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDDTISDHHRKGLEAAGWKVRIIQ  366

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  367  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  426

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  427  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  456



>gb|EMS55920.1| Glycogenin-1 [Triticum urartu]
Length=622

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  292  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  351

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  352  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNA  411

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M+ +N + SY
Sbjct  412  TLFNSGVMVIEPSNCTFQLLMNHINEITSY  441



>emb|CDM85463.1| unnamed protein product [Triticum aestivum]
Length=634

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  304  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  363

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  364  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNA  423

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M+ +N + SY
Sbjct  424  TLFNSGVMVIEPSNCTFQLLMNHINEITSY  453



>ref|XP_010999819.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Populus euphratica]
Length=649

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 91/154 (59%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+   F + G     +SIR  G+T+D+V+LV + ++ Y ++ L A GW +
Sbjct  313  RAHREAYATILHSAHFYVCGAIAAAQSIRMAGSTRDLVILVDETITDYHREGLTAAGWKI  372

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A 
Sbjct  373  HTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISAT  432

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  433  GNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  466



>ref|XP_011625863.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2 [Amborella trichopoda]
Length=363

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 92/150 (61%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  E ++ G   L +SIR TG+ KDMVV+V   +S  +++ L   GW+V E  
Sbjct  86   EAYATVLHSSEDYVCGAITLAQSIRATGSIKDMVVVVDKTISGSSRKGLTEAGWLVLERE  145

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP           YTKL+++ +T+Y+K+V+LD+D +V+KNI+ LFK  +  A     
Sbjct  146  RIRNPKANSGSYNEWNYTKLRLWQLTQYEKLVFLDSDLVVLKNIDFLFKLPEMSAISNSR  205

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSG+MV+EPS+ +F  +M +   +HSY
Sbjct  206  TIFNSGLMVIEPSQCMFRVLMREKERVHSY  235



>ref|XP_002997946.1| glycosyl transferase, putative [Phytophthora infestans T30-4]
 gb|EEY67784.1| glycosyl transferase, putative [Phytophthora infestans T30-4]
Length=519

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 109/184 (59%), Gaps = 10/184 (5%)
 Frame = +3

Query  303  VWLCLILCVLNNYC-VAGEPR-SQSSEEAYVTLLY-----GDEFLLGVRVLGKSIRDTGT  461
            +WL L L   ++   VAG+ +   +S  AYVT+ Y       E++LGV+V+  SI+ TG+
Sbjct  11   LWLWLGLAAASSEVQVAGKQQDPPTSRFAYVTVHYEGTARDAEYVLGVQVMMHSIKLTGS  70

Query  462  TKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANP---NQVRPKRFWGVYTKLKIFNMT  632
              D+VVL SD VS  +K L ++ G  V ++T + NP     +  K F     KL ++NM 
Sbjct  71   PYDLVVLASDSVSEKSKALFRSMGCRVLDVTNIDNPFVGGTLLNKGFIYTLNKLHVWNML  130

Query  633  RYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNT  812
             Y++VVYLDAD ++++N ++LF CG+FCA   +    ++G++VV PS   +  ++S +  
Sbjct  131  EYERVVYLDADNVLIRNSDELFLCGEFCAVFMNPCHFHTGLLVVTPSAAEYQRLLSALGH  190

Query  813  LHSY  824
            L S+
Sbjct  191  LESF  194



>dbj|BAJ87677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=633

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  304  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  363

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  364  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNA  423

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  424  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  453



>gb|EMT19434.1| Glycogenin-1 [Aegilops tauschii]
Length=642

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV D +S + ++ L++ GW V  I 
Sbjct  312  EAYATILHSASEYVCGAIAAAQSIRQAGSTRDFVILVDDTISDHHRKGLESAGWKVRIIE  371

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  372  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFTMPEISATGNNA  431

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M+ +N + SY
Sbjct  432  TLFNSGVMVIEPSNCTFQLLMNHINEITSY  461



>gb|AAS90653.1| putative glycogenin [Oryza sativa Japonica Group]
Length=671

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I 
Sbjct  347  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQ  406

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  407  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  466

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  467  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  496



>gb|EEC79261.1| hypothetical protein OsI_20036 [Oryza sativa Indica Group]
Length=671

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I 
Sbjct  347  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQ  406

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  407  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  466

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  467  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  496



>gb|EYU29759.1| hypothetical protein MIMGU_mgv1a017852mg, partial [Erythranthe 
guttata]
Length=462

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 93/154 (60%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+  ++++ G     +SIR +G+T+D+V+LV + +  + ++ LQ+ GW V
Sbjct  297  KTQREAYTTILHSANDYVCGAIAAAQSIRMSGSTRDLVILVDESIGDHHRRGLQSSGWKV  356

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LFK  +  A 
Sbjct  357  RTIKRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFVDADLLILRNIDFLFKMPQISAT  416

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              +    NSGVMV+EPS   F  +M  V+ + SY
Sbjct  417  GNNGTLFNSGVMVIEPSNCTFKLLMDHVDDIESY  450



>ref|XP_006581757.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=639

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 91/154 (59%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
             +  EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V
Sbjct  303  NAPREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKV  362

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A 
Sbjct  363  RTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITAT  422

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  423  GNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  456



>gb|EEE63788.1| hypothetical protein OsJ_18611 [Oryza sativa Japonica Group]
Length=684

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L+A GW V  I 
Sbjct  360  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDDTISDHHRKGLEAAGWKVRVIQ  419

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  420  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  479

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  480  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  509



>ref|XP_009404954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404955.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=644

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  E ++ G     +SIR +G+ +D+V+LV D +S + +  L+A GW V  + 
Sbjct  316  EAYATILHSAERYVCGAIAAARSIRSSGSARDLVILVDDTISEHDRSGLEAAGWKVRTME  375

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KVV+LDAD +V++NI+ LF   +  A   ++
Sbjct  376  RIRNPKAKRDAYNEWNYSKFRLWQLTEYDKVVFLDADLLVLRNIDFLFALPEITAVGNNA  435

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMVVEPS   F  +M  ++ + SY
Sbjct  436  ALFNSGVMVVEPSNCTFQLLMDHIDEITSY  465



>ref|XP_007019401.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
 gb|EOY16626.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
Length=644

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW +
Sbjct  308  RAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKI  367

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  368  YTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEIS  425

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  426  AIGNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  461



>ref|XP_009404956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=641

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  E ++ G     +SIR +G+ +D+V+LV D +S + +  L+A GW V  + 
Sbjct  313  EAYATILHSAERYVCGAIAAARSIRSSGSARDLVILVDDTISEHDRSGLEAAGWKVRTME  372

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KVV+LDAD +V++NI+ LF   +  A   ++
Sbjct  373  RIRNPKAKRDAYNEWNYSKFRLWQLTEYDKVVFLDADLLVLRNIDFLFALPEITAVGNNA  432

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMVVEPS   F  +M  ++ + SY
Sbjct  433  ALFNSGVMVVEPSNCTFQLLMDHIDEITSY  462



>ref|XP_002307480.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
 gb|EEE94476.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
Length=651

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 91/154 (59%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+   F + G     +SIR  G+T+D+V+LV + ++ Y ++ L A GW +
Sbjct  315  RAHREAYATILHSANFYVCGAIAAAQSIRMAGSTRDLVILVDETITDYHREGLAAAGWKI  374

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A 
Sbjct  375  HTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISAT  434

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  435  GNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  468



>gb|KHG12057.1| Glycogenin-2 [Gossypium arboreum]
Length=646

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW +
Sbjct  310  RAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKI  369

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  370  YTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPQIS  427

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  428  AIGNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  463



>ref|XP_010110483.1| hypothetical protein L484_003529 [Morus notabilis]
 gb|EXC26584.1| hypothetical protein L484_003529 [Morus notabilis]
Length=523

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 92/150 (61%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  E ++ G   + +SIR TG+T+D+++LV + +  + ++ L+  GW +  I 
Sbjct  220  EAYATILHSAEAYVCGAIAVAQSIRRTGSTRDLLILVDESIGEHHRRGLELAGWKIRTIR  279

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K+++LDAD +V++NI+ LF   +  A+  H+
Sbjct  280  RIRNPKAKRGLYNEWNYSKFRLWQLTDYDKIIFLDADLLVLRNIDFLFGFPEISASGNHA  339

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  ++ ++N + SY
Sbjct  340  ALFNSGVMVIEPSNCTFQMLIDQINEIESY  369



>gb|KHN31133.1| Glycogenin-2 [Glycine soja]
Length=633

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 91/154 (59%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
             +  EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V
Sbjct  297  NAPREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKV  356

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A 
Sbjct  357  RTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITAT  416

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  417  GNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  450



>ref|XP_004290562.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Fragaria vesca subsp. vesca]
Length=640

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 97/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+  + ++ G     +SIR +G+T+D+V+LV + +S Y ++ L A GW +
Sbjct  306  RAHREAYATILHSANLYVCGAIAAAQSIRMSGSTRDLVILVDETISEYHREGLAAAGWKI  365

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  366  HSIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEIS  423

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  424  ATGNNATLFNSGVMVVEPSNFTFQLLMDHINEIVSY  459



>ref|XP_010911800.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
 ref|XP_010911801.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
Length=639

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 94/158 (59%), Gaps = 2/158 (1%)
 Frame = +3

Query  357  PRSQSSE-EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            P S++   EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +S + +  L+A 
Sbjct  303  PYSKTGHREAYATILHSAHVYVCGAITAAQSIRLTGSTRDLVILVDETISDHHRSGLEAA  362

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW V+ I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +
Sbjct  363  GWKVKTIQRIRNPKAERDAYNEWNYSKFRLWQLTEYDKIIFIDADLLILRNIDFLFTMPE  422

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  423  ITATGNNATLFNSGVMVVEPSNCTFQLLMEHINEIESY  460



>ref|XP_010911799.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=665

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 94/158 (59%), Gaps = 2/158 (1%)
 Frame = +3

Query  357  PRSQSSE-EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQAD  530
            P S++   EAY T+L+    ++ G     +SIR TG+T+D+V+LV + +S + +  L+A 
Sbjct  329  PYSKTGHREAYATILHSAHVYVCGAITAAQSIRLTGSTRDLVILVDETISDHHRSGLEAA  388

Query  531  GWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGK  710
            GW V+ I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +
Sbjct  389  GWKVKTIQRIRNPKAERDAYNEWNYSKFRLWQLTEYDKIIFIDADLLILRNIDFLFTMPE  448

Query  711  FCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  449  ITATGNNATLFNSGVMVVEPSNCTFQLLMEHINEIESY  486



>ref|XP_006578795.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Glycine max]
 ref|XP_006578796.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Glycine max]
Length=639

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 91/154 (59%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
             +  EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +SSY +  L+A GW V
Sbjct  303  NAPREAYATILHSAHVYVCGAIAAAQSIRMSGSTRDLVILVDETISSYHRSGLEAAGWKV  362

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A 
Sbjct  363  RTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITAT  422

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  423  GNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  456



>gb|KJB59999.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=646

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW +
Sbjct  310  RAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKI  369

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  370  YTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEIS  427

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  428  AIGNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  463



>ref|XP_006406580.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
 gb|ESQ48033.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
Length=658

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G PR     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  316  GNPR----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  371

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  372  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  431

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  432  EISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESY  470



>gb|KJB60000.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=645

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A GW +
Sbjct  309  RAHREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSISDYHRGGLEAAGWKI  368

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  369  YTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEIS  426

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  427  AIGNNATLFNSGVMVVEPSNCTFQLLMDHINEIESY  462



>gb|AGT16755.1| glycogenin [Saccharum hybrid cultivar R570]
Length=631

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRIIQ  362

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  363  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEISATGNNA  422

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  423  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  452



>ref|XP_010110482.1| hypothetical protein L484_003528 [Morus notabilis]
 gb|EXC26583.1| hypothetical protein L484_003528 [Morus notabilis]
Length=660

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+    ++ G  V  +SIR  G+T+D+V+LV + +S Y +  L+A GW +
Sbjct  325  RAHREAYATILHSAHVYVCGAIVAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKI  384

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  385  HTIKRIRNP-KAEPEAYNEWN-YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFEMPEIS  442

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  443  ATGNNATLFNSGVMVIEPSNCTFQLLMDHINEIVSY  478



>ref|XP_002307022.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
 gb|EEE94018.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
Length=631

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 93/159 (58%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G PR     EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y +  L+A
Sbjct  294  GNPR----REAYTTILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEA  349

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  350  AGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMP  409

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   ++   NSGVMV+EPS   FN +M  +N + SY
Sbjct  410  EISATGNNATLFNSGVMVIEPSNCTFNLLMEHINEIESY  448



>ref|XP_002441128.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
 gb|EES19558.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
Length=631

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRIIQ  362

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  363  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  422

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  423  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  452



>ref|XP_008891806.1| hypothetical protein PPTG_02471 [Phytophthora parasitica INRA-310]
 ref|XP_008891807.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI50005.1| hypothetical protein F443_06354 [Phytophthora parasitica P1569]
 gb|ETI50006.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK89883.1| hypothetical protein L915_06242 [Phytophthora parasitica]
 gb|ETK89884.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL43286.1| hypothetical protein L916_06175 [Phytophthora parasitica]
 gb|ETL43287.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL96467.1| hypothetical protein L917_06049 [Phytophthora parasitica]
 gb|ETL96468.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM49629.1| hypothetical protein L914_06171 [Phytophthora parasitica]
 gb|ETM49630.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN22566.1| hypothetical protein PPTG_02471 [Phytophthora parasitica INRA-310]
 gb|ETN22567.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETO78727.1| hypothetical protein F444_06418 [Phytophthora parasitica P1976]
 gb|ETO78728.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP19772.1| hypothetical protein F441_06364 [Phytophthora parasitica CJ01A1]
 gb|ETP19773.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP47706.1| hypothetical protein F442_06399 [Phytophthora parasitica P10297]
 gb|ETP47707.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=519

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 108/184 (59%), Gaps = 10/184 (5%)
 Frame = +3

Query  303  VWLCLILCVLNNYC-VAGEPRSQ-SSEEAYVTLLY-----GDEFLLGVRVLGKSIRDTGT  461
            +WL L L   ++   VA + R   +S  AYVT+ Y       E++LGV+VL  SI+ TG+
Sbjct  11   LWLWLGLAAASSEVQVADQQRDPPTSRFAYVTVHYEGTARDAEYVLGVQVLMHSIKLTGS  70

Query  462  TKDMVVLVSDGVSSYAKQLLQADGWIVEEITLLANP---NQVRPKRFWGVYTKLKIFNMT  632
              D+VVL SD VS  +K L ++ G  V ++T + NP     +  K F     KL ++NM 
Sbjct  71   PYDLVVLASDSVSEKSKALFRSMGCRVLDVTNIDNPFVGGTLLNKGFIYTLNKLHVWNML  130

Query  633  RYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNT  812
             Y++VVYLDAD ++++N ++LF CG+FCA   +    ++G++VV PS   +  +++ +  
Sbjct  131  EYERVVYLDADNVLIRNADELFLCGEFCAVFMNPCHFHTGLLVVTPSATEYQRLLNALGH  190

Query  813  LHSY  824
            L S+
Sbjct  191  LESF  194



>ref|XP_008654538.1| PREDICTED: uncharacterized protein LOC100272808 isoform X1 [Zea 
mays]
 gb|AFW84389.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
 gb|AFW84390.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
Length=641

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV D +S + ++ L++ GW V  I 
Sbjct  303  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDDTISDHHRKGLESAGWKVRIIQ  362

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++NI+ LF   +  A   ++
Sbjct  363  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNIDFLFALPEITATGNNA  422

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  ++ + SY
Sbjct  423  TLFNSGVMVIEPSNCTFRLLMEHIDEITSY  452



>ref|XP_012087641.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Jatropha curcas]
 ref|XP_012087642.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Jatropha curcas]
Length=634

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 93/160 (58%), Gaps = 5/160 (3%)
 Frame = +3

Query  348  AGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  524
            +G PR     EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y K  L+
Sbjct  296  SGNPR----REAYATILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDESISLYHKSGLE  351

Query  525  ADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKC  704
            A GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF  
Sbjct  352  AAGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGM  411

Query  705  GKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             +  A   ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  412  PEISATGNNATLFNSGVMVIEPSNCTFKLLMEHINEIESY  451



>gb|KHG20951.1| Glycogenin-1 [Gossypium arboreum]
Length=403

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 56/66 (85%), Gaps = 6/66 (9%)
 Frame = +3

Query  627  MTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKV  806
            MT YKK      DTIVVK+IEDLFKC KFCANLKHSERLNSGVMVVEPS+ VFNDMMSKV
Sbjct  1    MTNYKK------DTIVVKSIEDLFKCEKFCANLKHSERLNSGVMVVEPSEAVFNDMMSKV  54

Query  807  NTLHSY  824
            NTL SY
Sbjct  55   NTLPSY  60



>ref|XP_011073953.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
Length=644

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 90/154 (58%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
             +  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + +S Y +  L+A GW +
Sbjct  308  NARREAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDETISDYHRGGLEAAGWKI  367

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   R       Y+K +++ +T Y K++++DAD +V++NI+ LF+  +  A 
Sbjct  368  HTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLVLRNIDFLFEMPEISAT  427

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  428  GNNATLFNSGVMVIEPSNCTFQLLMEHINEIESY  461



>gb|KDP24792.1| hypothetical protein JCGZ_25413 [Jatropha curcas]
Length=630

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 93/160 (58%), Gaps = 5/160 (3%)
 Frame = +3

Query  348  AGEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQ  524
            +G PR     EAY T+L+    ++ G     +SIR +G+T+D+V+LV + +S Y K  L+
Sbjct  292  SGNPR----REAYATILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDESISLYHKSGLE  347

Query  525  ADGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKC  704
            A GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF  
Sbjct  348  AAGWKIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGM  407

Query  705  GKFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             +  A   ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  408  PEISATGNNATLFNSGVMVIEPSNCTFKLLMEHINEIESY  447



>dbj|BAG90458.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  246  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  305

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  306  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  365

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  366  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  395



>dbj|BAJ85213.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=628

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  300  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIE  359

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  360  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  419

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  420  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  449



>gb|EMT13493.1| Glycogenin-1 [Aegilops tauschii]
Length=685

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  355  EAYATILHSASEYVCGAITAAQSIRQAGSTRDLVILVDNTISDHHRRGLEAAGWKVRIIE  414

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  415  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  474

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  475  TLFNSGVMVIEPSNCTFQLLMEHINEITSY  504



>gb|KFK44245.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=639

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 91/156 (58%), Gaps = 3/156 (2%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + +  EAY T+L+   F + G     +SIR  G+T+D+V+LV D ++ Y +  L A GW 
Sbjct  301  ASAKREAYATILHSANFYVCGAITAAQSIRMAGSTRDLVILVDDSITEYHRGGLAAAGWK  360

Query  540  VEEITLLANPN-QVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
            +  I  + NP  +      W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  361  IYSIERIRNPKAEAEAYNEWN-YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEIS  419

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  420  ATGNNATLFNSGVMVVEPSNSTFQLLMDHINEIVSY  455



>gb|ERN12676.1| hypothetical protein AMTR_s00025p00245930 [Amborella trichopoda]
Length=511

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 92/150 (61%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  E ++ G   L +SIR TG+ KDMVV+V   +S  +++ L   GW+V E  
Sbjct  234  EAYATVLHSSEDYVCGAITLAQSIRATGSIKDMVVVVDKTISGSSRKGLTEAGWLVLERE  293

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP           YTKL+++ +T+Y+K+V+LD+D +V+KNI+ LFK  +  A     
Sbjct  294  RIRNPKANSGSYNEWNYTKLRLWQLTQYEKLVFLDSDLVVLKNIDFLFKLPEMSAISNSR  353

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSG+MV+EPS+ +F  +M +   +HSY
Sbjct  354  TIFNSGLMVIEPSQCMFRVLMREKERVHSY  383



>gb|KFK44246.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=643

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 91/156 (58%), Gaps = 3/156 (2%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            + +  EAY T+L+   F + G     +SIR  G+T+D+V+LV D ++ Y +  L A GW 
Sbjct  305  ASAKREAYATILHSANFYVCGAITAAQSIRMAGSTRDLVILVDDSITEYHRGGLAAAGWK  364

Query  540  VEEITLLANPN-QVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
            +  I  + NP  +      W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  365  IYSIERIRNPKAEAEAYNEWN-YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEIS  423

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  +N + SY
Sbjct  424  ATGNNATLFNSGVMVVEPSNSTFQLLMDHINEIVSY  459



>ref|XP_008237654.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Prunus mume]
Length=644

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 93/155 (60%), Gaps = 5/155 (3%)
 Frame = +3

Query  369  SSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVE  545
            +  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + +S Y +  L A GW + 
Sbjct  309  AHREAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDETISEYHRGGLAAAGWKIH  368

Query  546  EITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCA  719
             I  + NP +  PK +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A
Sbjct  369  PIERIRNP-KAEPKAYNEWN-YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFEMPEISA  426

Query  720  NLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               ++   NSGVMVVEPS   F  +M  VN + SY
Sbjct  427  TGNNATLFNSGVMVVEPSNCTFQLLMDHVNEIVSY  461



>ref|XP_007199738.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
 gb|EMJ00937.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
Length=644

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 95/156 (61%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + ++ Y +  L+A GW +
Sbjct  308  RAHREAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDETITEYHRGGLEAAGWKI  367

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  
Sbjct  368  HTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADMLILRNIDFLFQMPEIS  425

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMVVEPS   F  +M  VN + SY
Sbjct  426  ATGNNASLFNSGVMVVEPSNGTFQLLMDHVNEIVSY  461



>ref|XP_010539695.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Tarenaya hassleriana]
Length=644

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 96/157 (61%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            +++  EAY T+L+   F + G     +SIR  G+T+D+V+LV + +S Y +  L+A GW 
Sbjct  306  ARAKREAYATILHSAHFYVCGAITAAQSIRMAGSTRDLVILVDESISDYHRGGLEAAGWK  365

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            +  I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  366  IHTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFEMPEI  423

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSGVMVVEPS   F  +M  ++ + SY
Sbjct  424  SATGNNATLFNSGVMVVEPSNCTFQLLMDHIDEIVSY  460



>ref|XP_008647982.1| PREDICTED: LOC100286027 isoform X2 [Zea mays]
 gb|ACR37754.1| unknown [Zea mays]
Length=546

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  221  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQ  280

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++N++ LF   +  A   ++
Sbjct  281  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNVDFLFAMPEIAATGNNA  340

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMVVEPS   F  +M  ++ + SY
Sbjct  341  TLFNSGVMVVEPSNCTFRLLMDHIDEITSY  370



>ref|XP_009776713.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Nicotiana sylvestris]
Length=632

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 87/150 (58%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+    ++ G     +SIR  G+T+D+V+LV D +  Y +  L+A GW V  I 
Sbjct  295  EAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQ  354

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   + 
Sbjct  355  RIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNG  414

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  415  TLFNSGVMVIEPSNCTFQLLMDHINEIESY  444



>ref|XP_009776712.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Nicotiana sylvestris]
Length=633

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 87/150 (58%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+    ++ G     +SIR  G+T+D+V+LV D +  Y +  L+A GW V  I 
Sbjct  296  EAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQ  355

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   + 
Sbjct  356  RIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNG  415

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  416  TLFNSGVMVIEPSNCTFQLLMDHINEIESY  445



>ref|XP_010244025.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
 ref|XP_010244026.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
Length=589

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 90/154 (58%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            +S  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + +S Y +  L+A GW +
Sbjct  253  KSHREAYATILHSAHVYVCGAIAAAQSIRMVGSTRDLVILVDETISEYHRGGLEAAGWKI  312

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A 
Sbjct  313  RTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITAT  372

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  373  GNNATLFNSGVMVIEPSNCTFQLLMDHINEIESY  406



>ref|XP_009776715.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X4 [Nicotiana sylvestris]
Length=626

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 87/150 (58%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+    ++ G     +SIR  G+T+D+V+LV D +  Y +  L+A GW V  I 
Sbjct  289  EAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQ  348

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   + 
Sbjct  349  RIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNG  408

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  409  TLFNSGVMVIEPSNCTFQLLMDHINEIESY  438



>ref|XP_009776714.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X3 [Nicotiana sylvestris]
Length=627

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 87/150 (58%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+    ++ G     +SIR  G+T+D+V+LV D +  Y +  L+A GW V  I 
Sbjct  290  EAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDDSIGEYHRSGLEAAGWQVRTIQ  349

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   + 
Sbjct  350  RIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDILFRMPQISATGNNG  409

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  410  TLFNSGVMVIEPSNCTFQLLMDHINEIESY  439



>ref|XP_010539696.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Tarenaya hassleriana]
Length=640

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 96/157 (61%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
            +++  EAY T+L+   F + G     +SIR  G+T+D+V+LV + +S Y +  L+A GW 
Sbjct  302  ARAKREAYATILHSAHFYVCGAITAAQSIRMAGSTRDLVILVDESISDYHRGGLEAAGWK  361

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            +  I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  362  IHTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTEYDKIIFIDADLLILRNIDFLFEMPEI  419

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSGVMVVEPS   F  +M  ++ + SY
Sbjct  420  SATGNNATLFNSGVMVVEPSNCTFQLLMDHIDEIVSY  456



>emb|CDP04731.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 89/154 (58%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            +   EAY T+L+    ++ G     +SIR  G+T+D+V+LV D +S Y +  L+  GW +
Sbjct  313  KKPREAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDDTISEYHRSGLEVAGWKI  372

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LFK  +  A 
Sbjct  373  RTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFKMPQISAT  432

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              +    NSGVMV+EPS   F+ +M  +N + SY
Sbjct  433  GNNGTLFNSGVMVIEPSNCTFHLLMEHINEIESY  466



>gb|EAZ14371.1| hypothetical protein OsJ_04291 [Oryza sativa Japonica Group]
Length=651

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  322  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  381

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  382  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  441

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  442  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  471



>ref|XP_011007558.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=631

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 91/156 (58%), Gaps = 1/156 (1%)
 Frame = +3

Query  360  RSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGW  536
            +     EAYVT+L+    ++ G     +SIR +G+T+D+V+LV + +S Y +  L+A GW
Sbjct  293  KGNPHREAYVTILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGW  352

Query  537  IVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
             +  I  + NP   +       Y+K +++  T Y K++++DAD ++++NI+ LF   +  
Sbjct  353  KIRTIQRIRNPKAEKDAYNEWNYSKFRLWQQTDYDKIIFIDADLLILRNIDFLFGMPEIS  412

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMV+EPS   FN +M  +N + SY
Sbjct  413  ATGNNATLFNSGVMVIEPSNCTFNLLMEHINEIESY  448



>gb|EEC71899.1| hypothetical protein OsI_04661 [Oryza sativa Indica Group]
Length=635

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  306  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  365

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  366  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  425

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  426  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  455



>ref|NP_001044991.1| Os01g0880200 [Oryza sativa Japonica Group]
 dbj|BAD81673.1| glycogenin-like protein [Oryza sativa Japonica Group]
 dbj|BAF06905.1| Os01g0880200 [Oryza sativa Japonica Group]
Length=635

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D V+LV + +S++ ++ L+A GW V  I 
Sbjct  306  EAYATILHSASEYVCGAITAAQSIRQAGSTRDFVILVDETISNHHRKGLEAAGWKVRIIQ  365

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y K++++DAD ++++N++ LF   +  A   ++
Sbjct  366  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNVDFLFAMPEITATGNNA  425

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  +N + SY
Sbjct  426  TLFNSGVMVIEPSNCTFQLLMDHINEITSY  455



>ref|XP_010244020.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244021.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244022.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244023.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244024.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
Length=648

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 90/154 (58%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            +S  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + +S Y +  L+A GW +
Sbjct  312  KSHREAYATILHSAHVYVCGAIAAAQSIRMVGSTRDLVILVDETISEYHRGGLEAAGWKI  371

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF   +  A 
Sbjct  372  RTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFGMPEITAT  431

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  432  GNNATLFNSGVMVIEPSNCTFQLLMDHINEIESY  465



>ref|XP_010063886.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Eucalyptus grandis]
Length=635

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 96/156 (62%), Gaps = 5/156 (3%)
 Frame = +3

Query  366  QSSEEAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
            ++  EAY T+L+  + ++ G     +SIR  G+T+D+V+LV + +S + +  L+A GW V
Sbjct  299  RAHREAYATILHSANVYVCGAITAAQSIRMAGSTRDLVILVDETISEHHRTGLEAAGWKV  358

Query  543  EEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFC  716
              I  + NP + +P  +  W  Y+K +++ +T Y K++++DAD +V++NI+ LF   +  
Sbjct  359  HTIQRIRNP-KAQPDAYNEWN-YSKFRLWQLTDYDKIIFIDADQLVLRNIDFLFGMPELS  416

Query  717  ANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            A   ++   NSGVMV+EPS   F  +M+ +N + SY
Sbjct  417  ATGNNASLFNSGVMVIEPSNCTFKLLMNHINEIESY  452



>ref|XP_008647980.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 ref|XP_008647981.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 gb|ACR35990.1| unknown [Zea mays]
 gb|AFW78066.1| secondary cell wall glycosyltransferase family 8 isoform 1 [Zea 
mays]
 gb|AFW78067.1| secondary cell wall glycosyltransferase family 8 isoform 2 [Zea 
mays]
Length=632

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  307  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQ  366

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++N++ LF   +  A   ++
Sbjct  367  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNVDFLFAMPEIAATGNNA  426

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMVVEPS   F  +M  ++ + SY
Sbjct  427  TLFNSGVMVVEPSNCTFRLLMDHIDEITSY  456



>emb|CDP18299.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 89/154 (58%), Gaps = 1/154 (1%)
 Frame = +3

Query  366  QSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIV  542
             +  EAY T+L+    ++ G     +SIR  G+T+D+V+LV + +S Y +  L+A GW +
Sbjct  311  NAHREAYATILHSAHVYVCGAIAAAQSIRMAGSTRDLVILVDETISEYHRGGLEAAGWKI  370

Query  543  EEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCAN  722
              I  + NP   R       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A 
Sbjct  371  RTIQRIRNPKAERDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEISAT  430

Query  723  LKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
              +    NSGVMVVEPS   F  +M  +N + SY
Sbjct  431  GNNGTLFNSGVMVVEPSNCTFQLLMDHINEIESY  464



>ref|XP_010487789.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=660

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  373  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  432

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  433  EISATGNNGTLFNSGVMVIEPCNCTFELLMEHINEIESY  471



>ref|NP_001152387.1| LOC100286027 [Zea mays]
 gb|ACG47359.1| secondary cell wall-related glycosyltransferase family 8 [Zea 
mays]
Length=633

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLY-GDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   E++ G     +SIR  G+T+D+V+LV + +S + ++ L+A GW V  I 
Sbjct  308  EAYATILHSASEYVCGAISAAQSIRQAGSTRDLVILVDETISDHHRRGLEAAGWKVRVIQ  367

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   R       Y+K +++ +T Y KV+++DAD ++++N++ LF   +  A   ++
Sbjct  368  RIRNPKAERDAYNEWNYSKFRLWQLTDYDKVIFIDADLLILRNVDFLFAMPEIAATGNNA  427

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMVVEPS   F  +M  ++ + SY
Sbjct  428  TLFNSGVMVVEPSNCTFRLLMDHIDEITSY  457



>ref|XP_002885270.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61529.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
Length=659

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  373  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  432

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  433  EISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESY  471



>ref|XP_010465976.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=661

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  318  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  373

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  374  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  433

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  434  EISATGNNGTLFNSGVMVIEPCNCTFELLMEHINEIESY  472



>gb|EPS63087.1| hypothetical protein M569_11696, partial [Genlisea aurea]
Length=329

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 91/150 (61%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+  + ++ G  V  +SIR TG+T+D+V+LV   +S + +  L+A GW +  I 
Sbjct  6    EAYATILHSAQVYVCGAIVAAQSIRMTGSTRDLVILVDSTISEHHRSGLRAAGWKIHTIE  65

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   ++
Sbjct  66   RIKNPRAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFRMPEISAIGNNA  125

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   F  +M  ++ + SY
Sbjct  126  TLFNSGVMVIEPSNCTFRLLMDHIDDIESY  155



>gb|KJB80585.1| hypothetical protein B456_013G105100 [Gossypium raimondii]
Length=534

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 95/157 (61%), Gaps = 5/157 (3%)
 Frame = +3

Query  363  SQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWI  539
             ++  EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +  Y +  L+A GW 
Sbjct  197  ERAGREAYATILHSAHVYVCGAITAAQSIRMSGSTRDLVILVDDSIGDYHRGGLEAAGWK  256

Query  540  VEEITLLANPNQVRPKRF--WGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
            +  I  + NP +  P+ +  W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  + 
Sbjct  257  IYTIQRIRNP-KAEPEAYNEWN-YSKFRLWQLTDYDKIIFIDADLLILRNIDFLFEMPEI  314

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
             A   ++   NSGVMV+EPS   F  +M  +N + SY
Sbjct  315  SAIGNNATLFNSGVMVIEPSNCTFQILMDHINEIKSY  351



>ref|NP_566615.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AAL07212.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13228.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76127.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=655

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  313  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  368

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  369  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  428

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  429  EISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESY  467



>ref|XP_011007557.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Populus euphratica]
Length=636

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAYVT+L+    ++ G     +SIR +G+T+D+V+LV + +S Y +  L+A GW +  I 
Sbjct  304  EAYVTILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKIRTIQ  363

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   +       Y+K +++  T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  364  RIRNPKAEKDAYNEWNYSKFRLWQQTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNA  423

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   FN +M  +N + SY
Sbjct  424  TLFNSGVMVIEPSNCTFNLLMEHINEIESY  453



>ref|NP_001189927.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AEE76129.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=654

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  312  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  367

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  368  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  427

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  428  EISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESY  466



>ref|XP_011007559.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X3 [Populus euphratica]
Length=630

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 90/150 (60%), Gaps = 1/150 (1%)
 Frame = +3

Query  378  EAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAYVT+L+    ++ G     +SIR +G+T+D+V+LV + +S Y +  L+A GW +  I 
Sbjct  298  EAYVTILHSAHVYVCGAIAAAQSIRLSGSTRDLVILVDETISVYHRSGLEAAGWKIRTIQ  357

Query  555  LLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKHS  734
             + NP   +       Y+K +++  T Y K++++DAD ++++NI+ LF   +  A   ++
Sbjct  358  RIRNPKAEKDAYNEWNYSKFRLWQQTDYDKIIFIDADLLILRNIDFLFGMPEISATGNNA  417

Query  735  ERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
               NSGVMV+EPS   FN +M  +N + SY
Sbjct  418  TLFNSGVMVIEPSNCTFNLLMEHINEIESY  447



>ref|NP_001030722.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 sp|Q9LSB1.1|GUX1_ARATH RecName: Full=UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1; Short=UDP-GlcA:xylan glucuronyltransferase 1; AltName: 
Full=Glycogenin-like protein 1; AltName: Full=Plant glycogenin-like 
starch initiation protein 1; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 1; Short=AtGUX1 [Arabidopsis 
thaliana]
 dbj|BAB01792.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU93699.1| glycogenin-like starch initiation protein [Arabidopsis thaliana]
 gb|AEE76128.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AHL38759.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=659

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  317  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  372

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  373  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  432

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  433  EISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESY  471



>gb|EGT40433.1| hypothetical protein CAEBREN_07033 [Caenorhabditis brenneri]
Length=447

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 93/157 (59%), Gaps = 1/157 (1%)
 Frame = +3

Query  357  PRSQSSEE-AYVTLLYGDEFLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADG  533
            P S + ++ AYV++L  ++FL+  +VL   +R   ++   +++V+  ++ Y+   L+A G
Sbjct  15   PESVTPQKYAYVSVLSSNDFLIPAKVLAYRLRKLNSSIPYIIIVTQDITDYSISELKAQG  74

Query  534  WIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKF  713
             IV   T +  P     K     YTK++++ MT +  +V+LD D +  ++I  LFKCG F
Sbjct  75   VIVHNDTKIDTPYIATHKARKYQYTKIRLWAMTEFDVIVHLDLDVLPTRDISTLFKCGSF  134

Query  714  CANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            CA  +HS+  NSGV V++ ++ VF+DM+  V T  SY
Sbjct  135  CAVFRHSDMFNSGVFVLKTNETVFHDMVQHVQTAESY  171



>ref|XP_006297149.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
 gb|EOA30047.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
Length=664

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  351  GEPRSQSSEEAYVTLLYGDE-FLLGVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQA  527
            G P+     EAY T+L+    ++ G     +SIR +G+T+D+V+LV D +S Y +  L+A
Sbjct  321  GNPK----REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEA  376

Query  528  DGWIVEEITLLANPNQVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCG  707
             GW +  I  + NP   +       Y+K +++ +T Y K++++DAD ++++NI+ LF   
Sbjct  377  AGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMP  436

Query  708  KFCANLKHSERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +  A   +    NSGVMV+EP    F  +M  +N + SY
Sbjct  437  EISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESY  475



>ref|XP_006416296.1| hypothetical protein EUTSA_v10007050mg [Eutrema salsugineum]
 gb|ESQ34649.1| hypothetical protein EUTSA_v10007050mg [Eutrema salsugineum]
Length=634

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 89/151 (59%), Gaps = 3/151 (2%)
 Frame = +3

Query  378  EAYVTLLYGDEFLL-GVRVLGKSIRDTGTTKDMVVLVSDGVSSYAKQLLQADGWIVEEIT  554
            EAY T+L+   F + G     +SIR  G+T+D+V+LV D ++ Y +  L A GW +  I 
Sbjct  302  EAYATILHSANFYVCGAITAAQSIRMAGSTRDLVILVDDSITEYHRGGLAAAGWKIYPIQ  361

Query  555  LLANPN-QVRPKRFWGVYTKLKIFNMTRYKKVVYLDADTIVVKNIEDLFKCGKFCANLKH  731
             + NP  +      W  Y+K +++ +T Y K++++DAD ++++NI+ LF+  +  A   +
Sbjct  362  RIRNPKAEAEAYNEWN-YSKFRLWQLTEYDKIIFIDADMLILRNIDFLFEMPEISATGNN  420

Query  732  SERLNSGVMVVEPSKEVFNDMMSKVNTLHSY  824
            +   NSGVMVVEPS   F  +M  +N + SY
Sbjct  421  ATLFNSGVMVVEPSNSTFQLLMDHINEIVSY  451



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1765995469312