BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11325

Length=966
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757181.1|  PREDICTED: mitochondrial-processing peptidas...    318   4e-101   Nicotiana sylvestris
ref|XP_009597035.1|  PREDICTED: mitochondrial-processing peptidas...    317   9e-101   Nicotiana tomentosiformis
ref|XP_006353507.1|  PREDICTED: mitochondrial-processing peptidas...    317   2e-100   
ref|XP_004251648.1|  PREDICTED: mitochondrial-processing peptidas...    315   5e-100   Solanum lycopersicum
ref|NP_001275168.1|  mitochondrial-processing peptidase subunit a...    315   7e-100   Solanum tuberosum [potatoes]
ref|XP_011093661.1|  PREDICTED: mitochondrial-processing peptidas...    314   1e-99    Sesamum indicum [beniseed]
ref|XP_011093662.1|  PREDICTED: mitochondrial-processing peptidas...    314   2e-99    Sesamum indicum [beniseed]
ref|XP_002283310.1|  PREDICTED: mitochondrial-processing peptidas...    313   3e-99    Vitis vinifera
ref|XP_010688376.1|  PREDICTED: mitochondrial-processing peptidas...    313   4e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001274924.1|  mitochondrial-processing peptidase subunit a...    313   5e-99    Solanum tuberosum [potatoes]
ref|XP_010049597.1|  PREDICTED: mitochondrial-processing peptidas...    312   7e-99    Eucalyptus grandis [rose gum]
ref|XP_009602845.1|  PREDICTED: mitochondrial-processing peptidas...    310   1e-97    Nicotiana tomentosiformis
ref|XP_009783210.1|  PREDICTED: mitochondrial-processing peptidas...    307   7e-97    Nicotiana sylvestris
gb|EPS62572.1|  mitochondrial processing peptidase                      306   8e-97    Genlisea aurea
ref|XP_006451349.1|  hypothetical protein CICLE_v10008040mg             306   2e-96    Citrus clementina [clementine]
ref|XP_006475356.1|  PREDICTED: mitochondrial-processing peptidas...    306   3e-96    Citrus sinensis [apfelsine]
ref|XP_003530483.1|  PREDICTED: mitochondrial-processing peptidas...    305   7e-96    Glycine max [soybeans]
gb|KHN16661.1|  Mitochondrial-processing peptidase subunit alpha        305   9e-96    Glycine soja [wild soybean]
emb|CDP03229.1|  unnamed protein product                                304   1e-95    Coffea canephora [robusta coffee]
gb|KJB83097.1|  hypothetical protein B456_013G229300                    303   2e-95    Gossypium raimondii
gb|KHG30214.1|  Mitochondrial-processing peptidase subunit alpha        303   4e-95    Gossypium arboreum [tree cotton]
ref|XP_003630686.1|  Mitochondrial-processing peptidase subunit a...    302   7e-95    Medicago truncatula
ref|XP_003525296.1|  PREDICTED: mitochondrial-processing peptidas...    301   3e-94    Glycine max [soybeans]
ref|XP_004503508.1|  PREDICTED: mitochondrial-processing peptidas...    300   4e-94    Cicer arietinum [garbanzo]
gb|EYU27247.1|  hypothetical protein MIMGU_mgv1a004049mg                299   3e-93    Erythranthe guttata [common monkey flower]
gb|ACJ86233.1|  unknown                                                 298   4e-93    Medicago truncatula
ref|XP_007012969.1|  Insulinase protein isoform 1                       300   5e-93    
ref|XP_010244405.1|  PREDICTED: mitochondrial-processing peptidas...    297   6e-93    Nelumbo nucifera [Indian lotus]
ref|XP_010914811.1|  PREDICTED: mitochondrial-processing peptidas...    296   1e-92    Elaeis guineensis
ref|XP_010924455.1|  PREDICTED: mitochondrial-processing peptidas...    296   2e-92    Elaeis guineensis
ref|XP_009415735.1|  PREDICTED: mitochondrial-processing peptidas...    294   8e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799765.1|  PREDICTED: mitochondrial-processing peptidas...    294   1e-91    Phoenix dactylifera
ref|XP_011078227.1|  PREDICTED: mitochondrial-processing peptidas...    293   2e-91    Sesamum indicum [beniseed]
gb|EYU30680.1|  hypothetical protein MIMGU_mgv1a004957mg                293   3e-91    Erythranthe guttata [common monkey flower]
gb|KGN60560.1|  hypothetical protein Csa_2G000680                       292   4e-91    Cucumis sativus [cucumbers]
ref|XP_008459098.1|  PREDICTED: mitochondrial-processing peptidas...    292   4e-91    Cucumis melo [Oriental melon]
ref|XP_004141034.2|  PREDICTED: mitochondrial-processing peptidas...    292   5e-91    Cucumis sativus [cucumbers]
ref|XP_002283426.1|  PREDICTED: mitochondrial-processing peptidas...    292   6e-91    Vitis vinifera
ref|XP_007160267.1|  hypothetical protein PHAVU_002G306900g             291   2e-90    Phaseolus vulgaris [French bean]
gb|KHF99831.1|  Mitochondrial-processing peptidase subunit alpha        290   4e-90    Gossypium arboreum [tree cotton]
gb|KJB27183.1|  hypothetical protein B456_004G282800                    288   2e-89    Gossypium raimondii
ref|XP_010086910.1|  Mitochondrial-processing peptidase subunit a...    286   7e-89    Morus notabilis
dbj|BAB62405.1|  mitochondrial processing peptidase alpha subunit       285   2e-88    Morus alba
ref|XP_006853743.1|  PREDICTED: mitochondrial-processing peptidas...    285   4e-88    Amborella trichopoda
ref|XP_004149179.1|  PREDICTED: mitochondrial-processing peptidas...    284   7e-88    Cucumis sativus [cucumbers]
ref|XP_004510321.1|  PREDICTED: mitochondrial-processing peptidas...    284   1e-87    Cicer arietinum [garbanzo]
ref|XP_008447564.1|  PREDICTED: mitochondrial-processing peptidas...    283   1e-87    Cucumis melo [Oriental melon]
ref|XP_007135618.1|  hypothetical protein PHAVU_010G144000g             283   1e-87    Phaseolus vulgaris [French bean]
ref|XP_003531643.1|  PREDICTED: mitochondrial-processing peptidas...    283   2e-87    Glycine max [soybeans]
ref|XP_012069060.1|  PREDICTED: mitochondrial-processing peptidas...    283   2e-87    Jatropha curcas
ref|XP_003530042.1|  PREDICTED: mitochondrial-processing peptidas...    283   2e-87    Glycine max [soybeans]
gb|KHN39262.1|  Mitochondrial-processing peptidase subunit alpha        281   1e-86    Glycine soja [wild soybean]
ref|XP_008795498.1|  PREDICTED: mitochondrial-processing peptidas...    280   2e-86    Phoenix dactylifera
ref|XP_008795496.1|  PREDICTED: mitochondrial-processing peptidas...    280   2e-86    Phoenix dactylifera
gb|KJB27182.1|  hypothetical protein B456_004G282800                    280   2e-86    Gossypium raimondii
ref|XP_010062551.1|  PREDICTED: mitochondrial-processing peptidas...    279   5e-86    Eucalyptus grandis [rose gum]
gb|KDP40843.1|  hypothetical protein JCGZ_24842                         279   7e-86    Jatropha curcas
ref|XP_009409367.1|  PREDICTED: mitochondrial-processing peptidas...    279   7e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798591.1|  PREDICTED: mitochondrial-processing peptidas...    278   1e-85    Phoenix dactylifera
ref|XP_008798592.1|  PREDICTED: mitochondrial-processing peptidas...    278   2e-85    
ref|XP_009344488.1|  PREDICTED: mitochondrial-processing peptidas...    277   4e-85    Pyrus x bretschneideri [bai li]
ref|XP_008380841.1|  PREDICTED: mitochondrial-processing peptidas...    276   7e-85    Malus domestica [apple tree]
ref|XP_010231138.1|  PREDICTED: mitochondrial-processing peptidas...    275   2e-84    Brachypodium distachyon [annual false brome]
ref|XP_002515947.1|  mitochondrial processing peptidase alpha sub...    275   2e-84    
ref|XP_003627059.1|  Mitochondrial-processing peptidase subunit a...    275   2e-84    Medicago truncatula
gb|ADE77223.1|  unknown                                                 275   3e-84    Picea sitchensis
ref|XP_003546593.1|  PREDICTED: mitochondrial-processing peptidas...    274   4e-84    Glycine max [soybeans]
ref|XP_007150592.1|  hypothetical protein PHAVU_005G1652000g            272   1e-83    Phaseolus vulgaris [French bean]
ref|XP_006644677.1|  PREDICTED: mitochondrial-processing peptidas...    270   1e-82    Oryza brachyantha
gb|EMS54290.1|  Mitochondrial-processing peptidase subunit alpha        266   2e-82    Triticum urartu
ref|XP_004961441.1|  PREDICTED: mitochondrial-processing peptidas...    270   2e-82    Setaria italica
ref|XP_009338746.1|  PREDICTED: mitochondrial-processing peptidas...    270   2e-82    Pyrus x bretschneideri [bai li]
ref|XP_010232283.1|  PREDICTED: mitochondrial-processing peptidas...    269   3e-82    Brachypodium distachyon [annual false brome]
ref|NP_001044193.1|  Os01g0739000                                       269   3e-82    
ref|XP_002514191.1|  mitochondrial processing peptidase alpha sub...    269   4e-82    Ricinus communis
gb|AAV44043.1|  putative mitochondrial processing peptidase alpha...    264   1e-81    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ13476.1|  hypothetical protein OsJ_03392                          269   1e-81    Oryza sativa Japonica Group [Japonica rice]
gb|EEC71449.1|  hypothetical protein OsI_03671                          268   3e-81    Oryza sativa Indica Group [Indian rice]
gb|ACN36870.1|  unknown                                                 265   4e-81    Zea mays [maize]
gb|KJB68193.1|  hypothetical protein B456_010G231200                    262   7e-81    Gossypium raimondii
ref|XP_003542085.1|  PREDICTED: mitochondrial-processing peptidas...    264   2e-80    Glycine max [soybeans]
ref|NP_001056089.1|  Os05g0524300                                       264   2e-80    
ref|NP_001146680.1|  uncharacterized protein LOC100280280               264   2e-80    Zea mays [maize]
gb|EEE64417.1|  hypothetical protein OsJ_19261                          264   3e-80    Oryza sativa Japonica Group [Japonica rice]
gb|KJB83096.1|  hypothetical protein B456_013G229300                    264   3e-80    Gossypium raimondii
gb|AFW78811.1|  putative mitochondrial processing peptidase alpha...    264   3e-80    
ref|XP_008228401.1|  PREDICTED: mitochondrial-processing peptidas...    263   8e-80    Prunus mume [ume]
ref|XP_002299745.1|  mitochondrial processing peptidase alpha sub...    263   8e-80    Populus trichocarpa [western balsam poplar]
ref|XP_007215264.1|  hypothetical protein PRUPE_ppa004554mg             263   9e-80    Prunus persica
gb|KJB68192.1|  hypothetical protein B456_010G231200                    262   2e-79    Gossypium raimondii
ref|XP_010098163.1|  Mitochondrial-processing peptidase subunit a...    262   2e-79    Morus notabilis
gb|EEC79554.1|  hypothetical protein OsI_20678                          263   1e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_011000940.1|  PREDICTED: mitochondrial-processing peptidas...    259   2e-78    Populus euphratica
ref|XP_006465713.1|  PREDICTED: mitochondrial-processing peptidas...    259   4e-78    Citrus sinensis [apfelsine]
gb|KDO51844.1|  hypothetical protein CISIN_1g010650mg                   258   5e-78    Citrus sinensis [apfelsine]
ref|XP_006426849.1|  hypothetical protein CICLE_v10025419mg             258   5e-78    Citrus clementina [clementine]
ref|XP_008242460.1|  PREDICTED: mitochondrial-processing peptidas...    258   6e-78    Prunus mume [ume]
ref|XP_011012737.1|  PREDICTED: mitochondrial-processing peptidas...    258   7e-78    Populus euphratica
ref|XP_004302845.1|  PREDICTED: mitochondrial-processing peptidas...    257   2e-77    Fragaria vesca subsp. vesca
ref|XP_010688377.1|  PREDICTED: mitochondrial-processing peptidas...    256   2e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010931091.1|  PREDICTED: mitochondrial-processing peptidas...    256   5e-77    Elaeis guineensis
ref|XP_007204564.1|  hypothetical protein PRUPE_ppa004446mg             249   2e-74    
gb|AFK44732.1|  unknown                                                 238   4e-74    Lotus japonicus
ref|XP_006426848.1|  hypothetical protein CICLE_v10025419mg             248   4e-74    
gb|KDO51843.1|  hypothetical protein CISIN_1g010650mg                   248   4e-74    Citrus sinensis [apfelsine]
gb|ACJ86214.1|  unknown                                                 236   2e-72    Medicago truncatula
ref|XP_007024339.1|  Mitochondrial-processing peptidase subunit a...    243   2e-72    
ref|XP_010465671.1|  PREDICTED: probable mitochondrial-processing...    242   6e-72    Camelina sativa [gold-of-pleasure]
emb|CDY46536.1|  BnaA08g01750D                                          242   6e-72    Brassica napus [oilseed rape]
ref|XP_009107159.1|  PREDICTED: probable mitochondrial-processing...    242   8e-72    Brassica rapa
gb|KFK35813.1|  hypothetical protein AALP_AA4G040900                    242   1e-71    Arabis alpina [alpine rockcress]
ref|XP_006854718.2|  PREDICTED: mitochondrial-processing peptidas...    241   2e-71    Amborella trichopoda
ref|XP_009414834.1|  PREDICTED: mitochondrial-processing peptidas...    241   2e-71    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY45641.1|  BnaA05g15080D                                          241   2e-71    Brassica napus [oilseed rape]
ref|XP_009144867.1|  PREDICTED: probable mitochondrial-processing...    241   2e-71    Brassica rapa
ref|XP_010528943.1|  PREDICTED: probable mitochondrial-processing...    241   3e-71    Tarenaya hassleriana [spider flower]
ref|XP_010535186.1|  PREDICTED: probable mitochondrial-processing...    241   3e-71    Tarenaya hassleriana [spider flower]
emb|CDY33843.1|  BnaC06g05100D                                          240   5e-71    Brassica napus [oilseed rape]
emb|CDX87868.1|  BnaC06g09300D                                          239   9e-71    
gb|KGN58021.1|  hypothetical protein Csa_3G435020                       239   9e-71    Cucumis sativus [cucumbers]
emb|CDM84014.1|  unnamed protein product                                239   1e-70    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010500794.1|  PREDICTED: probable mitochondrial-processing...    239   1e-70    Camelina sativa [gold-of-pleasure]
ref|NP_175610.1|  putative mitochondrial-processing peptidase sub...    238   2e-70    Arabidopsis thaliana [mouse-ear cress]
gb|EMT18398.1|  Mitochondrial-processing peptidase subunit alpha        239   3e-70    
gb|AAM65922.1|  mitochondrial processing peptidase alpha subunit,...    238   3e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CDY53441.1|  BnaC03g78020D                                          238   3e-70    Brassica napus [oilseed rape]
ref|XP_002894348.1|  hypothetical protein ARALYDRAFT_474319             238   4e-70    
emb|CDY22877.1|  BnaA06g02000D                                          238   4e-70    Brassica napus [oilseed rape]
ref|XP_010479701.1|  PREDICTED: probable mitochondrial-processing...    238   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010487509.1|  PREDICTED: probable mitochondrial-processing...    237   5e-70    Camelina sativa [gold-of-pleasure]
ref|XP_006307303.1|  hypothetical protein CARUB_v10008921mg             236   3e-69    Capsella rubella
ref|XP_006299456.1|  hypothetical protein CARUB_v10015621mg             235   4e-69    Capsella rubella
ref|XP_009147720.1|  PREDICTED: probable mitochondrial-processing...    235   4e-69    Brassica rapa
ref|XP_010462039.1|  PREDICTED: probable mitochondrial-processing...    234   8e-69    Camelina sativa [gold-of-pleasure]
gb|EMS48740.1|  Mitochondrial-processing peptidase subunit alpha        234   1e-68    Triticum urartu
gb|KJB83098.1|  hypothetical protein B456_013G229300                    233   3e-68    Gossypium raimondii
ref|NP_566548.1|  mitochondrial processing peptidase alpha subunit      233   3e-68    Arabidopsis thaliana [mouse-ear cress]
emb|CBI30865.3|  unnamed protein product                                234   4e-68    Vitis vinifera
ref|XP_006392973.1|  hypothetical protein EUTSA_v10011412mg             232   5e-68    Eutrema salsugineum [saltwater cress]
ref|XP_002987658.1|  hypothetical protein SELMODRAFT_126515             232   5e-68    
ref|XP_002987595.1|  hypothetical protein SELMODRAFT_183257             232   9e-68    Selaginella moellendorffii
gb|ERN16185.1|  hypothetical protein AMTR_s00030p00236070               231   1e-67    Amborella trichopoda
gb|AAK59675.1|  putative mitochondrial processing peptidase alpha...    231   1e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287497.1|  PREDICTED: mitochondrial-processing peptidas...    230   5e-67    Fragaria vesca subsp. vesca
ref|XP_008354423.1|  PREDICTED: mitochondrial-processing peptidas...    230   6e-67    
ref|XP_010545654.1|  PREDICTED: probable mitochondrial-processing...    229   7e-67    Tarenaya hassleriana [spider flower]
gb|EAY77359.1|  hypothetical protein OsI_05342                          227   1e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_010504356.1|  PREDICTED: probable mitochondrial-processing...    228   1e-66    Camelina sativa [gold-of-pleasure]
gb|KFK38993.1|  hypothetical protein AALP_AA3G186200                    227   5e-66    Arabis alpina [alpine rockcress]
ref|NP_001045501.1|  Os01g0966300                                       226   5e-66    
ref|XP_006406832.1|  hypothetical protein EUTSA_v10020561mg             227   6e-66    Eutrema salsugineum [saltwater cress]
ref|XP_001759462.1|  predicted protein                                  226   9e-66    
ref|XP_010504362.1|  PREDICTED: probable mitochondrial-processing...    226   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_001765307.1|  predicted protein                                  226   2e-65    
ref|XP_004971384.1|  PREDICTED: mitochondrial-processing peptidas...    225   2e-65    
ref|XP_002883011.1|  mppalpha                                           225   3e-65    
dbj|BAE98617.1|  hypothetical protein                                   224   4e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457003.1|  hypothetical protein SORBIDRAFT_03g047030          223   9e-65    
ref|XP_006595117.1|  PREDICTED: mitochondrial-processing peptidas...    223   1e-64    Glycine max [soybeans]
dbj|BAJ89700.1|  predicted protein                                      222   3e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDJ26330.1|  unnamed protein product                                222   4e-64    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009146083.1|  PREDICTED: probable mitochondrial-processing...    221   6e-64    Brassica rapa
emb|CDX92075.1|  BnaA05g23320D                                          221   7e-64    
ref|NP_001167727.1|  putative mitochondrial processing peptidase ...    220   2e-63    Zea mays [maize]
gb|EMT01864.1|  ABC transporter D family member 1                       229   3e-63    
emb|CDY43102.1|  BnaC05g36750D                                          219   3e-63    Brassica napus [oilseed rape]
ref|XP_006645345.1|  PREDICTED: mitochondrial-processing peptidas...    219   4e-63    
ref|NP_001150614.1|  mitochondrial-processing peptidase alpha sub...    217   3e-62    
ref|XP_001777355.1|  predicted protein                                  217   4e-62    
ref|XP_001753960.1|  predicted protein                                  216   5e-62    
gb|EAY72858.1|  hypothetical protein OsI_00727                          215   1e-61    Oryza sativa Indica Group [Indian rice]
ref|NP_001042272.1|  Os01g0191500                                       215   1e-61    
gb|ACG24289.1|  mitochondrial-processing peptidase alpha subunit        215   2e-61    Zea mays [maize]
ref|NP_001241707.1|  putative mitochondrial processing peptidase ...    214   3e-61    Zea mays [maize]
gb|ACN28785.1|  unknown                                                 214   4e-61    Zea mays [maize]
ref|XP_003564704.1|  PREDICTED: mitochondrial-processing peptidas...    213   7e-61    Brachypodium distachyon [annual false brome]
ref|XP_006583043.1|  PREDICTED: mitochondrial-processing peptidas...    211   2e-60    
ref|XP_002457199.1|  hypothetical protein SORBIDRAFT_03g003160          212   2e-60    Sorghum bicolor [broomcorn]
gb|AAG42149.1|  mitochondrial processing peptidase alpha-chain pr...    212   3e-60    Dactylis glomerata [cocksfoot]
ref|XP_006643862.1|  PREDICTED: mitochondrial-processing peptidas...    211   6e-60    Oryza brachyantha
ref|XP_010233616.1|  PREDICTED: ABC transporter D family member 1...    218   3e-59    
ref|XP_004968500.1|  PREDICTED: mitochondrial-processing peptidas...    209   3e-59    Setaria italica
dbj|BAH57110.1|  AT3G16480                                              196   2e-58    Arabidopsis thaliana [mouse-ear cress]
emb|CDM81679.1|  unnamed protein product                                206   3e-58    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010232284.1|  PREDICTED: mitochondrial-processing peptidas...    205   6e-58    
ref|XP_010655809.1|  PREDICTED: uncharacterized protein LOC100255464    209   8e-58    
ref|XP_008655316.1|  PREDICTED: uncharacterized protein LOC100384...    204   1e-57    
dbj|BAH20269.1|  AT3G16480                                              193   3e-57    Arabidopsis thaliana [mouse-ear cress]
gb|KJB68194.1|  hypothetical protein B456_010G231200                    202   3e-57    Gossypium raimondii
ref|XP_002992589.1|  hypothetical protein SELMODRAFT_448827             202   2e-56    Selaginella moellendorffii
gb|KCW82289.1|  hypothetical protein EUGRSUZ_C03704                     200   3e-56    Eucalyptus grandis [rose gum]
gb|KDO55872.1|  hypothetical protein CISIN_1g0104472mg                  189   3e-56    Citrus sinensis [apfelsine]
ref|XP_006451348.1|  hypothetical protein CICLE_v10008040mg             196   1e-54    
ref|XP_008799681.1|  PREDICTED: mitochondrial-processing peptidas...    194   5e-54    Phoenix dactylifera
ref|XP_006378186.1|  hypothetical protein POPTR_0010s04610g             194   1e-53    
ref|XP_002311791.2|  hypothetical protein POPTR_0008s19750g             184   2e-50    
gb|EMS58411.1|  Mitochondrial-processing peptidase subunit alpha        179   3e-48    Triticum urartu
ref|XP_006595118.1|  PREDICTED: mitochondrial-processing peptidas...    176   2e-47    Glycine max [soybeans]
gb|EMT19127.1|  Mitochondrial-processing peptidase subunit alpha        179   2e-47    
ref|NP_001077701.1|  putative mitochondrial-processing peptidase ...    176   4e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005846410.1|  hypothetical protein CHLNCDRAFT_36005              173   1e-45    Chlorella variabilis
ref|XP_006392972.1|  hypothetical protein EUTSA_v10011412mg             172   1e-45    
gb|KDO51845.1|  hypothetical protein CISIN_1g010650mg                   171   3e-45    Citrus sinensis [apfelsine]
ref|XP_005645630.1|  LuxS/MPP-like metallohydrolase                     166   5e-43    Coccomyxa subellipsoidea C-169
ref|XP_001422415.1|  predicted protein                                  160   3e-41    Ostreococcus lucimarinus CCE9901
emb|CEG00820.1|  Metalloenzyme, LuxS/M16 peptidase-like                 159   7e-41    Ostreococcus tauri
ref|XP_002508413.1|  predicted protein                                  158   1e-40    Micromonas commoda
ref|XP_003084396.1|  putative mitochondrial processing peptidase ...    158   3e-39    
gb|KHG28938.1|  Mitochondrial-processing peptidase subunit alpha        152   1e-38    Gossypium arboreum [tree cotton]
ref|XP_007509007.1|  predicted protein                                  150   1e-37    Bathycoccus prasinos
ref|XP_011399005.1|  putative mitochondrial-processing peptidase ...    147   1e-36    Auxenochlorella protothecoides
gb|KIZ01234.1|  processing peptidase alpha subunit                      141   8e-35    Monoraphidium neglectum
emb|CDJ37319.1|  mitochondrial-processing peptidase alpha subunit...    142   2e-34    Eimeria tenella
emb|CDJ66462.1|  mitochondrial-processing peptidase alpha subunit...    141   2e-34    Eimeria necatrix
ref|XP_003062937.1|  predicted protein                                  139   8e-34    Micromonas pusilla CCMP1545
gb|KHN30017.1|  Mitochondrial-processing peptidase subunit alpha        139   9e-34    Glycine soja [wild soybean]
ref|XP_005779248.1|  mitochondrial processing peptidase                 137   1e-33    Emiliania huxleyi CCMP1516
ref|XP_001970552.1|  GG10696                                            139   2e-33    Drosophila erecta
gb|EFN77279.1|  Mitochondrial-processing peptidase subunit alpha        138   2e-33    Harpegnathos saltator
ref|XP_002016657.1|  GL10384                                            138   3e-33    Drosophila persimilis
ref|XP_001361470.1|  GA21285                                            138   3e-33    Drosophila pseudoobscura pseudoobscura
ref|XP_011150400.1|  PREDICTED: mitochondrial-processing peptidas...    138   4e-33    
ref|XP_011150404.1|  PREDICTED: mitochondrial-processing peptidas...    138   4e-33    Harpegnathos saltator
ref|NP_610333.1|  CG8728                                                138   4e-33    Drosophila melanogaster
ref|XP_002032829.1|  GM20744                                            137   5e-33    Drosophila sechellia
ref|XP_001960990.1|  GF11230                                            136   1e-32    Drosophila ananassae
ref|XP_010915359.1|  PREDICTED: mitochondrial-processing peptidas...    129   1e-32    Elaeis guineensis
ref|XP_002089546.1|  GE23498                                            136   2e-32    Drosophila yakuba
ref|XP_010915360.1|  PREDICTED: mitochondrial-processing peptidas...    129   2e-32    
ref|XP_002080508.1|  GD10210                                            136   2e-32    
ref|XP_010915358.1|  PREDICTED: mitochondrial-processing peptidas...    129   2e-32    Elaeis guineensis
ref|XP_010915361.1|  PREDICTED: mitochondrial-processing peptidas...    129   2e-32    Elaeis guineensis
ref|XP_002063555.1|  GK21348                                            135   3e-32    Drosophila willistoni
gb|ERL94085.1|  hypothetical protein D910_11367                         134   5e-32    Dendroctonus ponderosae
gb|ENN72399.1|  hypothetical protein YQE_11033                          134   5e-32    Dendroctonus ponderosae
ref|XP_011506331.1|  PREDICTED: mitochondrial-processing peptidas...    134   1e-31    Ceratosolen solmsi marchali
ref|XP_002430518.1|  mitochondrial-processing peptidase alpha sub...    133   2e-31    Pediculus humanus corporis [human body lice]
gb|AFK45902.1|  unknown                                                 123   3e-31    Lotus japonicus
ref|XP_002132351.1|  GA25238                                            134   3e-31    Drosophila pseudoobscura pseudoobscura
emb|CCA25279.1|  conserved hypothetical protein                         132   5e-31    Albugo laibachii Nc14
ref|XP_317371.3|  AGAP008086-PA                                         130   9e-31    Anopheles gambiae str. PEST
ref|XP_009028455.1|  hypothetical protein HELRODRAFT_186101             131   9e-31    Helobdella robusta
ref|XP_005177966.1|  PREDICTED: mitochondrial-processing peptidas...    131   9e-31    Musca domestica
ref|XP_008862995.1|  hypothetical protein H310_01616                    131   1e-30    Aphanomyces invadans
ref|XP_004535752.1|  PREDICTED: mitochondrial-processing peptidas...    131   1e-30    Ceratitis capitata [medfly]
ref|XP_004535751.1|  PREDICTED: mitochondrial-processing peptidas...    130   1e-30    Ceratitis capitata [medfly]
ref|XP_009820980.1|  hypothetical protein H257_00138                    130   1e-30    Aphanomyces astaci
ref|XP_001986331.1|  GH20583                                            130   1e-30    Drosophila grimshawi
gb|ETN59954.1|  mitochondrial processing peptidase alpha subunit        130   1e-30    Anopheles darlingi [American malaria mosquito]
gb|KFB39416.1|  hypothetical protein ZHAS_00006962                      130   2e-30    Anopheles sinensis
ref|XP_001654562.1|  AAEL002068-PA                                      130   2e-30    Aedes aegypti
emb|CCI40388.1|  unnamed protein product                                130   3e-30    Albugo candida
emb|CCI40389.1|  unnamed protein product                                129   3e-30    Albugo candida
ref|XP_002018830.1|  GL26015                                            131   3e-30    
ref|XP_009513783.1|  hypothetical protein PHYSODRAFT_320443             129   3e-30    Phytophthora sojae
ref|XP_008904779.1|  hypothetical protein PPTG_11254                    129   5e-30    Phytophthora parasitica INRA-310
gb|ETM47544.1|  hypothetical protein L914_07753                         129   5e-30    Phytophthora parasitica
gb|ETL94313.1|  hypothetical protein L917_07681                         129   5e-30    Phytophthora parasitica
gb|ETK87731.1|  hypothetical protein L915_07867                         129   6e-30    Phytophthora parasitica
gb|KDR08018.1|  Mitochondrial-processing peptidase subunit alpha        129   6e-30    Zootermopsis nevadensis
gb|ETO76520.1|  hypothetical protein F444_08080                         129   6e-30    Phytophthora parasitica P1976
ref|XP_002895747.1|  conserved hypothetical protein                     128   6e-30    Phytophthora infestans T30-4
ref|XP_008555589.1|  PREDICTED: mitochondrial-processing peptidas...    129   6e-30    Microplitis demolitor
ref|XP_002132353.1|  GA25237                                            130   7e-30    Drosophila pseudoobscura pseudoobscura
ref|XP_001697130.1|  mitochondrial processing peptidase alpha sub...    128   8e-30    Chlamydomonas reinhardtii
gb|EFN62998.1|  Mitochondrial-processing peptidase subunit alpha        128   9e-30    Camponotus floridanus
ref|XP_011264138.1|  PREDICTED: mitochondrial-processing peptidas...    128   1e-29    
ref|XP_011264137.1|  PREDICTED: mitochondrial-processing peptidas...    128   1e-29    Camponotus floridanus
ref|XP_011264136.1|  PREDICTED: mitochondrial-processing peptidas...    128   1e-29    
ref|XP_011264139.1|  PREDICTED: mitochondrial-processing peptidas...    128   1e-29    
ref|XP_002004209.1|  GI19728                                            127   1e-29    Drosophila mojavensis
ref|XP_011207200.1|  PREDICTED: mitochondrial-processing peptidas...    127   2e-29    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011867025.1|  PREDICTED: mitochondrial-processing peptidas...    127   2e-29    Vollenhovia emeryi
ref|XP_011867027.1|  PREDICTED: mitochondrial-processing peptidas...    127   2e-29    Vollenhovia emeryi
ref|XP_011867026.1|  PREDICTED: mitochondrial-processing peptidas...    127   2e-29    Vollenhovia emeryi
gb|KFG61960.1|  mitochondrial processing peptidase alpha subunit        124   3e-29    Toxoplasma gondii RUB
ref|XP_011867024.1|  PREDICTED: mitochondrial-processing peptidas...    127   3e-29    Vollenhovia emeryi
gb|EFX81363.1|  hypothetical protein DAPPUDRAFT_303461                  126   3e-29    Daphnia pulex
ref|XP_011304621.1|  PREDICTED: mitochondrial-processing peptidas...    126   3e-29    Fopius arisanus
gb|KFG53664.1|  mitochondrial processing peptidase alpha subunit        123   3e-29    
ref|XP_011671850.1|  PREDICTED: mitochondrial-processing peptidas...    126   4e-29    
ref|XP_011186269.1|  PREDICTED: mitochondrial-processing peptidas...    126   4e-29    
ref|XP_011671849.1|  PREDICTED: mitochondrial-processing peptidas...    126   4e-29    
ref|NP_001164373.1|  mitochondrial-processing peptidase subunit a...    126   5e-29    
ref|XP_008216400.1|  PREDICTED: mitochondrial-processing peptidas...    126   5e-29    
ref|XP_007024341.1|  Mitochondrial-processing peptidase subunit a...    125   5e-29    
emb|CEF62784.1|  Mitochondrial-processing peptidase subunit alpha       125   6e-29    
ref|XP_008655317.1|  PREDICTED: uncharacterized protein LOC100384...    125   6e-29    
ref|XP_011167374.1|  PREDICTED: mitochondrial-processing peptidas...    125   7e-29    
gb|AFK47763.1|  unknown                                                 117   7e-29    
ref|XP_011691545.1|  PREDICTED: mitochondrial-processing peptidas...    125   1e-28    
ref|XP_003487474.1|  PREDICTED: mitochondrial-processing peptidas...    125   1e-28    
gb|AGM32915.1|  mitochondrial-processing peptidase subunit alpha        121   1e-28    
ref|XP_003394101.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    125   1e-28    
ref|XP_011054949.1|  PREDICTED: mitochondrial-processing peptidas...    125   1e-28    
gb|EGI65188.1|  Mitochondrial-processing peptidase subunit alpha        125   1e-28    
ref|XP_003487473.1|  PREDICTED: mitochondrial-processing peptidas...    125   1e-28    
ref|XP_008615167.1|  hypothetical protein SDRG_10928                    124   3e-28    
ref|XP_006571935.1|  PREDICTED: mitochondrial-processing peptidas...    124   3e-28    
ref|XP_005854553.1|  hypothetical protein NGA_0239600                   122   3e-28    
ref|XP_008486611.1|  PREDICTED: mitochondrial-processing peptidas...    123   4e-28    
ref|XP_006611948.1|  PREDICTED: mitochondrial-processing peptidas...    124   4e-28    
ref|XP_008472588.1|  PREDICTED: mitochondrial-processing peptidas...    123   4e-28    
ref|XP_003693437.1|  PREDICTED: mitochondrial-processing peptidas...    124   4e-28    
gb|AAF00541.1|AF187883_1  mitochondrial processing peptidase alph...    122   5e-28    
ref|XP_003743034.1|  PREDICTED: mitochondrial-processing peptidas...    123   5e-28    
ref|XP_007012970.1|  Mitochondrial-processing peptidase subunit a...    122   6e-28    
ref|XP_002736805.1|  PREDICTED: mitochondrial-processing peptidas...    122   6e-28    
gb|KDO51228.1|  hypothetical protein CISIN_1g044668mg                   121   7e-28    
gb|EPR61611.1|  putative peptidase M16, alpha subunit                   123   8e-28    
gb|KDO55884.1|  hypothetical protein CISIN_1g0104471mg                  120   8e-28    
ref|XP_006451350.1|  hypothetical protein CICLE_v10008040mg             121   8e-28    
ref|XP_007024340.1|  Mitochondrial-processing peptidase subunit a...    122   8e-28    
gb|KDO55879.1|  hypothetical protein CISIN_1g0104471mg                  121   9e-28    
ref|XP_011635704.1|  PREDICTED: mitochondrial-processing peptidas...    122   9e-28    
ref|XP_008884556.1|  peptidase M16, alpha subunit, putative             122   9e-28    
gb|KDO55881.1|  hypothetical protein CISIN_1g0104471mg                  121   1e-27    
gb|KDO55880.1|  hypothetical protein CISIN_1g0104471mg                  121   1e-27    
ref|XP_005835389.1|  hypothetical protein GUITHDRAFT_106014             121   2e-27    
ref|XP_012064483.1|  PREDICTED: mitochondrial-processing peptidas...    122   2e-27    
ref|XP_002367551.1|  mitochondrial-processing peptidase alpha sub...    122   2e-27    
gb|EWM22363.1|  Peptidase M16                                           120   2e-27    
ref|XP_009065468.1|  hypothetical protein LOTGIDRAFT_222316             121   2e-27    
gb|EWM22439.1|  Peptidase M16                                           121   2e-27    
ref|XP_011347654.1|  PREDICTED: mitochondrial-processing peptidas...    121   3e-27    
ref|XP_003882465.1|  hypothetical protein NCLIV_022220                  120   5e-27    
gb|KFM72414.1|  Mitochondrial-processing peptidase subunit alpha        119   9e-27    
gb|KDO55876.1|  hypothetical protein CISIN_1g0104472mg                  110   1e-26    
ref|XP_011568759.1|  PREDICTED: mitochondrial-processing peptidas...    119   1e-26    
ref|XP_001630965.1|  predicted protein                                  118   2e-26    
ref|XP_004928540.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    118   2e-26    
gb|KDO55877.1|  hypothetical protein CISIN_1g0104472mg                  110   2e-26    
ref|XP_012152211.1|  PREDICTED: mitochondrial-processing peptidas...    118   3e-26    
gb|KDD75602.1|  hypothetical protein H632_c597p0                        111   3e-26    
ref|XP_003708190.1|  PREDICTED: mitochondrial-processing peptidas...    118   3e-26    
ref|XP_001894239.1|  Peptidase M16 inactive domain containing pro...    116   1e-25    
ref|XP_002154594.2|  PREDICTED: mitochondrial-processing peptidas...    112   1e-25    
emb|CCF75879.1|  unnamed protein product                                115   1e-25    
emb|CDP91068.1|  Protein BM-MPPA-1, isoform c                           116   2e-25    
ref|XP_005536642.1|  probable mitochondrial processing peptidase ...    116   2e-25    
ref|XP_004367827.1|  peptidase M16 inactive domain containing pro...    115   2e-25    
ref|XP_005709111.1|  mitochondrial processing peptidase                 114   3e-25    
ref|XP_971071.1|  PREDICTED: mitochondrial-processing peptidase s...    115   4e-25    
ref|XP_002945711.1|  hypothetical protein VOLCADRAFT_85964              114   5e-25    
gb|KDO33365.1|  hypothetical protein SPRG_02172                         114   5e-25    
gb|EMF15932.1|  Peptidase_M16-domain-containing protein                 115   5e-25    
ref|XP_002183564.1|  predicted protein                                  113   9e-25    
gb|EXX72384.1|  Mas2p                                                   114   9e-25    
gb|ERZ95649.1|  hypothetical protein GLOINDRAFT_341126                  114   1e-24    
ref|XP_002289075.1|  predicted protein                                  114   1e-24    
gb|EXX72385.1|  Mas2p                                                   114   1e-24    
gb|KFH70181.1|  hypothetical protein MVEG_04983                         113   2e-24    
gb|EIE79114.1|  hypothetical protein RO3G_03819                         113   2e-24    
gb|KIR51344.1|  mitochondrial processing peptidase                      112   2e-24    
ref|XP_003194466.1|  mtochondrial processing peptidase                  112   2e-24    
emb|CAG14582.1|  unnamed protein product                                108   2e-24    
gb|KIR99699.1|  mitochondrial processing peptidase                      112   2e-24    
gb|KIR28955.1|  mitochondrial processing peptidase                      112   3e-24    
gb|EJK70440.1|  hypothetical protein THAOC_08203                        112   3e-24    
gb|KGB79385.1|  mitochondrial processing peptidase                      112   3e-24    
ref|XP_002119957.1|  PREDICTED: mitochondrial-processing peptidas...    112   3e-24    
dbj|GAN06395.1|  mitochondrial processing peptidase                     112   4e-24    
ref|XP_007582798.1|  putative mitochondrial processing peptidase ...    113   4e-24    
gb|EPB89014.1|  hypothetical protein HMPREF1544_04137                   112   4e-24    
gb|KIR85021.1|  mitochondrial processing peptidase                      112   5e-24    
gb|KIR46153.1|  mitochondrial processing peptidase                      112   5e-24    
ref|XP_002406607.1|  mitochondrial processing peptidase alpha sub...    112   5e-24    
gb|EME47007.1|  hypothetical protein DOTSEDRAFT_69101                   112   5e-24    
emb|CEP11004.1|  hypothetical protein                                   112   5e-24    
ref|XP_012049922.1|  mitochondrial processing peptidase                 111   6e-24    
gb|KIR58819.1|  mitochondrial processing peptidase                      111   6e-24    
gb|AFX73001.1|  mitochondrial processing peptidase                      111   8e-24    
gb|EUT90739.1|  hypothetical protein PFAG_01096                         110   9e-24    
gb|ETW31797.1|  hypothetical protein PFFCH_00763                        109   9e-24    
sp|P97997.1|MPPA_BLAEM  RecName: Full=Mitochondrial-processing pe...    110   1e-23    
ref|XP_007923257.1|  hypothetical protein MYCFIDRAFT_150806             111   1e-23    
gb|EJW78411.1|  peptidase M16 inactive domain-containing protein        110   1e-23    
ref|XP_003136792.1|  peptidase M16 inactive domain-containing pro...    110   1e-23    
gb|ETW19961.1|  hypothetical protein PFFVO_01133                        109   1e-23    
ref|XP_002141375.1|  peptidase M16 inactive domain-containing pro...    110   1e-23    
emb|CEG85054.1|  Putative Mitochondrial processing peptidase, alp...    107   1e-23    
emb|CDO63109.1|  mitochondrial processing peptidase alpha subunit...    110   1e-23    
ref|XP_571156.1|  mitochondrial processing peptidase                    110   1e-23    
emb|CDS13277.1|  hypothetical protein LRAMOSA05455                      110   2e-23    
ref|XP_005089371.1|  PREDICTED: mitochondrial-processing peptidas...    110   2e-23    
ref|XP_001843657.1|  mitochondrial-processing peptidase alpha sub...    110   2e-23    
emb|CDH54037.1|  mitochondrial processing alpha subunit                 110   2e-23    
ref|XP_002787314.1|  conserved hypothetical protein                     110   2e-23    
ref|XP_002780898.1|  conserved hypothetical protein                     110   3e-23    
ref|XP_775189.1|  hypothetical protein CNBE4620                         109   3e-23    
ref|XP_003855277.1|  matrix processing peptidase of mitochondria        109   3e-23    
ref|XP_001945676.2|  PREDICTED: mitochondrial-processing peptidas...    109   3e-23    
ref|XP_001351788.2|  mitochondrial processing peptidase alpha sub...    109   3e-23    
gb|KDN46463.1|  hypothetical protein K437DRAFT_246510                   110   3e-23    
gb|ETW50752.1|  hypothetical protein PFMALIP_01200                      109   3e-23    
gb|KHN74662.1|  Mitochondrial-processing peptidase subunit alpha        110   3e-23    
gb|EWC90069.1|  hypothetical protein PFNF54_01193                       109   4e-23    
ref|XP_739393.1|  hypothetical protein                                  107   4e-23    
ref|XP_002600317.1|  hypothetical protein BRAFLDRAFT_118286             109   4e-23    
gb|EUR76701.1|  hypothetical protein PFBG_01123                         109   4e-23    
ref|XP_007024342.1|  Mitochondrial-processing peptidase subunit a...    107   4e-23    
gb|KKA65736.1|  Peptidase                                               108   6e-23    
ref|XP_003975159.1|  PREDICTED: mitochondrial-processing peptidas...    108   7e-23    
ref|XP_002259580.1|  mitochondrial processing peptidase alpha sub...    108   7e-23    
ref|XP_001613727.1|  mitochondrial processing peptidase alpha sub...    108   7e-23    
ref|XP_002935264.1|  PREDICTED: mitochondrial-processing peptidas...    108   8e-23    
ref|XP_004178343.1|  hypothetical protein TBLA_0A10460                  107   1e-22    
ref|XP_005817438.1|  PREDICTED: mitochondrial-processing peptidas...    104   1e-22    
ref|XP_007674552.1|  hypothetical protein BAUCODRAFT_55578              108   1e-22    
gb|EKG16560.1|  Peptidase M16 zinc-binding site                         108   1e-22    
gb|KJP87509.1|  hypothetical protein AK88_02813                         108   1e-22    
gb|KIN04225.1|  hypothetical protein OIDMADRAFT_159534                  108   1e-22    
gb|EFX02329.1|  mitochondrial processing peptidase alpha                107   1e-22    
ref|XP_004222783.1|  mitochondrial processing peptidase alpha sub...    107   1e-22    
ref|XP_008078602.1|  LuxS/MPP-like metallohydrolase                     108   1e-22    
gb|ETS64829.1|  hypothetical protein PaG_00797                          108   1e-22    
ref|XP_010784641.1|  PREDICTED: mitochondrial-processing peptidas...    107   1e-22    
ref|XP_001544249.1|  mitochondrial processing peptidase alpha sub...    103   2e-22    
ref|NP_001089466.1|  peptidase (mitochondrial processing) alpha         107   2e-22    
gb|EUD72298.1|  mitochondrial processing peptidase                      107   2e-22    
dbj|GAK64491.1|  mtochondrial processing peptidase                      108   2e-22    
ref|XP_744676.1|  mitochondrial processing peptidase alpha subunit      107   2e-22    
gb|KFA65492.1|  hypothetical protein S40285_00513                       108   2e-22    
gb|EST05590.1|  mitochondrial processing peptidase, alpha subunit       106   2e-22    
ref|XP_008623617.1|  mitochondrial processing peptidase                 107   2e-22    
gb|KEY69051.1|  hypothetical protein S7711_03349                        107   2e-22    
dbj|GAC94136.1|  hypothetical protein PHSY_001705                       108   2e-22    
gb|KJX92983.1|  mitochondrial-processing peptidase subunit alpha ...    107   2e-22    
dbj|GAC71863.1|  mitochondrial processing peptidase, alpha subunit      108   2e-22    
ref|XP_007006734.1|  hypothetical protein TREMEDRAFT_40551              107   2e-22    
ref|XP_008815202.1|  mitochondrial processing peptidase                 107   2e-22    
ref|XP_011127661.1|  hypothetical protein AOL_s00215g157                107   2e-22    
dbj|GAD95102.1|  hypothetical protein PVAR5_3741                        107   2e-22    
ref|XP_011449758.1|  PREDICTED: mitochondrial-processing peptidas...    107   2e-22    
emb|CCX32308.1|  Similar to Mitochondrial-processing peptidase su...    106   2e-22    
emb|CDQ64627.1|  unnamed protein product                                107   3e-22    
emb|CBQ72957.1|  probable mitochondrial processing peptidase alph...    107   3e-22    
ref|XP_007916066.1|  putative mitochondrial-processing peptidase ...    107   3e-22    
ref|XP_003454233.1|  PREDICTED: mitochondrial-processing peptidas...    106   3e-22    
gb|ETN84962.1|  hypothetical protein NECAME_01524                       105   3e-22    
emb|CDR97226.1|  mitochondrial processing peptidase alpha subunit...    106   3e-22    
ref|XP_007253920.1|  PREDICTED: mitochondrial-processing peptidas...    106   4e-22    
ref|XP_006640603.1|  PREDICTED: mitochondrial-processing peptidas...    106   4e-22    
ref|XP_011389001.1|  putative mitochondrial processing peptidase ...    107   4e-22    
ref|XP_009038836.1|  hypothetical protein AURANDRAFT_1996               105   4e-22    
ref|XP_730445.1|  mitochondrial processing peptidase subunit alph...    106   4e-22    
ref|XP_679923.1|  mitochondrial processing peptidase alpha subunit      106   4e-22    
ref|XP_007275988.1|  mitochondrial processing peptidase alpha           101   4e-22    
emb|CEG71991.1|  Putative Mitochondrial processing peptidase alph...    106   5e-22    
gb|KFG82731.1|  hypothetical protein MANI_003829                        105   5e-22    
emb|CEI99504.1|  Putative Mitochondrial processing peptidase alph...    106   5e-22    
emb|CEG81561.1|  Putative Mitochondrial processing peptidase alph...    106   5e-22    
gb|EER37410.1|  mitochondrial processing peptidase alpha subunit        103   6e-22    
gb|EHK99956.1|  putative Mitochondrial-processing peptidase subun...    101   6e-22    
ref|XP_010735128.1|  PREDICTED: mitochondrial-processing peptidas...    105   6e-22    
ref|XP_010208819.1|  PREDICTED: mitochondrial-processing peptidas...    103   7e-22    
emb|CDI53437.1|  probable mitochondrial processing peptidase alph...    106   8e-22    
emb|CDJ84623.1|  Peptidase M16 domain containing protein                105   8e-22    
ref|NP_001007443.1|  mitochondrial-processing peptidase subunit a...    105   1e-21    
gb|KJK89443.1|  hypothetical protein H633G_06692                        105   1e-21    
ref|XP_011703434.1|  PREDICTED: mitochondrial-processing peptidas...    105   1e-21    
gb|KID75063.1|  Peptidase M16, core                                     105   1e-21    
ref|XP_007825098.2|  mitochondrial processing peptidase alpha sub...    105   1e-21    
gb|KJK79439.1|  hypothetical protein H634G_05030                        105   1e-21    
gb|KID87417.1|  Peptidase M16, core                                     105   1e-21    
gb|EXU97322.1|  peptidase M16 family protein                            105   1e-21    
gb|KID64964.1|  Peptidase M16, core                                     105   1e-21    
ref|XP_004566807.1|  PREDICTED: mitochondrial-processing peptidas...    105   1e-21    
ref|XP_007810468.1|  mitochondrial processing peptidase alpha sub...    105   1e-21    
ref|XP_005743164.1|  PREDICTED: mitochondrial-processing peptidas...    105   1e-21    
ref|XP_009850780.1|  mitochondrial-processing peptidase subunit a...    105   1e-21    
gb|KID97673.1|  Peptidase M16, core                                     105   1e-21    
ref|XP_010607174.1|  PREDICTED: mitochondrial-processing peptidas...    104   1e-21    
ref|XP_962874.1|  mitochondrial-processing peptidase subunit alpha      105   1e-21    
gb|KGQ07660.1|  peptidase subunit alpha                                 103   1e-21    
gb|EYB91182.1|  hypothetical protein Y032_0209g2100                     104   1e-21    
emb|CDK26632.1|  unnamed protein product                                104   1e-21    
gb|EYB91183.1|  hypothetical protein Y032_0209g2100                     105   1e-21    
gb|AAA33597.1|  matrix processing peptidase                             105   1e-21    
ref|XP_006863762.1|  PREDICTED: mitochondrial-processing peptidas...    103   1e-21    
ref|XP_006803892.1|  PREDICTED: mitochondrial-processing peptidas...    104   2e-21    
ref|XP_008274637.1|  PREDICTED: mitochondrial-processing peptidas...    104   2e-21    
emb|CCF52811.1|  probable mitochondrial processing peptidase alph...    105   2e-21    
ref|XP_011368229.1|  PREDICTED: mitochondrial-processing peptidas...    100   2e-21    
ref|XP_008416176.1|  PREDICTED: mitochondrial-processing peptidas...    104   2e-21    
ref|XP_006581997.1|  PREDICTED: mitochondrial-processing peptidas...  97.1    2e-21    
dbj|GAO13498.1|  hypothetical protein UVI_004740                        105   2e-21    
ref|XP_004460717.1|  PREDICTED: mitochondrial-processing peptidas...    102   2e-21    
ref|XP_007557870.1|  PREDICTED: mitochondrial-processing peptidas...    104   2e-21    
emb|CDW57151.1|  mitochondrial processing peptidase subunit             103   2e-21    
ref|XP_006016930.1|  PREDICTED: mitochondrial-processing peptidas...    103   2e-21    
gb|KDN71763.1|  putative insulinase                                     104   2e-21    
gb|KDB18129.1|  putative mitochondrial processing peptidase alpha...    104   2e-21    
gb|KFO21487.1|  Mitochondrial-processing peptidase subunit alpha        104   2e-21    
gb|ENH86349.1|  mitochondrial processing peptidase                      104   2e-21    
gb|ELU13518.1|  hypothetical protein CAPTEDRAFT_155657                  102   2e-21    
ref|XP_009267568.1|  hypothetical protein J056_004084                   103   2e-21    
ref|XP_009186108.1|  PREDICTED: mitochondrial-processing peptidas...    103   2e-21    
gb|EPE10983.1|  mitochondrial processing peptidase alpha                104   2e-21    
ref|XP_003351545.1|  hypothetical protein SMAC_00087                    104   2e-21    



>ref|XP_009757181.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Nicotiana 
sylvestris]
Length=504

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFE+PGGW  EK++MTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN+YPQ+
Sbjct  304  MTHFALAFEVPGGWMSEKESMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNQYPQI  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             AFSAFSSI+N TGLFGIQATT+SDF  +AVD+AVKEL AIA+PGEVDQ QLDRAKQ+TK
Sbjct  364  QAFSAFSSIYNDTGLFGIQATTTSDFGPQAVDLAVKELIAIANPGEVDQVQLDRAKQSTK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+LTYGERKPVEHFLKAI+ VSAKDIAS+AQKLISSPLTMA
Sbjct  424  SAILMNLESRMVASEDIGRQLLTYGERKPVEHFLKAIDAVSAKDIASVAQKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LPSYD V
Sbjct  484  SYGDVLSLPSYDAV  497



>ref|XP_009597035.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Nicotiana 
tomentosiformis]
Length=504

 Score =   317 bits (813),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THF+LAFE+PGGW  EK++MTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN+YPQ+
Sbjct  304  MTHFSLAFEVPGGWMSEKESMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNQYPQI  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             AFSAFSSI+N TGLFGIQATT+SDF  +AVD+AVKEL AIASPGEVDQ QLDRAKQ+TK
Sbjct  364  QAFSAFSSIYNDTGLFGIQATTTSDFGPQAVDVAVKELVAIASPGEVDQVQLDRAKQSTK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+LTYGERKPVEHFLKAI+ VSAKDIAS+A KLISSPLTMA
Sbjct  424  SAILMNLESRMVASEDIGRQLLTYGERKPVEHFLKAIDAVSAKDIASVAHKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LPSYD V
Sbjct  484  SYGDVLSLPSYDAV  497



>ref|XP_006353507.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Solanum tuberosum]
Length=504

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFE+PGGW  EK++MTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN+YPQ+
Sbjct  304  MTHFALAFEVPGGWMSEKESMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNQYPQI  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            HAFSAFSSI+NSTGLFGIQ TTSSDF  +AVD+AVKEL A+A+P EVDQ QL+RAKQATK
Sbjct  364  HAFSAFSSIYNSTGLFGIQGTTSSDFGPQAVDVAVKELIAVANPSEVDQVQLNRAKQATK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+LTYGERKPVEHFLKAI+ VSAKDIAS  QKLISSPLTMA
Sbjct  424  SAILMNLESRMVASEDIGRQLLTYGERKPVEHFLKAIDAVSAKDIASFVQKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LPSYD V
Sbjct  484  SYGDVLSLPSYDAV  497



>ref|XP_004251648.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Solanum 
lycopersicum]
Length=504

 Score =   315 bits (808),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFE+PGGW  EK++MTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN+YPQ+
Sbjct  304  MTHFALAFEVPGGWMSEKESMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNQYPQI  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            HAFSAFSSI+N+TGLFGIQ TT SDF  +AVD+AVKEL A+A+P EVDQ QL+RAKQATK
Sbjct  364  HAFSAFSSIYNNTGLFGIQGTTGSDFGPQAVDVAVKELIAVANPSEVDQVQLNRAKQATK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+LTYGERKPVEHFLKAI+ VSAKDIAS+ QKLISSPLTMA
Sbjct  424  SAILMNLESRMVASEDIGRQLLTYGERKPVEHFLKAIDAVSAKDIASVVQKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LPSYD V
Sbjct  484  SYGDVLSLPSYDAV  497



>ref|NP_001275168.1| mitochondrial-processing peptidase subunit alpha [Solanum tuberosum]
 sp|P29677.1|MPPA_SOLTU RecName: Full=Mitochondrial-processing peptidase subunit alpha; 
AltName: Full=Alpha-MPP; AltName: Full=Ubiquinol-cytochrome-c 
reductase subunit II; Flags: Precursor [Solanum tuberosum]
 emb|CAA46990.1| mitochondrial processing peptidase [Solanum tuberosum]
Length=504

 Score =   315 bits (807),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFE+PGGW  EK++MTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN+YPQ+
Sbjct  304  MTHFALAFEVPGGWMSEKESMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNQYPQI  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            HAFSAFSSI+N+TGLFGIQ TTSSDF  +AVD+AVKEL A+A+P EVDQ QL+RAKQATK
Sbjct  364  HAFSAFSSIYNNTGLFGIQGTTSSDFGPQAVDVAVKELIAVANPSEVDQVQLNRAKQATK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+LTYGER PVEHFLKAI+ VSAKDIAS+ QKLISSPLTMA
Sbjct  424  SAILMNLESRMVASEDIGRQLLTYGERNPVEHFLKAIDAVSAKDIASVVQKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LPSYD V
Sbjct  484  SYGDVLSLPSYDAV  497



>ref|XP_011093661.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Sesamum indicum]
Length=505

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFELPGGW KEKDA+TLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNE+PQ+
Sbjct  305  ITHFALAFELPGGWVKEKDAITLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNEHPQI  364

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SI+N TGLFGIQATT SDF+  A+DIAV+EL A+A+PGEVDQ QL+RAKQ+TK
Sbjct  365  QSFSAFNSIYNHTGLFGIQATTGSDFAPHAIDIAVRELVAVATPGEVDQVQLNRAKQSTK  424

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIG+QILTYGERKPVEHFLKA++EV+A+DIA IAQKL+SSPLTMA
Sbjct  425  SAILMNLESRMVASEDIGKQILTYGERKPVEHFLKAVDEVTAQDIAKIAQKLLSSPLTMA  484

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL+LPSYD V
Sbjct  485  SYGDVLHLPSYDAV  498



>ref|XP_011093662.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Sesamum indicum]
Length=505

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFELPGGW KEKDA+TLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNE+PQ+
Sbjct  305  MTHFALAFELPGGWVKEKDAITLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNEHPQI  364

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             AFSAFSSI+N TGLFGIQATT SDF+  A+D+AVKEL A+A+PGEVDQ QL+RAKQ+TK
Sbjct  365  QAFSAFSSIYNHTGLFGIQATTGSDFAIHAIDVAVKELIAVATPGEVDQVQLNRAKQSTK  424

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIG+QILTYGERKPVEHFLKA++EV+A+D+A IAQKL+SSPLTMA
Sbjct  425  SAILMNLESRMVASEDIGKQILTYGERKPVEHFLKAVDEVTAQDLAKIAQKLLSSPLTMA  484

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL+LPSYD V
Sbjct  485  SYGDVLHLPSYDAV  498



>ref|XP_002283310.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Vitis 
vinifera]
 emb|CBI27974.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGWHKEK+AMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN YPQ+ 
Sbjct  307  THFALAFEVPGGWHKEKEAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNTYPQIQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N+TGLFGIQATT SDF SKA+DIA KEL A+A+PG+VDQ QLDRAKQ TK+
Sbjct  367  SFSAFNSIYNNTGLFGIQATTGSDFVSKAIDIAAKELVAVATPGQVDQVQLDRAKQTTKT  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMVASEDIGRQILTYGERKPV+HFLKA++EV+ KDIASI QKL+SSPLTMAS
Sbjct  427  AVLMNLESRMVASEDIGRQILTYGERKPVDHFLKAVDEVTLKDIASITQKLLSSPLTMAS  486

Query  422  YGDVLYLPSYDTV  384
            YGDV+++PSY+ V
Sbjct  487  YGDVIFVPSYENV  499



>ref|XP_010688376.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=507

 Score =   313 bits (802),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFELPGGWHK+KDAM +TVLQMLMGGGGSFSAGGPGKGMYSRLYL VLNEYPQ+
Sbjct  307  MTHFALAFELPGGWHKDKDAMVMTVLQMLMGGGGSFSAGGPGKGMYSRLYLNVLNEYPQI  366

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H+FSAF+SI+N+TGLFGIQATT SDF +KA++IA +EL A+A+PGEV Q QLDRAK ATK
Sbjct  367  HSFSAFNSIYNTTGLFGIQATTGSDFVTKAIEIAARELIAVATPGEVTQLQLDRAKAATK  426

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQILTYGERKPVEHFLK+I+E+S KDI+S+AQKL+SSPLTMA
Sbjct  427  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKSIDEISTKDISSMAQKLLSSPLTMA  486

Query  425  SYGDVLYLPSYDTV  384
            S+GDVLY+P+YD+V
Sbjct  487  SHGDVLYVPNYDSV  500



>ref|NP_001274924.1| mitochondrial-processing peptidase subunit alpha-like [Solanum 
tuberosum]
 emb|CAA56520.1| mitochondrial processing peptidase [Solanum tuberosum]
Length=504

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFE+PGGW KEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN YPQ+
Sbjct  304  MTHFALAFEVPGGWLKEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNAYPQI  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            HAFSAFSSI+N+TGLFGIQA T+SDF+ +A+++AVKELTA+A+PGEVD  QLDRAKQ+TK
Sbjct  364  HAFSAFSSIYNNTGLFGIQAATTSDFAPRAIEVAVKELTAVANPGEVDMVQLDRAKQSTK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+L YGERKPVEH LKAI+ +SA DIAS+AQKLISSPLTMA
Sbjct  424  SAILMNLESRMVASEDIGRQLLIYGERKPVEHVLKAIDAISANDIASVAQKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LP+YD V
Sbjct  484  SYGDVLSLPTYDVV  497



>ref|XP_010049597.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Eucalyptus grandis]
 gb|KCW82288.1| hypothetical protein EUGRSUZ_C03704 [Eucalyptus grandis]
Length=506

 Score =   312 bits (800),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+ FELPGGWHKEK+AM LTVLQML+GGGGSFSAGGPGKGMYSRLYLRVLNEYPQV 
Sbjct  307  THFAVGFELPGGWHKEKEAMNLTVLQMLLGGGGSFSAGGPGKGMYSRLYLRVLNEYPQVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFS+I+N+TG+FGIQATT SDF+++A+DIA KEL A+A+PGEVDQ QLDRAKQ+T++
Sbjct  367  SFSAFSNIYNNTGIFGIQATTGSDFAAQAIDIAAKELIAVATPGEVDQVQLDRAKQSTRA  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMVASEDI RQILTYGERKPVEHFLKA++EV+ KDIAS+AQKL+ SPLTMAS
Sbjct  427  AILMNLESRMVASEDIARQILTYGERKPVEHFLKAVDEVTPKDIASMAQKLLKSPLTMAS  486

Query  422  YGDVLYLPSYDTV  384
            YGDV+YLP+YD++
Sbjct  487  YGDVIYLPTYDSI  499



>ref|XP_009602845.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Nicotiana tomentosiformis]
Length=552

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFE+ GGW KEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN YPQ+
Sbjct  352  MTHFALAFEVSGGWLKEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNAYPQI  411

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            HAFSAFSSI+N+TGLFGIQA T+SDF+ +A+++A+KELTA+A+P EVDQ QLDRAKQ+TK
Sbjct  412  HAFSAFSSIYNNTGLFGIQAATTSDFAPRAIEVAIKELTAVANPKEVDQVQLDRAKQSTK  471

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+LTYGERKPVEHFLKAI+ ++A DIAS+A+KLISSPLTMA
Sbjct  472  SAILMNLESRMVASEDIGRQLLTYGERKPVEHFLKAIDAITANDIASVAEKLISSPLTMA  531

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LP+YD V
Sbjct  532  SYGDVLSLPTYDAV  545



>ref|XP_009783210.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Nicotiana sylvestris]
Length=504

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFE+ GGW KEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLN YPQ+
Sbjct  304  MTHFALAFEVSGGWLKEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNAYPQI  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            HAFSAFSSI+N+TGLFGIQA T+SDF+ +A+++A+KELTA+A+P EVDQ QLDRAKQ+TK
Sbjct  364  HAFSAFSSIYNNTGLFGIQAATTSDFAPRAIEVAIKELTAVANPKEVDQVQLDRAKQSTK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMVASEDIGRQ+LTYGER PVEHFLKAI+ ++A D+AS+A+KLISSPLTMA
Sbjct  424  SAILMNLESRMVASEDIGRQLLTYGERNPVEHFLKAIDTITANDVASMAEKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL LP+YD V
Sbjct  484  SYGDVLSLPTYDAV  497



>gb|EPS62572.1| mitochondrial processing peptidase, partial [Genlisea aurea]
Length=487

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFELPGGW KEKDA+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLYLRVLNEYPQ+
Sbjct  290  LTHFALAFELPGGWIKEKDALVLTVLQILMGGGGSFSAGGPGKGMYSRLYLRVLNEYPQI  349

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SI+N TGLFGIQATT SDF++ A+DIAVKEL A+A+PG+VDQ QLDRAKQ+TK
Sbjct  350  QSFSAFNSIYNHTGLFGIQATTGSDFATNAIDIAVKELIAVATPGQVDQVQLDRAKQSTK  409

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESR++ASEDIG+QILTYGERK VEHFL+A++EV+A+DI+ IAQKL+SSPLTMA
Sbjct  410  SAILMNLESRVIASEDIGKQILTYGERKTVEHFLRAVDEVTAQDISGIAQKLLSSPLTMA  469

Query  425  SYGDVLYLPSYDTV  384
            SYGDV++LPSYDTV
Sbjct  470  SYGDVVHLPSYDTV  483



>ref|XP_006451349.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
 gb|ESR64589.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
Length=512

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THF LAFELPGGWHK+KDAMTLTVLQML+GGGGSFSAGGPGKGMYSRLY RVLNE+PQV
Sbjct  310  LTHFVLAFELPGGWHKDKDAMTLTVLQMLLGGGGSFSAGGPGKGMYSRLYRRVLNEFPQV  369

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAFS+I+N +G+FGIQ TT SDF SKA+D+A +EL ++A+PGEVDQ QLDRAKQ+TK
Sbjct  370  QSFSAFSNIYNHSGMFGIQGTTGSDFVSKAIDLAARELISVATPGEVDQVQLDRAKQSTK  429

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMV SEDIGRQ+LTYGERKPVEHFLK +E V+AKDIAS+AQKL+SSPLTMA
Sbjct  430  SAILMNLESRMVVSEDIGRQVLTYGERKPVEHFLKTVEGVTAKDIASVAQKLLSSPLTMA  489

Query  425  SYGDVLYLPSYDTV  384
            SYGDV+ +PSYD V
Sbjct  490  SYGDVINVPSYDAV  503



>ref|XP_006475356.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Citrus sinensis]
Length=510

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THF LAFELPGGWHK+KDAMTLTVLQML+GGGGSFSAGGPGKGMYSRLY RVLNE+PQV
Sbjct  310  LTHFVLAFELPGGWHKDKDAMTLTVLQMLLGGGGSFSAGGPGKGMYSRLYRRVLNEFPQV  369

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAFS+I+N +G+FGIQ TT SDF SKA+D+A +EL ++A+PGEVDQ QLDRAKQ+TK
Sbjct  370  QSFSAFSNIYNHSGMFGIQGTTGSDFVSKAIDLAARELISVATPGEVDQVQLDRAKQSTK  429

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMV SEDIGRQ+LTYGERKPVEHFLK +E V+AKDIAS+AQKL+SSPLTMA
Sbjct  430  SAILMNLESRMVVSEDIGRQVLTYGERKPVEHFLKTVEGVTAKDIASVAQKLLSSPLTMA  489

Query  425  SYGDVLYLPSYDTV  384
            SYGDV+ +PSYD V
Sbjct  490  SYGDVINVPSYDAV  503



>ref|XP_003530483.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Glycine max]
Length=509

 Score =   305 bits (781),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHK KDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYL VLNEYPQVH
Sbjct  311  THFALAFELPGGWHKLKDAMVLTVLQMLLGGGGSFSAGGPGKGMYSRLYLNVLNEYPQVH  370

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF++I+N TG+FGIQ TT SDF SKA+DIA  E+  +A+PG+VDQ QL+RAKQATKS
Sbjct  371  SISAFNNIYNGTGIFGIQVTTGSDFVSKAIDIAANEILGVATPGQVDQAQLNRAKQATKS  430

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIGRQILTYGERKPVE FLKA++EV++KDI SI+QKLISSPLTMAS
Sbjct  431  AILMNLESRMVVSEDIGRQILTYGERKPVEDFLKAVDEVTSKDITSISQKLISSPLTMAS  490

Query  422  YGDVLYLPSYDTV  384
            YGDVLY+PSY++V
Sbjct  491  YGDVLYVPSYESV  503



>gb|KHN16661.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=509

 Score =   305 bits (780),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHK KDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYL VLNEYPQVH
Sbjct  311  THFALAFELPGGWHKLKDAMILTVLQMLLGGGGSFSAGGPGKGMYSRLYLNVLNEYPQVH  370

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF++I+N TG+FGIQ TT SDF SKA+DIA  E+  +A+PG+VDQ QL+RAKQATKS
Sbjct  371  SISAFNNIYNGTGIFGIQVTTGSDFVSKAIDIAANEILGVATPGQVDQAQLNRAKQATKS  430

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIGRQILTYGERKPVE FLKA++EV++KDI SI+QKLISSPLTMAS
Sbjct  431  AILMNLESRMVVSEDIGRQILTYGERKPVEDFLKAVDEVTSKDITSISQKLISSPLTMAS  490

Query  422  YGDVLYLPSYDTV  384
            YGDVLY+PSY++V
Sbjct  491  YGDVLYVPSYESV  503



>emb|CDP03229.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW KEK+AMTLTVLQ+LMGGGGSFSAGGPGKGMYSRLYLRVLNEYPQ+ 
Sbjct  306  THFALAFELPGGWLKEKEAMTLTVLQLLMGGGGSFSAGGPGKGMYSRLYLRVLNEYPQMQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
             FSAFSSI+NSTGLFGIQATTSSDF +KAVD+AVKEL A+ASPGEVDQ QL+RAKQATKS
Sbjct  366  MFSAFSSIYNSTGLFGIQATTSSDFVTKAVDVAVKELIAVASPGEVDQVQLNRAKQATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIG+QI TYGERKPVE FLK I+E+  +DI S+AQKLI+SPLT+AS
Sbjct  426  AILMNLESRMVTSEDIGKQISTYGERKPVEQFLKTIDEIKVQDIVSVAQKLITSPLTLAS  485

Query  422  YGDVLYLPSYDTV  384
            +GDV+Y PSYD +
Sbjct  486  HGDVVYFPSYDAI  498



>gb|KJB83097.1| hypothetical protein B456_013G229300 [Gossypium raimondii]
Length=505

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHKEK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLY+RVLNEYPQV+
Sbjct  308  THFALAFELPGGWHKEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRLYVRVLNEYPQVY  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N TG+FGIQATT SDF+  A+D+AVKEL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  368  SFSAFNSIYNHTGIFGIQATTGSDFAPTAIDVAVKELIAVATPGQVDQIQLDRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMVASEDIG+Q+LTYGERKPVE+FLK ++E++ KDI+SIAQKL+SSPLTMAS
Sbjct  428  AILMNLESRMVASEDIGKQVLTYGERKPVEYFLKVVDEITLKDISSIAQKLLSSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            YG+V+ +PSYD+V
Sbjct  488  YGNVINVPSYDSV  500



>gb|KHG30214.1| Mitochondrial-processing peptidase subunit alpha [Gossypium arboreum]
Length=505

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHKEK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLY+RVLNEYPQV+
Sbjct  308  THFALAFELPGGWHKEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRLYVRVLNEYPQVY  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N TG+FGIQATT SDF+  A+D+AVKEL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  368  SFSAFNSIYNHTGIFGIQATTGSDFAPTAIDVAVKELIAVATPGQVDQIQLDRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMVASEDIG+Q+LTYGERKPVE+FLK ++E++ KDI+SIAQKL+SSPLTMAS
Sbjct  428  AILMNLESRMVASEDIGKQVLTYGERKPVEYFLKVVDEITLKDISSIAQKLLSSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            YG+V+ +PSYD+V
Sbjct  488  YGNVINVPSYDSV  500



>ref|XP_003630686.1| Mitochondrial-processing peptidase subunit alpha [Medicago truncatula]
 gb|AET05162.1| processing peptidase [Medicago truncatula]
Length=510

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWH  KDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYLRVLNEYPQVH
Sbjct  311  THFALAFELPGGWHNLKDAMVLTVLQMLLGGGGSFSAGGPGKGMYSRLYLRVLNEYPQVH  370

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF++I+N+TG+FGIQ TT SDF SKA+DIA  E+  +A+ G+VDQ QLDRAKQATKS
Sbjct  371  SISAFNNIYNNTGIFGIQVTTGSDFVSKAIDIAANEILTVATSGQVDQVQLDRAKQATKS  430

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIGRQ+LTYGERKPVE FLKA++EV+ KDIASI+QKLISSPLTMAS
Sbjct  431  AILMNLESRMVVSEDIGRQVLTYGERKPVEDFLKAVDEVTLKDIASISQKLISSPLTMAS  490

Query  422  YGDVLYLPSYDTV  384
            YGDVLY+PSY++V
Sbjct  491  YGDVLYVPSYESV  503



>ref|XP_003525296.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform 1 [Glycine max]
 gb|KHM99824.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=511

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHK KDAM LTVLQML+GGGGSFSAGGPGKGMYSRLY  VLNEYPQVH
Sbjct  313  THFALAFELPGGWHKLKDAMVLTVLQMLLGGGGSFSAGGPGKGMYSRLYQNVLNEYPQVH  372

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
              SAF++I+N TG+FGIQ TT SDF SKA+DIA  E+ A+A+PG+VDQ QLDRAKQATKS
Sbjct  373  EISAFNNIYNDTGIFGIQVTTGSDFVSKAIDIAANEILAVATPGQVDQVQLDRAKQATKS  432

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIGRQILTYGERKPVE FLKA++EV++KDI SI++KLI SPLTMAS
Sbjct  433  AILMNLESRMVVSEDIGRQILTYGERKPVEDFLKAVDEVTSKDITSISRKLICSPLTMAS  492

Query  422  YGDVLYLPSYDTV  384
            YGDVLY+PSY++V
Sbjct  493  YGDVLYVPSYESV  505



>ref|XP_004503508.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cicer arietinum]
Length=510

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWH  KDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYLRVLNEYPQVH
Sbjct  311  THFALAFELPGGWHNLKDAMALTVLQMLLGGGGSFSAGGPGKGMYSRLYLRVLNEYPQVH  370

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF++I+N+TG+FGIQ TT SDF SKA+DIA  E+ A+A+ G+VDQ QLDRAKQATKS
Sbjct  371  SISAFNNIYNNTGIFGIQVTTGSDFVSKAIDIAANEILAVATSGQVDQVQLDRAKQATKS  430

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIGRQ+LTYG+RKPV+ FLKA++E++ KDIASI+QKLISSPLTMAS
Sbjct  431  AILMNLESRMVVSEDIGRQVLTYGDRKPVDDFLKAVDEITLKDIASISQKLISSPLTMAS  490

Query  422  YGDVLYLPSYDTV  384
            YGDVLY+PSY++V
Sbjct  491  YGDVLYVPSYESV  503



>gb|EYU27247.1| hypothetical protein MIMGU_mgv1a004049mg [Erythranthe guttata]
Length=547

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
             THFALAFELPGGW+KEKDA+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLYLRVLNE PQ+
Sbjct  347  TTHFALAFELPGGWNKEKDAVALTVLQILMGGGGSFSAGGPGKGMYSRLYLRVLNENPQI  406

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SI+N +GLFGIQATT SDF+ KA+DIAVKEL A+ASPG+VDQ QLDRAK++T+
Sbjct  407  QSFSAFNSIYNHSGLFGIQATTGSDFAIKAIDIAVKELIAVASPGQVDQVQLDRAKKSTR  466

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMV ++D G+QILTYGERKPVEHFLKA++E++A+DIA  AQK+ISSPLTMA
Sbjct  467  SAILMNLESRMVVADDTGKQILTYGERKPVEHFLKAVDEITAQDIAKTAQKIISSPLTMA  526

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL+LPSYD +
Sbjct  527  SYGDVLHLPSYDAI  540



>gb|ACJ86233.1| unknown [Medicago truncatula]
 gb|AFK45711.1| unknown [Medicago truncatula]
Length=510

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAF LPGGWH  KDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYLRVLNEYPQVH
Sbjct  311  THFALAFGLPGGWHNLKDAMVLTVLQMLLGGGGSFSAGGPGKGMYSRLYLRVLNEYPQVH  370

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF++I+N+TG+FGIQ  T SDF SKA+DIA  E+  +A+ G+VDQ QLDRAKQATKS
Sbjct  371  SISAFNNIYNNTGIFGIQVATGSDFVSKAIDIAANEILTVATSGQVDQVQLDRAKQATKS  430

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIGRQ+LTYGERKPVE FLKA++EV+ KDIASI+QKLISSPLTMAS
Sbjct  431  AILMNLESRMVVSEDIGRQVLTYGERKPVEDFLKAVDEVTLKDIASISQKLISSPLTMAS  490

Query  422  YGDVLYLPSYDTV  384
            YGDVLY+PSY++V
Sbjct  491  YGDVLYVPSYESV  503



>ref|XP_007012969.1| Insulinase protein isoform 1 [Theobroma cacao]
 gb|EOY30588.1| Insulinase protein isoform 1 [Theobroma cacao]
Length=583

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHKEK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLY+RVLNEYPQV 
Sbjct  386  THFALAFELPGGWHKEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRLYVRVLNEYPQVQ  445

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF++I+N TG+FGIQATT SDF   A+D+AVKEL A+A+PG+V Q+QLDRAKQ+TKS
Sbjct  446  SFSAFNNIYNHTGIFGIQATTGSDFVPTAIDVAVKELIAVATPGQVGQKQLDRAKQSTKS  505

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMVASEDIG+Q+LTYGERKP+E+FLKA++E++ KDI+S+AQKL+SSPLTMAS
Sbjct  506  AILMNLESRMVASEDIGKQVLTYGERKPLEYFLKAVDEITLKDISSVAQKLLSSPLTMAS  565

Query  422  YGDVLYLPSYDTV  384
            YG+V+ +PSYD+V
Sbjct  566  YGNVINVPSYDSV  578



>ref|XP_010244405.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Nelumbo nucifera]
Length=506

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKEK+AMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNEY Q+ 
Sbjct  307  THIALAFEVPGGWHKEKEAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNEYQQIQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N+TG+FGI ATT S+F S+AVD+A +EL ++A+PG+VDQ QLDRAK++TKS
Sbjct  367  SFSAFNSIYNNTGIFGIHATTGSEFVSEAVDLAARELLSVATPGQVDQVQLDRAKESTKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMVASEDIGRQILTYGERKPVEHFLKA++EV+ KDI++IAQKL+SSPLTMAS
Sbjct  427  AVLMNLESRMVASEDIGRQILTYGERKPVEHFLKAVDEVTLKDISTIAQKLVSSPLTMAS  486

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSY+ V
Sbjct  487  WGDVINVPSYEAV  499



>ref|XP_010914811.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Elaeis guineensis]
Length=507

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH+EK+AMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNE+ Q+ 
Sbjct  308  THVALAFEVPGGWHQEKEAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNEFQQIQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N+TG+FGI ATT SDF SKAVD+A +EL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  368  SFSAFNSVYNNTGIFGIHATTGSDFVSKAVDLAARELLAVATPGQVDQAQLDRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESR+VASEDIGRQILTYGERKP+EHFLKA++EV  +DI SI+QK+ISSPLTMAS
Sbjct  428  AILMNLESRIVASEDIGRQILTYGERKPIEHFLKAVDEVKLQDITSISQKIISSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSY++V
Sbjct  488  WGDVINVPSYESV  500



>ref|XP_010924455.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Elaeis guineensis]
Length=507

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH+EK+A+TLTVLQMLMGGGGSFS GGPGKGMYSRLYLRVLNE+ Q+ 
Sbjct  308  THIALAFEVPGGWHQEKEAITLTVLQMLMGGGGSFSTGGPGKGMYSRLYLRVLNEFQQIQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N+TG+FGI ATT SDF SKAVD+A +EL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  368  SFSAFNSVYNNTGIFGIHATTGSDFVSKAVDLAARELLAVATPGQVDQTQLDRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMVASEDIGRQILTYGERKP++HFLKA++EV+ +DI SI+QK+ISSPLTMAS
Sbjct  428  AVLMNLESRMVASEDIGRQILTYGERKPIDHFLKAVDEVTLEDITSISQKIISSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSY++V
Sbjct  488  WGDVINVPSYESV  500



>ref|XP_009415735.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=500

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EKDAMTLTV+QMLMGGG SFSAGGPGKGMYSRLYLRVLNE+ Q+ 
Sbjct  301  THVALAFEVPGGWRQEKDAMTLTVIQMLMGGGDSFSAGGPGKGMYSRLYLRVLNEHQQIQ  360

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N+TG+FGI ATTSSDF SKA+D+A++EL AIA+PG+VDQ QLDRAK++TKS
Sbjct  361  SFSAFNSIYNNTGIFGIHATTSSDFVSKAIDLAIRELHAIATPGQVDQLQLDRAKESTKS  420

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMVASEDIGRQILTYGERKP+EHFLKAI++V+ KDI +I +K+ISSPLTMAS
Sbjct  421  AVLMNLESRMVASEDIGRQILTYGERKPIEHFLKAIDKVTLKDITTITEKIISSPLTMAS  480

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  481  WGDVIHVPSYESV  493



>ref|XP_008799765.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Phoenix dactylifera]
Length=507

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH+EK+AMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNE+ Q+ 
Sbjct  308  THVALAFEVPGGWHQEKEAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNEFQQIQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N+TG+FGI ATT SDF SKAVD+A +EL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  368  SFSAFNSVYNNTGIFGIHATTGSDFVSKAVDLAARELLAVATPGQVDQVQLDRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMVASEDIGRQILTYGERKP+E FLKA++EV+ +DI SI+QK+ISSPLTMAS
Sbjct  428  AILMNLESRMVASEDIGRQILTYGERKPIELFLKAVDEVTLQDITSISQKIISSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSY++V
Sbjct  488  WGDVINVPSYESV  500



>ref|XP_011078227.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Sesamum indicum]
Length=502

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFELPGGW KEKDA+ LTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNE+PQ+
Sbjct  302  ITHFALAFELPGGWLKEKDAIILTVLQMLMGGGGSFSAGGPGKGMYSRLYLRVLNEHPQI  361

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SI+N TGLFGIQATT SDF+  A+DIAVKEL A+A+PG+VD+ QLDRAK++TK
Sbjct  362  QSFSAFNSIYNHTGLFGIQATTESDFAINAIDIAVKELIAVATPGQVDKVQLDRAKESTK  421

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESRMV SEDIG+QILTYGER P+ HFLK ++E++ +DIA  AQKL+SSPLTMA
Sbjct  422  SAILMNLESRMVVSEDIGKQILTYGERTPLGHFLKVVDEITRQDIAKTAQKLLSSPLTMA  481

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL+LPSY+++
Sbjct  482  SYGDVLHLPSYESI  495



>gb|EYU30680.1| hypothetical protein MIMGU_mgv1a004957mg [Erythranthe guttata]
 gb|EYU30681.1| hypothetical protein MIMGU_mgv1a004957mg [Erythranthe guttata]
 gb|EYU30682.1| hypothetical protein MIMGU_mgv1a004957mg [Erythranthe guttata]
Length=503

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW KEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYL VLNE PQ+ 
Sbjct  306  THFALAFELPGGWVKEKDAMTLTVLQMLMGGGGSFSAGGPGKGMYSRLYLNVLNENPQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFSS+ N TGLFGIQATT+SDF+  A+DIAV+EL A+A+PG+VD+ QLDRAKQ+TK+
Sbjct  366  SFSAFSSVSNHTGLFGIQATTASDFAINAIDIAVRELMAVATPGQVDKVQLDRAKQSTKT  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A LMNLESRMV SEDIG+QILT GERKPV+H+LK +EE++A+DIA   QKL+SSPLTMAS
Sbjct  426  AFLMNLESRMVVSEDIGKQILTQGERKPVDHYLKIVEEITAQDIAKTVQKLLSSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDVL+LPSYD+V
Sbjct  486  YGDVLHLPSYDSV  498



>gb|KGN60560.1| hypothetical protein Csa_2G000680 [Cucumis sativus]
Length=498

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW KEKDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYL+VLNEYPQV 
Sbjct  299  THFALAFELPGGWRKEKDAMALTVLQMLLGGGGSFSAGGPGKGMYSRLYLQVLNEYPQVQ  358

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFSSI+N++GLFGI+ TT SDF  KA DIA  EL AIA+PG+V Q QLDRAKQ+TKS
Sbjct  359  SISAFSSIYNNSGLFGIKGTTGSDFVPKAFDIAASELLAIATPGKVQQVQLDRAKQSTKS  418

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+VASEDI RQ+LTYGERKPVEHFLKA++EV+   +ASIAQKL+SSPLTMAS
Sbjct  419  AVLMNLESRVVASEDIARQVLTYGERKPVEHFLKAVDEVTLDSVASIAQKLLSSPLTMAS  478

Query  422  YGDVLYLPSYDTV  384
            YGDV+++PSYD+V
Sbjct  479  YGDVIHVPSYDSV  491



>ref|XP_008459098.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cucumis melo]
Length=506

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW  EKDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYL+VLNEYPQV 
Sbjct  306  THFALAFELPGGWRNEKDAMALTVLQMLLGGGGSFSAGGPGKGMYSRLYLQVLNEYPQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFSSI+N++GLFGI+ TT SDF  KA DIA  EL AIA+PG+V Q QLDRAKQ+TKS
Sbjct  366  SISAFSSIYNNSGLFGIKGTTGSDFVPKAFDIAASELLAIATPGKVQQVQLDRAKQSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+VASEDI RQ+LTYGERKPVEHFLKA++EV+  D+ASIAQKL+SSPLTMAS
Sbjct  426  AVLMNLESRVVASEDIARQVLTYGERKPVEHFLKAVDEVTLDDVASIAQKLLSSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+++PSYD+V
Sbjct  486  YGDVIHVPSYDSV  498



>ref|XP_004141034.2| PREDICTED: mitochondrial-processing peptidase subunit alpha [Cucumis 
sativus]
Length=505

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW KEKDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYL+VLNEYPQV 
Sbjct  306  THFALAFELPGGWRKEKDAMALTVLQMLLGGGGSFSAGGPGKGMYSRLYLQVLNEYPQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFSSI+N++GLFGI+ TT SDF  KA DIA  EL AIA+PG+V Q QLDRAKQ+TKS
Sbjct  366  SISAFSSIYNNSGLFGIKGTTGSDFVPKAFDIAASELLAIATPGKVQQVQLDRAKQSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+VASEDI RQ+LTYGERKPVEHFLKA++EV+   +ASIAQKL+SSPLTMAS
Sbjct  426  AVLMNLESRVVASEDIARQVLTYGERKPVEHFLKAVDEVTLDSVASIAQKLLSSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+++PSYD+V
Sbjct  486  YGDVIHVPSYDSV  498



>ref|XP_002283426.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Vitis 
vinifera]
 emb|CBI36036.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGWH EK+A+TLTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+
Sbjct  306  ITHLALAFEVPGGWHNEKEAITLTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQL  365

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF++IFN+TG+FGI A+T SDF +KAVDIA  EL +IASPG+VDQ QL RAK+ATK
Sbjct  366  QSFSAFNNIFNNTGIFGIYASTGSDFVAKAVDIAAGELLSIASPGQVDQVQLTRAKEATK  425

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESRM+ASEDIGRQILTYGERKP+EHFLKA++E++ KDI +IAQ++ISSPLTMA
Sbjct  426  SAVLMNLESRMIASEDIGRQILTYGERKPLEHFLKAVDEITLKDITTIAQRIISSPLTMA  485

Query  425  SYGDVLYLPSYDTV  384
            SYGDV+++PSY++V
Sbjct  486  SYGDVIHVPSYESV  499



>ref|XP_007160267.1| hypothetical protein PHAVU_002G306900g [Phaseolus vulgaris]
 gb|ESW32261.1| hypothetical protein PHAVU_002G306900g [Phaseolus vulgaris]
Length=508

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHK KDAM LTVLQML+GGGGSFSAGGPGKGMYSRLYL VLN+YPQ H
Sbjct  309  THFALAFELPGGWHKLKDAMVLTVLQMLLGGGGSFSAGGPGKGMYSRLYLNVLNQYPQFH  368

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF++I+N TG+FGIQ TT+SD  SKA+DI   E+ A+A+ G+V+Q QLDRAKQATKS
Sbjct  369  SISAFNNIYNDTGIFGIQVTTNSDIVSKAIDITANEILAVATHGKVEQVQLDRAKQATKS  428

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMV SEDIGRQ+LTYGERKP+E FLKA++EV+ KDI+SI+QKLISSPLTMAS
Sbjct  429  AILMNLESRMVVSEDIGRQVLTYGERKPLEDFLKAVDEVTLKDISSISQKLISSPLTMAS  488

Query  422  YGDVLYLPSYDTV  384
            YGDVLY+PSY++V
Sbjct  489  YGDVLYVPSYESV  501



>gb|KHF99831.1| Mitochondrial-processing peptidase subunit alpha [Gossypium arboreum]
Length=507

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWH EK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLYLRVLN+YPQV 
Sbjct  308  THFALAFELPGGWHNEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRLYLRVLNQYPQVQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N TGLFGIQATT SDF   A+D+AVKEL A+A+PG+V+Q++L+RAKQ+TKS
Sbjct  368  SFSAFNSIYNHTGLFGIQATTGSDFVPSAIDVAVKELIAVATPGQVEQKELERAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESR VASEDIG+QILTYGERKPVEHFLK + E++ KDI+S+A+KL+SS LTMAS
Sbjct  428  AILMNLESRAVASEDIGKQILTYGERKPVEHFLKVVNEITPKDISSVAEKLLSSNLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            YG+V+ +P YD++
Sbjct  488  YGNVINVPRYDSI  500



>gb|KJB27183.1| hypothetical protein B456_004G282800 [Gossypium raimondii]
Length=507

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWH EK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLYLRVLN+YPQV 
Sbjct  308  THFALAFELPGGWHNEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRLYLRVLNQYPQVQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N TGLFGIQATT SDF   A+D+AVKEL A+A+PG+V+Q++L+RAKQ+TKS
Sbjct  368  SFSAFNSIYNHTGLFGIQATTGSDFVPSAIDVAVKELIAVATPGQVEQKELERAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESR VASEDIG+QILTYGERKPVEHFLK +++++ KDI+S+A+KL+SS LTMAS
Sbjct  428  AILMNLESRAVASEDIGKQILTYGERKPVEHFLKVVDKITPKDISSVAEKLLSSNLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            YG+V+ +P YD++
Sbjct  488  YGNVINVPRYDSI  500



>ref|XP_010086910.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
 gb|EXB24701.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
Length=508

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGWHKEK+A+ LTV+QML+GGGGSFS GGPGKGM+SRLY RVLN +PQ  
Sbjct  309  THFALAFEVPGGWHKEKEAIKLTVIQMLLGGGGSFSTGGPGKGMHSRLYARVLNNHPQFQ  368

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFS+I+N+TG+FGIQ TTSSDF++KAVDI   EL AI+ PGEVDQ QLDRAK++TKS
Sbjct  369  SISAFSNIYNNTGIFGIQTTTSSDFAAKAVDIVANELIAISKPGEVDQVQLDRAKKSTKS  428

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESR++ASEDIGRQ+LTYG+R  V+HFLKA++EV+ KDIAS AQKL+SSPLT+AS
Sbjct  429  AILMNLESRVIASEDIGRQVLTYGKRMEVDHFLKAVDEVTVKDIASTAQKLLSSPLTLAS  488

Query  422  YGDVLYLPSYDTV  384
            YGDVLY PSYDTV
Sbjct  489  YGDVLYFPSYDTV  501



>dbj|BAB62405.1| mitochondrial processing peptidase alpha subunit [Morus alba]
Length=506

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGWHKEK+A+ LTV+QML+GGGGSFS GGPGKGM+SRLY RVLN +PQ  
Sbjct  307  THFALAFEVPGGWHKEKEAIKLTVIQMLLGGGGSFSTGGPGKGMHSRLYARVLNNHPQFQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFS+I+N+TG+FGIQATTSSDF++KAVD+   EL AI+ PGEVDQ QLDRAK++TKS
Sbjct  367  SISAFSNIYNNTGIFGIQATTSSDFAAKAVDVVANELIAISKPGEVDQVQLDRAKKSTKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESR++ASEDIGRQ+LTYG+R  V+HFL A++EV+ KDIAS AQKL+SSP+T+AS
Sbjct  427  AILMNLESRVIASEDIGRQVLTYGKRMEVDHFLNAVDEVTVKDIASTAQKLLSSPVTLAS  486

Query  422  YGDVLYLPSYDTV  384
            YGDVLY PSYDTV
Sbjct  487  YGDVLYFPSYDTV  499



>ref|XP_006853743.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Amborella 
trichopoda]
 gb|ERN15210.1| hypothetical protein AMTR_s00056p00180950 [Amborella trichopoda]
Length=500

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW KEK+A+TLTVLQ+LMGGGGSFSAGGPGKGMYSRLYLR+LNE+ Q+ 
Sbjct  301  THVALAFEVPGGWLKEKEAITLTVLQILMGGGGSFSAGGPGKGMYSRLYLRILNEFQQIQ  360

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N+TG+FGI ATT  +F SKAVD+A +EL +IA+PGEVD  QLDRAK +TKS
Sbjct  361  SFSAFNSIYNNTGIFGIHATTGPEFVSKAVDLAARELISIATPGEVDNVQLDRAKASTKS  420

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMVA+EDIGRQILTYGERKPVEH+LKA++EV+ KDI+SIA+KLIS+PLTMAS
Sbjct  421  AVLMNLESRMVAAEDIGRQILTYGERKPVEHYLKAVDEVTLKDISSIAEKLISTPLTMAS  480

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSY++V
Sbjct  481  WGDVLNVPSYESV  493



>ref|XP_004149179.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Cucumis 
sativus]
Length=505

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+ 
Sbjct  306  THVALAFEVPGGWHKEKDAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+T S+F +KAVDIA  EL +IA+PG+V Q QL+RAK++TKS
Sbjct  366  SFSAFNSIFNNTGLFGIYASTGSNFVAKAVDIAASELISIATPGQVSQVQLNRAKESTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ SEDIGRQILTYGERKPVEHFLKA++ ++  DI +IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRMIVSEDIGRQILTYGERKPVEHFLKAVDSITLNDITNIAQKVISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +P+Y++V
Sbjct  486  YGDVINVPTYESV  498



>ref|XP_004510321.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cicer arietinum]
Length=506

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -2

Query  959  HFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHA  780
            H A+AFE+PGGW KE+DA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+ +
Sbjct  308  HVAIAFEVPGGWQKERDAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIQS  367

Query  779  FSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSA  600
            FSAF+SIFN+TGLFGI A+TS DF  KAVDIA KEL AIASPG+V Q QLDRAK++TKSA
Sbjct  368  FSAFNSIFNNTGLFGIYASTSPDFVQKAVDIAAKELIAIASPGQVSQVQLDRAKKSTKSA  427

Query  599  ILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASY  420
            +LMNLESRM+ASEDIGRQILTYGERKPVE FLKA++E++  DI  I+QK+ISSPLTMASY
Sbjct  428  VLMNLESRMIASEDIGRQILTYGERKPVEQFLKAVDEITLNDITKISQKIISSPLTMASY  487

Query  419  GDVLYLPSYDTV  384
            GDV+ +PSY++V
Sbjct  488  GDVINVPSYESV  499



>ref|XP_008447564.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Cucumis melo]
Length=505

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+ 
Sbjct  306  THVALAFEVPGGWHKEKDAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A T S+F +KAVDIA  EL +IA+PG+V Q QL+RAK++TKS
Sbjct  366  SFSAFNSIFNNTGLFGIYACTGSNFVAKAVDIAASELISIATPGQVSQVQLNRAKESTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ SEDIGRQILTYGERKPVEHFLKA++ ++  DI +IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRMIVSEDIGRQILTYGERKPVEHFLKAVDSITLNDITNIAQKVISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +P+Y++V
Sbjct  486  YGDVINVPTYESV  498



>ref|XP_007135618.1| hypothetical protein PHAVU_010G144000g [Phaseolus vulgaris]
 gb|ESW07612.1| hypothetical protein PHAVU_010G144000g [Phaseolus vulgaris]
Length=507

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKEKDA+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLNE+ Q+ 
Sbjct  308  THVALAFEVPGGWHKEKDAIVLTVLQVLMGGGGSFSAGGPGKGMHSRLYLRVLNEHQQIQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+TS DF+  AVDIA KEL AIASPGEV Q QLDRAK++TKS
Sbjct  368  SFSAFNSIFNNTGLFGIYASTSPDFAPNAVDIAAKELIAIASPGEVTQVQLDRAKKSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQILTYGERK +E FLKA++E++  DI  IAQK+ISSPLTMAS
Sbjct  428  AVLMNLESRMIASEDIGRQILTYGERKALEQFLKAVDEITLNDITKIAQKIISSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            YGDVL +PSY++V
Sbjct  488  YGDVLSVPSYESV  500



>ref|XP_003531643.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Glycine max]
 gb|KHN05323.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=505

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH A+AFE+PGGW KEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYL VLNEY Q+ 
Sbjct  306  THVAIAFEVPGGWQKEKDAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLYLNVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+TS DF  K VDIA KEL AIASPG+V Q QLDRAK++TKS
Sbjct  366  SFSAFNSIFNNTGLFGIYASTSPDFVPKTVDIAAKELIAIASPGQVTQVQLDRAKKSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQILTYGERKPVE FLKA++E++  DI  IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRMIASEDIGRQILTYGERKPVEQFLKAVDEITLNDITKIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +PSY++V
Sbjct  486  YGDVMNVPSYESV  498



>ref|XP_012069060.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Jatropha curcas]
Length=503

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGWH EK+A+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY ++
Sbjct  304  MTHVALAFEVPGGWHNEKEAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQEL  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SIFN+TGLFGI A+TSSDF  KAVDIAV EL AIA+PG+V + QLDRAK+ TK
Sbjct  364  QSFSAFNSIFNNTGLFGIYASTSSDFVPKAVDIAVGELLAIAAPGQVTKLQLDRAKETTK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESRM+ +EDIGRQ LTYGERKPVEHFLK ++ +S KDI +IAQKLISSPLTMA
Sbjct  424  SAVLMNLESRMIMAEDIGRQFLTYGERKPVEHFLKTVDGISLKDITNIAQKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDV+ +PSYD+V
Sbjct  484  SYGDVINVPSYDSV  497



>ref|XP_003530042.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Glycine max]
Length=505

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH A+AFE+PGGW KEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYL VLNEY Q+ 
Sbjct  306  THVAIAFEVPGGWQKEKDAIALTVLQMLMGGGGSFSAGGPGKGMHSRLYLNVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+TS DF  K VDIA KEL AIASPG+V Q QLDRAK++TKS
Sbjct  366  SFSAFNSIFNNTGLFGIYASTSPDFVPKTVDIAAKELIAIASPGQVTQVQLDRAKKSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQILTYGERKPVE FLKA++E++  DI  IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRMIASEDIGRQILTYGERKPVEQFLKAVDEITLNDITKIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +PSY++V
Sbjct  486  YGDVMNVPSYESV  498



>gb|KHN39262.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=505

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH A+AFE+PGGW KEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYL VLNEY Q+ 
Sbjct  306  THVAIAFEVPGGWQKEKDAIALTVLQMLMGGGGSFSAGGPGKGMHSRLYLNVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+TS DF  K VDIA KEL AIASPG+V Q QLDRAK++TKS
Sbjct  366  SFSAFNSIFNNTGLFGIYASTSPDFVPKTVDIAAKELIAIASPGQVTQVQLDRAKKSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQILTYGERKPVE FLK ++E++  DI  IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRMIASEDIGRQILTYGERKPVEQFLKVVDEITLNDITKIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +PSY++V
Sbjct  486  YGDVMNVPSYESV  498



>ref|XP_008795498.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Phoenix dactylifera]
Length=503

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH+E++A+TLTVLQMLMGGGGSFS GGPGKGMYSRLYLR+LNE+ Q+ 
Sbjct  304  THVALAFEVPGGWHQEQEAITLTVLQMLMGGGGSFSTGGPGKGMYSRLYLRILNEFQQIQ  363

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N+TG+FGI ATT SDF SKAVD+A +EL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  364  SFSAFNSVYNNTGIFGIHATTGSDFVSKAVDLAARELLALATPGQVDQTQLDRAKQSTKS  423

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMVASEDIGRQILTYGERKP+EHFLKA++EV+ +DI SI+QK+ISSPLTMAS
Sbjct  424  AVLMNLESRMVASEDIGRQILTYGERKPIEHFLKALDEVTLEDITSISQKIISSPLTMAS  483

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSY++V
Sbjct  484  WGDVINVPSYESV  496



>ref|XP_008795496.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Phoenix dactylifera]
Length=505

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH+E++A+TLTVLQMLMGGGGSFS GGPGKGMYSRLYLR+LNE+ Q+ 
Sbjct  306  THVALAFEVPGGWHQEQEAITLTVLQMLMGGGGSFSTGGPGKGMYSRLYLRILNEFQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N+TG+FGI ATT SDF SKAVD+A +EL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  366  SFSAFNSVYNNTGIFGIHATTGSDFVSKAVDLAARELLALATPGQVDQTQLDRAKQSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMVASEDIGRQILTYGERKP+EHFLKA++EV+ +DI SI+QK+ISSPLTMAS
Sbjct  426  AVLMNLESRMVASEDIGRQILTYGERKPIEHFLKALDEVTLEDITSISQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSY++V
Sbjct  486  WGDVINVPSYESV  498



>gb|KJB27182.1| hypothetical protein B456_004G282800 [Gossypium raimondii]
Length=508

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLY-LRVLNEYPQV  786
            THFALAFELPGGWH EK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRL  LRVLN+YPQV
Sbjct  308  THFALAFELPGGWHNEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRLSDLRVLNQYPQV  367

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SI+N TGLFGIQATT SDF   A+D+AVKEL A+A+PG+V+Q++L+RAKQ+TK
Sbjct  368  QSFSAFNSIYNHTGLFGIQATTGSDFVPSAIDVAVKELIAVATPGQVEQKELERAKQSTK  427

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SAILMNLESR VASEDIG+QILTYGERKPVEHFLK +++++ KDI+S+A+KL+SS LTMA
Sbjct  428  SAILMNLESRAVASEDIGKQILTYGERKPVEHFLKVVDKITPKDISSVAEKLLSSNLTMA  487

Query  425  SYGDVLYLPSYDTV  384
            SYG+V+ +P YD++
Sbjct  488  SYGNVINVPRYDSI  501



>ref|XP_010062551.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Eucalyptus 
grandis]
 gb|KCW69690.1| hypothetical protein EUGRSUZ_F03085 [Eucalyptus grandis]
Length=505

 Score =   279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFELPGGW KE+DA+ LTV+QMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+ 
Sbjct  306  THIALAFELPGGWIKERDAVILTVIQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN TGLFGI A+TSSDF +KAVD+A +EL A+A+PG+V Q QL+RAK++TKS
Sbjct  366  SFSAFNSIFNRTGLFGIYASTSSDFVAKAVDVAAEELIALATPGQVTQVQLNRAKESTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ SEDIGRQILTYGERKPVEHFLK +E+++  DI S+A++++SSPLTMAS
Sbjct  426  AVLMNLESRMIVSEDIGRQILTYGERKPVEHFLKDVEKITLDDITSVARRVLSSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+++PSY++V
Sbjct  486  YGDVIHVPSYESV  498



>gb|KDP40843.1| hypothetical protein JCGZ_24842 [Jatropha curcas]
Length=503

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGWH EK+A+ LTVLQMLMGGGGSFSAGGPGKGM+SRL LRVLNEY ++
Sbjct  304  MTHVALAFEVPGGWHNEKEAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLDLRVLNEYQEL  363

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SIFN+TGLFGI A+TSSDF  KAVDIAV EL AIA+PG+V + QLDRAK+ TK
Sbjct  364  QSFSAFNSIFNNTGLFGIYASTSSDFVPKAVDIAVGELLAIAAPGQVTKLQLDRAKETTK  423

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESRM+ +EDIGRQ LTYGERKPVEHFLK ++ +S KDI +IAQKLISSPLTMA
Sbjct  424  SAVLMNLESRMIMAEDIGRQFLTYGERKPVEHFLKTVDGISLKDITNIAQKLISSPLTMA  483

Query  425  SYGDVLYLPSYDTV  384
            SYGDV+ +PSYD+V
Sbjct  484  SYGDVINVPSYDSV  497



>ref|XP_009409367.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=507

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKEK+AM LTVLQMLMGGGGSFSAGGPGKGM+SRLYL VLN++ Q+ 
Sbjct  308  THIALAFEVPGGWHKEKEAMALTVLQMLMGGGGSFSAGGPGKGMHSRLYLHVLNQFQQIE  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N TG+FGI ATT  +F SKAVD+  +EL A+A+PG+VDQ QLDRAK++TKS
Sbjct  368  SFSAFNSIYNHTGIFGIHATTGPEFVSKAVDLVARELLAVATPGQVDQVQLDRAKESTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR V SEDIGRQILTYGERKPV+HFLKA++E++ KDI S+A+K+ISSPLTMAS
Sbjct  428  AVLMNLESRAVVSEDIGRQILTYGERKPVQHFLKAVDELTLKDITSLAEKIISSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  488  WGDVIHVPSYESV  500



>ref|XP_008798591.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X1 [Phoenix dactylifera]
Length=507

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKE + MTLTVLQMLMGGGGSFSAGGPGKGM+S LYLRVLNE+PQ+ 
Sbjct  308  THVALAFEVPGGWHKENETMTLTVLQMLMGGGGSFSAGGPGKGMHSCLYLRVLNEFPQIQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
             FS+FS+I+N TGLFGI ATT  DF SKAVD+AV+EL A+A+PG+VDQ QLDRAK +TKS
Sbjct  368  LFSSFSNIYNHTGLFGIYATTGPDFVSKAVDLAVRELLAVATPGQVDQVQLDRAKDSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ S+DIG+QILTYGERKP EHFLK+I+EV+ KDI+ +A+K++SSPLTMAS
Sbjct  428  AVLMNLESRVLTSKDIGQQILTYGERKPTEHFLKSIDEVTLKDISCLAEKILSSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSYD+V
Sbjct  488  WGDVVRVPSYDSV  500



>ref|XP_008798592.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X2 [Phoenix dactylifera]
Length=505

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKE + MTLTVLQMLMGGGGSFSAGGPGKGM+S LYLRVLNE+PQ+ 
Sbjct  306  THVALAFEVPGGWHKENETMTLTVLQMLMGGGGSFSAGGPGKGMHSCLYLRVLNEFPQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
             FS+FS+I+N TGLFGI ATT  DF SKAVD+AV+EL A+A+PG+VDQ QLDRAK +TKS
Sbjct  366  LFSSFSNIYNHTGLFGIYATTGPDFVSKAVDLAVRELLAVATPGQVDQVQLDRAKDSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ S+DIG+QILTYGERKP EHFLK+I+EV+ KDI+ +A+K++SSPLTMAS
Sbjct  426  AVLMNLESRVLTSKDIGQQILTYGERKPTEHFLKSIDEVTLKDISCLAEKILSSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSYD+V
Sbjct  486  WGDVVRVPSYDSV  498



>ref|XP_009344488.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Pyrus x bretschneideri]
Length=502

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLN+YPQ+ 
Sbjct  303  THIALAFEVPGGWREEKQAILLTVLQLLMGGGGSFSAGGPGKGMHSRLYLRVLNQYPQIQ  362

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN +GLFGI A+T S+F+SKAVDIA +EL  IA+PG+V   QL RAK++TK+
Sbjct  363  SFSAFNSIFNDSGLFGIYASTGSEFASKAVDIAAQELLTIATPGQVTDVQLKRAKESTKA  422

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQ+LTYGERKPVEHFLK +EEVS KDI +IAQK+ISSPLT+A+
Sbjct  423  AVLMNLESRMIASEDIGRQVLTYGERKPVEHFLKTVEEVSLKDIITIAQKIISSPLTLAT  482

Query  422  YGDVLYLPSYDTV  384
            YG+V+++P YD++
Sbjct  483  YGNVVHVPGYDSI  495



>ref|XP_008380841.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Malus 
domestica]
Length=502

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE PGGW +EK A+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLN+YP++ 
Sbjct  303  THVALAFEAPGGWREEKQAILLTVLQLLMGGGGSFSAGGPGKGMHSRLYLRVLNQYPEIQ  362

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN +GLFGI A+T S+F+SKAVDIA +EL  IA+PG+V   QL RAK++TK+
Sbjct  363  SFSAFNSIFNDSGLFGIYASTGSEFASKAVDIAAQELLTIATPGQVTDVQLKRAKESTKA  422

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQ+LTYGERKPVEHFLK +EEVS KDI +IAQK+ISSPLTMA+
Sbjct  423  AVLMNLESRMIASEDIGRQVLTYGERKPVEHFLKTVEEVSLKDITTIAQKIISSPLTMAT  482

Query  422  YGDVLYLPSYDTV  384
            YG+V+++P YD++
Sbjct  483  YGNVVHVPGYDSI  495



>ref|XP_010231138.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Brachypodium distachyon]
Length=498

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK AM +TVLQMLMGGGGSFS GGPGKGM+SRLYLRVLN+Y Q+ 
Sbjct  300  THIALAFEVPGGWRQEKTAMIVTVLQMLMGGGGSFSVGGPGKGMHSRLYLRVLNQYEQIE  359

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N++GLFGI A TS DF+SKAVD+A  EL  +A+PG+V Q+QLDRAK+ATK+
Sbjct  360  SFSAFNSIYNNSGLFGIHAATSPDFASKAVDLAAGELLEVATPGKVTQEQLDRAKEATKA  419

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ASEDIGRQ+LTYGERKP+E+F+KA+E+ +  DI+SIAQK+ISSPLT+AS
Sbjct  420  AVLMNLESRIIASEDIGRQVLTYGERKPIEYFVKAVEQTTLNDISSIAQKIISSPLTLAS  479

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY+TV
Sbjct  480  WGDVIHVPSYETV  492



>ref|XP_002515947.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
 gb|EEF46367.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
Length=492

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 161/194 (83%), Gaps = 12/194 (6%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGWH EK+A+ LTVLQ            G  +GM+SRLYLRVLNEY Q+
Sbjct  305  MTHVALAFEVPGGWHNEKEAIVLTVLQ------------GSWQGMHSRLYLRVLNEYHQL  352

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             AFSAF+SIFN+TGLFGI A+TSSDF  KAVD+AV EL AIA+PG+V + QLDRAK++TK
Sbjct  353  QAFSAFNSIFNNTGLFGIYASTSSDFVPKAVDVAVGELLAIAAPGQVSKAQLDRAKESTK  412

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESRM+ +EDIGRQ LTYGERKPVEHFLK +EE++  DIA IAQK+ISSPLTMA
Sbjct  413  SAVLMNLESRMIVTEDIGRQYLTYGERKPVEHFLKVVEEITPNDIAKIAQKIISSPLTMA  472

Query  425  SYGDVLYLPSYDTV  384
            SYGDV+ +PSY++V
Sbjct  473  SYGDVINVPSYESV  486



>ref|XP_003627059.1| Mitochondrial-processing peptidase subunit alpha [Medicago truncatula]
 gb|AET01535.1| processing peptidase [Medicago truncatula]
Length=507

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH A+AFE+PGGW KEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRL+LRVLNEY Q+ 
Sbjct  308  THVAIAFEVPGGWQKEKDAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLFLRVLNEYQQIQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+TSSDF+ KAV++A KEL AIA+P +V + QLDRAK++TK+
Sbjct  368  SFSAFNSIFNNTGLFGIYASTSSDFAPKAVELAAKELIAIATPEKVPEVQLDRAKKSTKT  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQILTYGERKPVE FLKA++E++  DI  I+Q++ISSPLTMAS
Sbjct  428  AVLMNLESRMIASEDIGRQILTYGERKPVEEFLKAVDEITLDDITKISQRIISSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +PSY+ V
Sbjct  488  YGDVINVPSYENV  500



>gb|ADE77223.1| unknown [Picea sitchensis]
Length=510

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH EKDA+ LTVLQ LMGGGGSFSAGGPGKGMYSRLYLRVLNEY QV 
Sbjct  311  THVALAFEVPGGWHSEKDAIALTVLQTLMGGGGSFSAGGPGKGMYSRLYLRVLNEYQQVQ  370

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N +G+FGI ATT SDF S+AV++A +EL A+A+PG+V + +L+RAK +TKS
Sbjct  371  SFSAFNSMYNDSGIFGIHATTGSDFVSQAVELATRELLAVATPGQVTEVELNRAKNSTKS  430

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMV +EDIGRQILTYG+RKPVEHFLK + EV+  DIASIAQK+IS+PLTMAS
Sbjct  431  AVLMNLESRMVVTEDIGRQILTYGQRKPVEHFLKVLNEVTLDDIASIAQKIISTPLTMAS  490

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSYD V
Sbjct  491  WGDVIQVPSYDGV  503



>ref|XP_003546593.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Glycine max]
 gb|KHN32658.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=491

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            V H A+AFE+PGGW KEK+A+ LTVLQMLMGGGGSFSAGGPGKGM+SRL+LRVLNE+ Q+
Sbjct  291  VAHVAIAFEVPGGWKKEKEAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLFLRVLNEHQQI  350

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H+FSAF+S+FN+TGLFGI A+T SDF +KAVD+A +EL AIASPG+V Q QLDRAK +TK
Sbjct  351  HSFSAFNSLFNNTGLFGIYASTGSDFVAKAVDLAARELIAIASPGQVSQVQLDRAKVSTK  410

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESRM+ASEDIGRQILTYGERKP+E F KA++ ++  DI  I+QK+ISSPLTMA
Sbjct  411  SAVLMNLESRMIASEDIGRQILTYGERKPLEQFFKAVDGITLNDITKISQKIISSPLTMA  470

Query  425  SYGDVLYLPSYDTV  384
            SYGDV  +PSY++V
Sbjct  471  SYGDVFNVPSYESV  484



>ref|XP_007150592.1| hypothetical protein PHAVU_005G1652000g, partial [Phaseolus vulgaris]
 gb|ESW22586.1| hypothetical protein PHAVU_005G1652000g, partial [Phaseolus vulgaris]
Length=482

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -2

Query  959  HFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHA  780
            H A+AFE+PGGW KEK+A+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYL VLNEY Q+  
Sbjct  284  HVAIAFEVPGGWKKEKEAIILTVLQMLMGGGGSFSAGGPGKGMHSRLYLHVLNEYQQIQC  343

Query  779  FSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSA  600
            FSAF+S+FN+TGLFGI ATTSSDF  KAVD+A KEL A+ASPG+V Q QLDRAK++TKSA
Sbjct  344  FSAFNSLFNNTGLFGIYATTSSDFVEKAVDLAAKELIALASPGQVSQVQLDRAKESTKSA  403

Query  599  ILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASY  420
            ILMNLESR++ASEDIGRQILTYGERKPVE  L+A+E ++  DI+  +QK+ISSPLTMASY
Sbjct  404  ILMNLESRIIASEDIGRQILTYGERKPVEQLLEAVEAITLNDISEFSQKIISSPLTMASY  463

Query  419  GDVLYLPSYDTV  384
            GDV+ +PSY++V
Sbjct  464  GDVMNVPSYESV  475



>ref|XP_006644677.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Oryza brachyantha]
Length=499

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK A+ +TVLQMLMGGGGSFSAGGPGKGM+SRLYLR+LN Y Q+ 
Sbjct  300  THIALAFEVPGGWYEEKTAIIVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRILNNYHQIE  359

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N +GLFGI  TTS DF+SKAVD+A +EL  +A+PG+V Q+QLDRAKQATKS
Sbjct  360  SFSAFNSIYNHSGLFGIHTTTSPDFASKAVDLAARELLDVATPGQVTQEQLDRAKQATKS  419

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR VASEDIGRQILTYGERKP+EHFLK +E ++  DI+S A+K+ISSPLT+AS
Sbjct  420  AVLMNLESRAVASEDIGRQILTYGERKPIEHFLKDLEAITLNDISSTAKKIISSPLTLAS  479

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  480  WGDVIHVPSYESV  492



>gb|EMS54290.1| Mitochondrial-processing peptidase subunit alpha [Triticum urartu]
Length=382

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK AM +TVLQMLMGGGGSFS GGPGKGM+SRLYLRVLN+Y Q+ 
Sbjct  183  THIALAFEVPGGWRQEKTAMIVTVLQMLMGGGGSFSVGGPGKGMHSRLYLRVLNKYDQIE  242

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N +GLFGI A TS DF+S AVD+A  EL  +A+PG+V Q+QLDRAK+ATK+
Sbjct  243  SFSAFNSIYNDSGLFGIHAATSPDFASTAVDLAAGELLEVATPGKVTQEQLDRAKEATKA  302

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+VASEDIGRQ+LTYG+RKPVE+F++A+E  +  DI+++AQK+ISSPLT+AS
Sbjct  303  AVLMNLESRIVASEDIGRQVLTYGQRKPVEYFVRAVEATTLNDISTVAQKIISSPLTLAS  362

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  363  WGDVIHVPSYESV  375



>ref|XP_004961441.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Setaria italica]
Length=499

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK AM +TVLQMLMGGGGSFSAGGPGKGM+SRLYLR+L  Y Q+ 
Sbjct  300  THIALAFEVPGGWNQEKTAMVVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRILTNYQQIE  359

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N++GLFGI A TS DFSSKAVD+A  EL  IA+PG+V Q+QLDRAK+ATKS
Sbjct  360  SFSAFNSVYNNSGLFGIYAVTSPDFSSKAVDLAAGELLEIATPGKVSQEQLDRAKEATKS  419

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR +ASEDIGRQ+LTYGERKP+E+FLK +EE++  DI+S A+K++SSPLTMAS
Sbjct  420  AVLMNLESRSIASEDIGRQVLTYGERKPIEYFLKTVEEITLNDISSTAKKIMSSPLTMAS  479

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  480  WGDVIHVPSYESV  492



>ref|XP_009338746.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Pyrus x bretschneideri]
Length=502

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLN+YPQ+ 
Sbjct  303  THIALAFEVPGGWRQEKQAVLLTVLQLLMGGGGSFSAGGPGKGMHSRLYLRVLNQYPQIQ  362

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN +GLFGI A+T S+F+SKAVDIA +EL  IA+PG+V   Q+ RAK++TK+
Sbjct  363  SFSAFNSIFNDSGLFGIYASTGSEFASKAVDIAAQELLTIATPGQVTDVQVKRAKESTKA  422

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQ+LTYG+RKPVEHFLK +E V+ KDI +IAQK+ISSPLT+A+
Sbjct  423  AVLMNLESRMIASEDIGRQVLTYGDRKPVEHFLKTVEGVTLKDITTIAQKIISSPLTLAT  482

Query  422  YGDVLYLPSYDTV  384
            YG V+++P YD++
Sbjct  483  YGSVVHVPGYDSI  495



>ref|XP_010232283.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Brachypodium distachyon]
Length=498

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK A+ +TVLQMLMGGGGSFSAGGPGKGM+SRLYLR+LN Y Q+ 
Sbjct  299  THVALAFEVPGGWYEEKTAIIVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRILNHYQQIE  358

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N +GLFGI ATTS DF+SKAVD+A  EL  +A+PG V Q+QLDRAKQATKS
Sbjct  359  SFSAFTSIYNHSGLFGIHATTSPDFASKAVDLAAGELLEVATPGNVTQEQLDRAKQATKS  418

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR VASED+GRQILTYGERKP+EHFLK +E ++  DI+S A  +ISSPLTMAS
Sbjct  419  AVLMNLESRAVASEDMGRQILTYGERKPIEHFLKDLEAITLNDISSTANNIISSPLTMAS  478

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  479  WGDVIHVPSYESV  491



>ref|NP_001044193.1| Os01g0739000 [Oryza sativa Japonica Group]
 dbj|BAD86941.1| putative mitochondrial processing peptidase [Oryza sativa Japonica 
Group]
 dbj|BAF06107.1| Os01g0739000 [Oryza sativa Japonica Group]
 dbj|BAG91493.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93650.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGT38448.1| mitochondrial processing peptidase [Oryza sativa Japonica Group]
Length=499

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ +TVLQMLMGGGGSFSAGGPGKGM+SRLYLR+LN Y Q+ 
Sbjct  300  THIALAFEVPGGWFEEKTAIIVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRILNNYHQIE  359

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N +GLFGI ATTS +F+SKAVD+A  EL  +A+PG+V Q+QLDRAKQATKS
Sbjct  360  SFSAFNSIYNHSGLFGIHATTSPNFASKAVDLAAGELLEVATPGKVTQEQLDRAKQATKS  419

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+VASEDIGRQILTYGERKP+EHFLK +E ++  DI+S A+K+ISSPLT+AS
Sbjct  420  AVLMNLESRVVASEDIGRQILTYGERKPIEHFLKDLEAITLNDISSTAKKIISSPLTLAS  479

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  480  WGDVIHVPSYESV  492



>ref|XP_002514191.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
 gb|EEF48145.1| mitochondrial processing peptidase alpha subunit, putative [Ricinus 
communis]
Length=507

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE P GW  +K AMTLTVLQMLMGGGG+FSAGGPGKGMYSRLYLRVL++YPQ+ 
Sbjct  308  THFALAFESPKGWSDDKGAMTLTVLQMLMGGGGAFSAGGPGKGMYSRLYLRVLHDYPQIE  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +F+AFS+I++ +G+FGIQATT S+F+SKA+D+AV EL ++ASPG VDQ QLDRAKQ+TKS
Sbjct  368  SFTAFSNIYHHSGIFGIQATTGSNFASKAIDLAVNELISVASPGAVDQVQLDRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESR++ SEDIGRQILTYG+RKP+E FLK ++ V+ +DI   AQKLISSPLTMAS
Sbjct  428  AILMNLESRIIVSEDIGRQILTYGKRKPLEDFLKIVDSVTLQDITQTAQKLISSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +P+YD++
Sbjct  488  HGDVVNVPTYDSI  500



>gb|AAV44043.1| putative mitochondrial processing peptidase alpha subunit [Oryza 
sativa Japonica Group]
 dbj|BAG89683.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK AM +TVLQ+LMGGGGSFS GGPGKGM+S LYLRVLN Y Q+ 
Sbjct  183  THIALAFEVPGGWRQEKTAMIVTVLQVLMGGGGSFSTGGPGKGMHSWLYLRVLNNYGQIE  242

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFSSI+N++GLFGI ATT+ DF S AVD+A +EL  +A+PG+V Q+QLDRAK+ATKS
Sbjct  243  SFSAFSSIYNNSGLFGIHATTNPDFVSSAVDLAARELHEVATPGKVTQEQLDRAKEATKS  302

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            ++LM+LESR+VASEDIGRQ+LTYGERKP+E+FLK +EE++  DI+S A+K+ISSPLT+AS
Sbjct  303  SVLMDLESRIVASEDIGRQVLTYGERKPIEYFLKTVEEITLNDISSTAKKIISSPLTLAS  362

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  363  WGDVIHVPSYESV  375



>gb|EAZ13476.1| hypothetical protein OsJ_03392 [Oryza sativa Japonica Group]
Length=535

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ +TVLQMLMGGGGSFSAGGPGKGM+SRLYLR+LN Y Q+ 
Sbjct  336  THIALAFEVPGGWFEEKTAIIVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRILNNYHQIE  395

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N +GLFGI ATTS +F+SKAVD+A  EL  +A+PG+V Q+QLDRAKQATKS
Sbjct  396  SFSAFNSIYNHSGLFGIHATTSPNFASKAVDLAAGELLEVATPGKVTQEQLDRAKQATKS  455

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+VASEDIGRQILTYGERKP+EHFLK +E ++  DI+S A+K+ISSPLT+AS
Sbjct  456  AVLMNLESRVVASEDIGRQILTYGERKPIEHFLKDLEAITLNDISSTAKKIISSPLTLAS  515

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  516  WGDVIHVPSYESV  528



>gb|EEC71449.1| hypothetical protein OsI_03671 [Oryza sativa Indica Group]
Length=563

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ +TVLQMLMGGGGSFSAGGPGKGM+SRLYLR+LN Y Q+ 
Sbjct  352  THIALAFEVPGGWFEEKTAIIVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRILNNYHQIE  411

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N +GLFGI ATTS +F+SKAVD+A  EL  +A+PG+V Q+QLDRAKQATKS
Sbjct  412  SFSAFNSIYNHSGLFGIHATTSPNFASKAVDLAAGELLEVATPGKVTQEQLDRAKQATKS  471

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+VASEDIGRQILTYGERKP+EHFLK +E ++  DI+S A+K+ISSPLT+AS
Sbjct  472  AVLMNLESRVVASEDIGRQILTYGERKPIEHFLKDLEAITLNDISSTAKKIISSPLTLAS  531

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  532  WGDVIHVPSYESV  544



>gb|ACN36870.1| unknown [Zea mays]
 gb|AFW78812.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
Length=464

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK AM +TVLQMLMGGGGSFSAGGPGKGM+SRLYLRVL  + Q+ 
Sbjct  265  THIALAFEVPGGWNQEKTAMVVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLTNFQQIE  324

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N++GLFGI A TS DFSSKAVD+A  EL  IA+PG+V Q+QLDRAK+ATKS
Sbjct  325  SFSAFNSVYNNSGLFGIYAVTSPDFSSKAVDLAAGELLEIATPGKVTQEQLDRAKEATKS  384

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR +ASEDIGRQ+LTYGERKP+E+FLK +EE++  DI S A++++S+PLTMAS
Sbjct  385  AVLMNLESRSIASEDIGRQVLTYGERKPIEYFLKTVEEITLNDILSTAKEMMSTPLTMAS  444

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  445  WGDVIHVPSYESV  457



>gb|KJB68193.1| hypothetical protein B456_010G231200 [Gossypium raimondii]
Length=382

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGW+ EKD + LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+H
Sbjct  183  THFALAFEVPGGWNNEKDTVALTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIH  242

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI  +TSSDF S+AV+IA +EL  +A+ G V Q  + RA++ATKS
Sbjct  243  SFSAFNSIFNNTGLFGIYGSTSSDFVSRAVEIAAEELLVLATEGSVSQLMIKRAQEATKS  302

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ +EDIGRQILTYGERK V  FLK ++EV+ +DI ++A+K+ISSPLTMAS
Sbjct  303  AVLMNLESRMIIAEDIGRQILTYGERKSVNAFLKMVDEVTLRDITNMAKKIISSPLTMAS  362

Query  422  YGDVLYLPSYDTV  384
            YGDV  +PSY++V
Sbjct  363  YGDVFRVPSYESV  375



>ref|XP_003542085.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Glycine max]
Length=491

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            V   A+AFE+PGGW KEK+A+ LT+LQMLMGGGGSFSAGGPGKGM+SRL+LRVLNE+ Q+
Sbjct  291  VARVAIAFEVPGGWKKEKEAIALTILQMLMGGGGSFSAGGPGKGMHSRLFLRVLNEHQQI  350

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H+FSAF+S+FN+TGLFGI A+T SDF +KAVD+A +EL AIASPG+V Q QLD AK +TK
Sbjct  351  HSFSAFNSLFNNTGLFGIYASTGSDFVAKAVDLAARELIAIASPGQVTQVQLDLAKLSTK  410

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESRM+ASEDIGRQ+LTYGERKP+E FL A++ ++  DI  I+QK+ISSPLTMA
Sbjct  411  SAVLMNLESRMIASEDIGRQVLTYGERKPLEQFLNAVDGITLNDITKISQKIISSPLTMA  470

Query  425  SYGDVLYLPSYDTV  384
            SYGDV  +P Y++V
Sbjct  471  SYGDVFNVPCYESV  484



>ref|NP_001056089.1| Os05g0524300 [Oryza sativa Japonica Group]
 dbj|BAF18003.1| Os05g0524300, partial [Oryza sativa Japonica Group]
Length=494

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK AM +TVLQ+LMGGGGSFS GGPGKGM+S LYLRVLN Y Q+ 
Sbjct  295  THIALAFEVPGGWRQEKTAMIVTVLQVLMGGGGSFSTGGPGKGMHSWLYLRVLNNYGQIE  354

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFSSI+N++GLFGI ATT+ DF S AVD+A +EL  +A+PG+V Q+QLDRAK+ATKS
Sbjct  355  SFSAFSSIYNNSGLFGIHATTNPDFVSSAVDLAARELHEVATPGKVTQEQLDRAKEATKS  414

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            ++LM+LESR+VASEDIGRQ+LTYGERKP+E+FLK +EE++  DI+S A+K+ISSPLT+AS
Sbjct  415  SVLMDLESRIVASEDIGRQVLTYGERKPIEYFLKTVEEITLNDISSTAKKIISSPLTLAS  474

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  475  WGDVIHVPSYESV  487



>ref|NP_001146680.1| uncharacterized protein LOC100280280 [Zea mays]
 gb|ACL54515.1| unknown [Zea mays]
Length=499

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK AM +TVLQMLMGGGGSFSAGGPGKGM+SRLYLRVL  + Q+ 
Sbjct  300  THIALAFEVPGGWNQEKTAMVVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLTNFQQIE  359

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N++GLFGI A TS DFSSKAVD+A  EL  IA+PG+V Q+QLDRAK+ATKS
Sbjct  360  SFSAFNSVYNNSGLFGIYAVTSPDFSSKAVDLAAGELLEIATPGKVTQEQLDRAKEATKS  419

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR +ASEDIGRQ+LTYGERKP+E+FLK +EE++  DI S A++++S+PLTMAS
Sbjct  420  AVLMNLESRSIASEDIGRQVLTYGERKPIEYFLKTVEEITLNDILSTAKEMMSTPLTMAS  479

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  480  WGDVIHVPSYESV  492



>gb|EEE64417.1| hypothetical protein OsJ_19261 [Oryza sativa Japonica Group]
Length=495

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK AM +TVLQ+LMGGGGSFS GGPGKGM+S LYLRVLN Y Q+ 
Sbjct  296  THIALAFEVPGGWRQEKTAMIVTVLQVLMGGGGSFSTGGPGKGMHSWLYLRVLNNYGQIE  355

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFSSI+N++GLFGI ATT+ DF S AVD+A +EL  +A+PG+V Q+QLDRAK+ATKS
Sbjct  356  SFSAFSSIYNNSGLFGIHATTNPDFVSSAVDLAARELHEVATPGKVTQEQLDRAKEATKS  415

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            ++LM+LESR+VASEDIGRQ+LTYGERKP+E+FLK +EE++  DI+S A+K+ISSPLT+AS
Sbjct  416  SVLMDLESRIVASEDIGRQVLTYGERKPIEYFLKTVEEITLNDISSTAKKIISSPLTLAS  475

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  476  WGDVIHVPSYESV  488



>gb|KJB83096.1| hypothetical protein B456_013G229300 [Gossypium raimondii]
Length=490

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 168/193 (87%), Gaps = 15/193 (8%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHKEK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRL            
Sbjct  308  THFALAFELPGGWHKEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRL------------  355

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
               +F+SI+N TG+FGIQATT SDF+  A+D+AVKEL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  356  ---SFNSIYNHTGIFGIQATTGSDFAPTAIDVAVKELIAVATPGQVDQIQLDRAKQSTKS  412

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMVASEDIG+Q+LTYGERKPVE+FLK ++E++ KDI+SIAQKL+SSPLTMAS
Sbjct  413  AILMNLESRMVASEDIGKQVLTYGERKPVEYFLKVVDEITLKDISSIAQKLLSSPLTMAS  472

Query  422  YGDVLYLPSYDTV  384
            YG+V+ +PSYD+V
Sbjct  473  YGNVINVPSYDSV  485



>gb|AFW78811.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
Length=499

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK AM +TVLQMLMGGGGSFSAGGPGKGM+SRLYLRVL  + Q+ 
Sbjct  300  THIALAFEVPGGWNQEKTAMVVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLTNFQQIE  359

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+S++N++GLFGI A TS DFSSKAVD+A  EL  IA+PG+V Q+QLDRAK+ATKS
Sbjct  360  SFSAFNSVYNNSGLFGIYAVTSPDFSSKAVDLAAGELLEIATPGKVTQEQLDRAKEATKS  419

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR +ASEDIGRQ+LTYGERKP+E+FLK +EE++  DI S A++++S+PLTMAS
Sbjct  420  AVLMNLESRSIASEDIGRQVLTYGERKPIEYFLKTVEEITLNDILSTAKEMMSTPLTMAS  479

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  480  WGDVIHVPSYESV  492



>ref|XP_008228401.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Prunus 
mume]
Length=503

 Score =   263 bits (672),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLN++ ++ 
Sbjct  304  THIALAFEVPGGWRQEKQAILLTVLQLLMGGGGSFSAGGPGKGMHSRLYLRVLNQFQEIQ  363

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN +GLFGI A+++S+F S+ VDIA KEL +IA+PG+V   QL RAK++TK+
Sbjct  364  SFSAFNSIFNDSGLFGIYASSASEFGSELVDIAAKELLSIATPGQVTDVQLKRAKESTKA  423

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQ+LTYGERKPVEHFLK +EEVS  DI +IAQK+ISSPLTMAS
Sbjct  424  AVLMNLESRMIASEDIGRQVLTYGERKPVEHFLKTVEEVSLTDITTIAQKIISSPLTMAS  483

Query  422  YGDVLYLPSYDTV  384
            +G+V  +PSY++V
Sbjct  484  FGNVSNVPSYESV  496



>ref|XP_002299745.1| mitochondrial processing peptidase alpha subunit 2 family protein 
[Populus trichocarpa]
 gb|EEE84550.1| mitochondrial processing peptidase alpha subunit 2 family protein 
[Populus trichocarpa]
Length=507

 Score =   263 bits (672),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H ALAFE  GGWHKEKDA+ LTVLQML+GGGGSFSAGGPGKGM+SRLYLRVL++YP++
Sbjct  305  LAHVALAFEASGGWHKEKDAIMLTVLQMLLGGGGSFSAGGPGKGMHSRLYLRVLSKYPEL  364

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SIFN TGLFGI A+   +F  KAVD+AV EL AIA+PG+V Q+QL+RAK++TK
Sbjct  365  QSFSAFNSIFNKTGLFGIYASCGPNFVHKAVDLAVAELIAIATPGQVTQEQLNRAKESTK  424

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+L NLESRM+ +EDIGRQ LTYGERKPVEHFLK ++E++  DI SI + LI SPLTMA
Sbjct  425  SAVLFNLESRMIVAEDIGRQFLTYGERKPVEHFLKVVDEITLDDITSIGRSLIRSPLTMA  484

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL +PSY++V
Sbjct  485  SYGDVLNVPSYESV  498



>ref|XP_007215264.1| hypothetical protein PRUPE_ppa004554mg [Prunus persica]
 gb|EMJ16463.1| hypothetical protein PRUPE_ppa004554mg [Prunus persica]
Length=503

 Score =   263 bits (672),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLN++ ++ 
Sbjct  304  THIALAFEVPGGWRQEKQAILLTVLQLLMGGGGSFSAGGPGKGMHSRLYLRVLNKFQEIQ  363

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN +GLFGI A+++S+F S+ VDIA KEL +IA+PG+V   QL RAK++TK+
Sbjct  364  SFSAFNSIFNDSGLFGIYASSASEFGSELVDIAAKELLSIATPGQVTDVQLKRAKESTKA  423

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQ+LTYGERKPVEHFLK +EEVS  DI +IAQK+ISSPLTMAS
Sbjct  424  AVLMNLESRMIASEDIGRQVLTYGERKPVEHFLKTVEEVSLTDITTIAQKIISSPLTMAS  483

Query  422  YGDVLYLPSYDTV  384
            +G+V  +PSY++V
Sbjct  484  FGNVSNVPSYESV  496



>gb|KJB68192.1| hypothetical protein B456_010G231200 [Gossypium raimondii]
 gb|KJB68195.1| hypothetical protein B456_010G231200 [Gossypium raimondii]
Length=484

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGW+ EKD + LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+H
Sbjct  285  THFALAFEVPGGWNNEKDTVALTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIH  344

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI  +TSSDF S+AV+IA +EL  +A+ G V Q  + RA++ATKS
Sbjct  345  SFSAFNSIFNNTGLFGIYGSTSSDFVSRAVEIAAEELLVLATEGSVSQLMIKRAQEATKS  404

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ +EDIGRQILTYGERK V  FLK ++EV+ +DI ++A+K+ISSPLTMAS
Sbjct  405  AVLMNLESRMIIAEDIGRQILTYGERKSVNAFLKMVDEVTLRDITNMAKKIISSPLTMAS  464

Query  422  YGDVLYLPSYDTV  384
            YGDV  +PSY++V
Sbjct  465  YGDVFRVPSYESV  477



>ref|XP_010098163.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
 gb|EXB74600.1| Mitochondrial-processing peptidase subunit alpha [Morus notabilis]
Length=505

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK A+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+ 
Sbjct  306  THVALAFEVPGGWREEKQAILLTVLQLLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN++GLFGI A+T SDF  KAV +A  EL +IA+ G+V Q +L+RAK++TKS
Sbjct  366  SFSAFNSIFNNSGLFGIYASTGSDFVEKAVAVAAAELLSIATAGQVTQVELNRAKESTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ASEDIGRQ+LTYGERKPVE FLKA++E++ KDI SIAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRMIASEDIGRQVLTYGERKPVERFLKAVDEITLKDITSIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL++PSY++V
Sbjct  486  FGDVLHVPSYESV  498



>gb|EEC79554.1| hypothetical protein OsI_20678 [Oryza sativa Indica Group]
Length=592

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW +EK AM +TVLQ+LMGGGGSFS GGPGKGM S LYLRVLN Y Q+ 
Sbjct  393  THIALAFEVPGGWRQEKTAMIVTVLQVLMGGGGSFSTGGPGKGMRSWLYLRVLNNYGQIE  452

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFSSI+N++GLFGI ATT+ DF S AVD+A +EL  +A+PG+V Q+QLDRAK+ATKS
Sbjct  453  SFSAFSSIYNNSGLFGIHATTNPDFVSSAVDLAARELHEVATPGKVTQEQLDRAKEATKS  512

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            ++LM+LESR+VASEDIGRQ+LTYGERKP+E+FLK +EE++  DI+S A+K+ISSPLT+AS
Sbjct  513  SVLMDLESRIVASEDIGRQVLTYGERKPIEYFLKTVEEITLNDISSTAKKIISSPLTLAS  572

Query  422  YGDVLYLPSYDTV  384
            +GDV+++PSY++V
Sbjct  573  WGDVIHVPSYESV  585



>ref|XP_011000940.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Populus euphratica]
Length=507

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H ALAFE  GGWHKEKDA+ LTVLQML+GGGGSFSAGGPGKGM+SRLYLRVL+++P++
Sbjct  305  MAHVALAFEASGGWHKEKDAIMLTVLQMLLGGGGSFSAGGPGKGMHSRLYLRVLSKHPEL  364

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+SIFN TGLFGI A+   +F  KAVD+AV EL AIA+PG+V Q+QL+RAK++TK
Sbjct  365  QSFSAFNSIFNKTGLFGIYASCGPNFVHKAVDLAVAELIAIATPGQVTQEQLNRAKESTK  424

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+L NLESRM+ +EDIGRQ LTYGERKPVEHFLK ++E++  DI SI   LI SPLTMA
Sbjct  425  SAVLFNLESRMIVAEDIGRQFLTYGERKPVEHFLKVVDEITLDDITSIGCSLIRSPLTMA  484

Query  425  SYGDVLYLPSYDTV  384
            SYGDVL +PSY++V
Sbjct  485  SYGDVLNVPSYESV  498



>ref|XP_006465713.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Citrus sinensis]
Length=505

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW K+K+A+ LTVLQ+LMGGGGSFSAGGPGKGM++RLYLRVLNEY Q+ 
Sbjct  306  THIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A T SDF SKAVD+ V+EL  IA+P +V Q QL+RAK+ATKS
Sbjct  366  SFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ SEDIGRQILTYGERK V+ FL  +E ++  DI +IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRVIVSEDIGRQILTYGERKSVDQFLSVLEHITLDDITNIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +P Y++V
Sbjct  486  YGDVINVPGYESV  498



>gb|KDO51844.1| hypothetical protein CISIN_1g010650mg [Citrus sinensis]
Length=505

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW K+K+A+ LTVLQ+LMGGGGSFSAGGPGKGM++RLYLRVLNEY Q+ 
Sbjct  306  THIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A T SDF SKAVD+ V+EL  IA+P +V Q QL+RAK+ATKS
Sbjct  366  SFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ SEDIGRQILTYGERK V+ FL  +E ++  DI +IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRVIVSEDIGRQILTYGERKSVDQFLSVLEHITLDDITNIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +P Y++V
Sbjct  486  YGDVINVPGYESV  498



>ref|XP_006426849.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
 gb|ESR40089.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
Length=505

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW K+K+A+ LTVLQ+LMGGGGSFSAGGPGKGM++RLYLRVLNEY Q+ 
Sbjct  306  THIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A T SDF SKAVD+ V+EL  IA+P +V Q QL+RAK+ATKS
Sbjct  366  SFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ SEDIGRQILTYGERK V+ FL  +E ++  DI +IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRVIVSEDIGRQILTYGERKSVDQFLSVLEHITLDDITNIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +P Y++V
Sbjct  486  YGDVINVPGYESV  498



>ref|XP_008242460.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Prunus mume]
Length=510

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 168/193 (87%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW  EKDAM + VLQ+LMGGGGSFSAGGPGKGM+SRLY RVLN++ ++H
Sbjct  312  THFALAFELPGGWLNEKDAMIVNVLQVLMGGGGSFSAGGPGKGMHSRLYSRVLNQHLELH  371

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFSSI+N+TG+FGIQA T SDF +KA+DIA  EL AIA+PGEVDQ QLDRAK++TKS
Sbjct  372  SISAFSSIYNNTGIFGIQAATGSDFVTKAIDIAANELIAIATPGEVDQVQLDRAKKSTKS  431

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            +ILMNLESRMV ++D+GRQILTY + K +   LKA++EVS +DIASI QKL+SSPLTMAS
Sbjct  432  SILMNLESRMVVADDLGRQILTYNDWK-LSQLLKAVDEVSLEDIASIGQKLLSSPLTMAS  490

Query  422  YGDVLYLPSYDTV  384
            YGDV  +PSYD+V
Sbjct  491  YGDVTKVPSYDSV  503



>ref|XP_011012737.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Populus euphratica]
Length=506

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAF L GGWH  K+AMTLTVLQ+LMGGGGSFSAGGPGKGMYSRLY RVLN+Y +V 
Sbjct  307  THFALAFGLKGGWHDVKEAMTLTVLQILMGGGGSFSAGGPGKGMYSRLYQRVLNQYHKVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFS I+N + +FGIQATT +DF+S A+ +A  ELT +ASPG VD  QL RAKQ+TKS
Sbjct  367  SFSAFSHIYNHSAIFGIQATTDADFASSAIKLAAGELTEVASPGAVDPVQLQRAKQSTKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRMVASEDIGRQIL Y +RKP+  FLKAI+EV+ +DI  I+QKLISSPLTMAS
Sbjct  427  AILMNLESRMVASEDIGRQILMYNKRKPLGDFLKAIDEVTLQDITQISQKLISSPLTMAS  486

Query  422  YGDVLYLPSYDTV  384
            YG+V+ +P+YDT+
Sbjct  487  YGEVINVPTYDTI  499



>ref|XP_004302845.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Fragaria 
vesca subsp. vesca]
Length=503

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -2

Query  959  HFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHA  780
            H ALAFE+PGGW +EK+A+ LTVLQ+LMGGGGSFSAGGPGKGM+SRLYLRVLN + ++ +
Sbjct  305  HIALAFEVPGGWRQEKEAIILTVLQLLMGGGGSFSAGGPGKGMHSRLYLRVLNHHQEIQS  364

Query  779  FSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSA  600
            F+AF+S+FN +GLFGI A+T S F+S+AV+IA KEL +IA+PG+V   +L RAK+ATK+A
Sbjct  365  FTAFNSLFNESGLFGIYASTGSAFASEAVEIAAKELLSIATPGQVTDVELKRAKEATKAA  424

Query  599  ILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASY  420
            +LMNLESR++ASEDIGRQ+LTYGERKPVEHFLK +E V+ KDI + AQ++ISSPLTMASY
Sbjct  425  VLMNLESRVIASEDIGRQVLTYGERKPVEHFLKTVEGVTLKDITTAAQQIISSPLTMASY  484

Query  419  GDVLYLPSYDTV  384
            G+V+ +PSYD+V
Sbjct  485  GNVVNVPSYDSV  496



>ref|XP_010688377.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=469

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THFALAFELPGGWHK+KDAM +TVLQMLMGGGGSFSAGGPGKGMYSRLYL VLNEYPQ+
Sbjct  307  MTHFALAFELPGGWHKDKDAMVMTVLQMLMGGGGSFSAGGPGKGMYSRLYLNVLNEYPQI  366

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H+FSAF+SI+N+TGLFGIQATT SDF +KA++IA +EL A+A+PGEV Q QLDRAK ATK
Sbjct  367  HSFSAFNSIYNTTGLFGIQATTGSDFVTKAIEIAARELIAVATPGEVTQLQLDRAKAATK  426

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEE  489
            SAILMNLESRMVASEDIGRQILTYGERKPVEHFLK+I++
Sbjct  427  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKSIDD  465



>ref|XP_010931091.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Elaeis guineensis]
Length=512

 Score =   256 bits (654),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH++KDA  LTVLQ LMGGGGSFSAGGPGKGM+SRLYLRVLN+Y QV 
Sbjct  312  THVALAFEVPGGWHQDKDATVLTVLQTLMGGGGSFSAGGPGKGMHSRLYLRVLNQYQQVQ  371

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFSSI+N +GLFGI +TT S+F +KAVDIA  EL AIA+PG+V + +L RAK ATKS
Sbjct  372  SFSAFSSIYNDSGLFGIHSTTGSEFVAKAVDIAANELLAIATPGQVSEVELCRAKNATKS  431

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR +A+EDIGRQILTYG RKPVEHFL+ ++E++  D+  +AQK++SSPLTMAS
Sbjct  432  AVLMNLESRAIATEDIGRQILTYGCRKPVEHFLRCLDELTLDDLTMMAQKIVSSPLTMAS  491

Query  422  YGDVLYLPSYDTV  384
             GDV  +PSY +V
Sbjct  492  LGDVDCVPSYASV  504



>ref|XP_007204564.1| hypothetical protein PRUPE_ppa004446mg [Prunus persica]
 gb|EMJ05763.1| hypothetical protein PRUPE_ppa004446mg [Prunus persica]
Length=509

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 166/193 (86%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW  EKDAM + VLQ+LMGGGGSFSAGGPGKGM+SRLY RVLN++ ++H
Sbjct  312  THFALAFELPGGWLNEKDAMIVNVLQVLMGGGGSFSAGGPGKGMHSRLYSRVLNQHLELH  371

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFSSI+N+TG+FGIQA T  +F +KA+DIA  EL AIA+PGEVDQ QLDRAK++TKS
Sbjct  372  SISAFSSIYNNTGIFGIQAAT-VNFVTKAIDIAANELIAIATPGEVDQVQLDRAKKSTKS  430

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            +ILMNLESRMV ++D+GRQILTY + K +   LKA++EVS  DIASI QKL+SSPLTMAS
Sbjct  431  SILMNLESRMVVADDLGRQILTYNDWK-LSQLLKAVDEVSLGDIASIGQKLLSSPLTMAS  489

Query  422  YGDVLYLPSYDTV  384
            YGDV  +PSYD+V
Sbjct  490  YGDVTKVPSYDSV  502



>gb|AFK44732.1| unknown [Lotus japonicus]
Length=181

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  905  MTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQA  726
            M LTVLQML+GGGGSFSAGGPGKGM+SRLYL VLN++ +V++ SAF++I+N+TG+FGIQ 
Sbjct  1    MVLTVLQMLLGGGGSFSAGGPGKGMFSRLYLNVLNKFSEVYSISAFNNIYNNTGIFGIQV  60

Query  725  TTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSAILMNLESRMVASEDIGRQ  546
            TT SDF SK +DI V EL A+A+ G+V+  +LDRAKQATKSAILMNLESRMV SEDIGRQ
Sbjct  61   TTGSDFVSKVIDITVNELLAVATSGQVNHVELDRAKQATKSAILMNLESRMVVSEDIGRQ  120

Query  545  ILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDVLYLPSYDTV  384
            +LTYGERKPV+ FLKA+++V+ KDI SI+QK +SSPLTMASYGDVLY+PSY++V
Sbjct  121  VLTYGERKPVDDFLKAVDQVTLKDITSISQKPLSSPLTMASYGDVLYVPSYESV  174



>ref|XP_006426848.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
 gb|ESR40088.1| hypothetical protein CICLE_v10025419mg [Citrus clementina]
Length=503

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 165/193 (85%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW K+K+A+ LTVLQ+LMGGGGSFSAGGPGKGM++RLYLRVLNEY Q+ 
Sbjct  306  THIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A T SDF SKAVD+ V+EL  IA+P +V Q QL+RAK+ATKS
Sbjct  366  SFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ SEDIGRQILTYGERK V+ FL  +E ++  DI +IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRVIVSEDIGRQILTYGERKSVDQFLSVLEHITLDDITNIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            Y  V+ +P Y++V
Sbjct  486  Y--VINVPGYESV  496



>gb|KDO51843.1| hypothetical protein CISIN_1g010650mg [Citrus sinensis]
Length=503

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 165/193 (85%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW K+K+A+ LTVLQ+LMGGGGSFSAGGPGKGM++RLYLRVLNEY Q+ 
Sbjct  306  THIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A T SDF SKAVD+ V+EL  IA+P +V Q QL+RAK+ATKS
Sbjct  366  SFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR++ SEDIGRQILTYGERK V+ FL  +E ++  DI +IAQK+ISSPLTMAS
Sbjct  426  AVLMNLESRVIVSEDIGRQILTYGERKSVDQFLSVLEHITLDDITNIAQKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            Y  V+ +P Y++V
Sbjct  486  Y--VINVPGYESV  496



>gb|ACJ86214.1| unknown [Medicago truncatula]
Length=240

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  893  VLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSS  714
            VLQMLMGGGGSFSAGGPGKGM+SRL+LRVLNEY Q+ +FSAF+SIFN+TGLFGI A+TSS
Sbjct  64   VLQMLMGGGGSFSAGGPGKGMHSRLFLRVLNEYQQIQSFSAFNSIFNNTGLFGIYASTSS  123

Query  713  DFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSAILMNLESRMVASEDIGRQILTY  534
            DF+ KAV++A KEL AIA+P +V + QLDRAK++TK+A+LMNLESRM+ASEDIGRQILTY
Sbjct  124  DFAPKAVELAAKELIAIATPEKVPEVQLDRAKKSTKTAVLMNLESRMIASEDIGRQILTY  183

Query  533  GERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDVLYLPSYDTV  384
            GERKPVE FLKA++E++  DI  I+Q++ISSPLTMASYGDV+ +PSY+ V
Sbjct  184  GERKPVEEFLKAVDEITLDDITKISQRIISSPLTMASYGDVINVPSYENV  233



>ref|XP_007024339.1| Mitochondrial-processing peptidase subunit alpha isoform 1 [Theobroma 
cacao]
 gb|EOY26961.1| Mitochondrial-processing peptidase subunit alpha isoform 1 [Theobroma 
cacao]
Length=486

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            +HFALAFE+PGGW+ EK+++ LTV+QMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+ 
Sbjct  285  SHFALAFEVPGGWNSEKESVILTVMQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIQ  344

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI  +TSSDF SKAVDIA +EL  +A  G V +  + RA++ATKS
Sbjct  345  SFSAFNSIFNNTGLFGIYGSTSSDFVSKAVDIAAEELLLLAEEGAVSRLMIKRAQEATKS  404

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ +EDIGRQILTYGERK V+ FLK ++EV+ +DIA +A+K++SSPLTMAS
Sbjct  405  AVLMNLESRMIVAEDIGRQILTYGERKSVQSFLKMVDEVTLRDIADMAKKILSSPLTMAS  464

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +PSY++V
Sbjct  465  YGDVINVPSYESV  477



>ref|XP_010465671.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 [Camelina sativa]
Length=501

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEYP+V 
Sbjct  306  THFALAFEVPG-WNNEKEAIIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYPEVQ  364

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSS+FN+TGLFGI   T+ DF+S+ +++   E+ A+A  G VDQ+ LDRAK ATKS
Sbjct  365  SCTAFSSVFNNTGLFGIYGCTTPDFASRGIELVADEIKAVAE-GRVDQKHLDRAKAATKS  423

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+A+EDIGRQILTYGERKPV+ FL  ++E++ KDIA    K+I+ PLTMAS
Sbjct  424  AILMNLESRMIAAEDIGRQILTYGERKPVDQFLTTVDELTLKDIADFTSKVITKPLTMAS  483

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSYD+V
Sbjct  484  FGEVLKVPSYDSV  496



>emb|CDY46536.1| BnaA08g01750D [Brassica napus]
Length=502

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W  EK+A+  +VLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  307  THFALAFEVPG-WKNEKEALIASVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIF++TGLFGI   +S +F++KA+++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFTSIFDNTGLFGIYGCSSPEFAAKAIELAAKELKDVAG-GKVNQKHLDRAKTATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLKA++E++ KDI     K+IS PLTM S
Sbjct  425  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKAVDELTLKDITDFTSKIISKPLTMGS  484

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDTV
Sbjct  485  FGDVLSVPSYDTV  497



>ref|XP_009107159.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Brassica rapa]
Length=502

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W  EK+A+  +VLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  307  THFALAFEVPG-WKNEKEALIASVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIF++TGLFGI   +S +F++KA+++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFTSIFDNTGLFGIYGCSSPEFAAKAIELAAKELKDVAG-GKVNQKHLDRAKTATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLKA++E++ KDI     K+IS PLTM S
Sbjct  425  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKAVDELTLKDITDFTSKIISKPLTMGS  484

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDTV
Sbjct  485  FGDVLSVPSYDTV  497



>gb|KFK35813.1| hypothetical protein AALP_AA4G040900 [Arabis alpina]
Length=513

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 164/193 (85%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+++T TVLQML+GGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  312  THFALAFEVPG-WNNEKESVTATVLQMLLGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  370

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +S +F++ A+++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  371  SCTAFTSIFNNTGLFGIYGCSSPEFAATAIELAAKELKNVAG-GKVNQKHLDRAKAATKS  429

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLK +++++ KDIA    K+IS PLTM S
Sbjct  430  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKTVDQLTLKDIADFTSKVISKPLTMGS  489

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDTV
Sbjct  490  FGDVLGVPSYDTV  502



>ref|XP_006854718.2| PREDICTED: mitochondrial-processing peptidase subunit alpha [Amborella 
trichopoda]
Length=514

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T+ AL FE+PGGW  EKDA+   VLQ LMGGGGSFSAGGPGKGM+SRLY+RVLNEY Q+ 
Sbjct  314  TYVALVFEVPGGWRDEKDAIITIVLQNLMGGGGSFSAGGPGKGMHSRLYIRVLNEYQQIQ  373

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFS+++N TGLFGI+A+T SDF ++AVDIA +EL AIA+PG+V + +L RAK +TKS
Sbjct  374  SFSAFSTVYNDTGLFGIRASTGSDFVAEAVDIAAEELIAIATPGKVKEVELIRAKNSTKS  433

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMV +EDIGRQILTYG RK VEHFLKA++ ++  D+++ A K++SSP+TM S
Sbjct  434  AVLMNLESRMVVTEDIGRQILTYGCRKHVEHFLKAVDAITLDDLSATAHKILSSPVTMGS  493

Query  422  YGDVLYLPSYDTV  384
            +GDV  +PSYD V
Sbjct  494  WGDVDRVPSYDLV  506



>ref|XP_009414834.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=514

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW  EKDA  LTVLQ LMGGGGSFSAGGPGKGM+SRLYLRVLN+Y +V 
Sbjct  314  THVALAFEVPGGWRHEKDATALTVLQTLMGGGGSFSAGGPGKGMHSRLYLRVLNKYQEVQ  373

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +F AFSSI N TGLFGI + T SDF SKAVD+AV EL AIA+PG+V + +L RAK AT+ 
Sbjct  374  SFLAFSSICNDTGLFGIHSITGSDFVSKAVDVAVNELHAIATPGQVTELELHRAKNATRL  433

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL+NLESR +A EDIGRQILTYG RKPV++FL+ ++E++  D+  +AQK++SSPLTMAS
Sbjct  434  AILLNLESRAIAVEDIGRQILTYGCRKPVDYFLRCLDELTLDDLTILAQKMLSSPLTMAS  493

Query  422  YGDVLYLPSYDTV  384
            +GDV  +PSY +V
Sbjct  494  WGDVDRVPSYASV  506



>emb|CDY45641.1| BnaA05g15080D [Brassica napus]
Length=504

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  309  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSSIFN+TGLFGI   +S +F++KA+++A KE+  +A  G+V+Q+ LDRAK ATKS
Sbjct  368  SCTAFSSIFNNTGLFGIYGCSSPEFAAKAIELAAKEMKDVAG-GKVNQKHLDRAKAATKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLK ++ ++ KDI     K+IS PLTM S
Sbjct  427  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKTVDGLTLKDITDFTSKIISKPLTMGS  486

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  487  FGDVLSVPSYDTI  499



>ref|XP_009144867.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Brassica rapa]
Length=504

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  309  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSSIFN+TGLFGI   +S +F++KA+++A KE+  +A  G+V+Q+ LDRAK ATKS
Sbjct  368  SCTAFSSIFNNTGLFGIYGCSSPEFAAKAIELAAKEMKDVAG-GKVNQKHLDRAKAATKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLK ++ ++ KDI     K+IS PLTM S
Sbjct  427  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKTVDGLTLKDITDFTSKIISKPLTMGS  486

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  487  FGDVLSVPSYDTI  499



>ref|XP_010528943.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Tarenaya hassleriana]
Length=502

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W  EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LYLRVLNEY QV 
Sbjct  307  THFALAFEVPG-WFNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYLRVLNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSSIFN+TGLFGI   +S +F++KAV++   EL  +A  G+V+Q+ L+RAK ATKS
Sbjct  366  SCTAFSSIFNNTGLFGIYGCSSPEFAAKAVEVGANELKDVAG-GKVNQKHLNRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLK +++++  DIA    K+I+ PLTMAS
Sbjct  425  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKTVDQLTLTDIADFTSKVIAKPLTMAS  484

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +PSYDTV
Sbjct  485  FGDVMNVPSYDTV  497



>ref|XP_010535186.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 isoform X1 [Tarenaya hassleriana]
Length=502

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+AMT TVLQMLMGGGGSFSAGGPGKGM+S LYLRVLNEY QV 
Sbjct  307  THFALAFEVPG-WYSEKEAMTATVLQMLMGGGGSFSAGGPGKGMHSWLYLRVLNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +S +F++K V++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFTSIFNNTGLFGIYGCSSPEFAAKTVEVAAKELKDVAG-GKVNQKHLDRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
             ILMNLES+M+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTMAS
Sbjct  425  TILMNLESQMITAEDIGRQILTYGERKPVDRFLKMVDQLTLKDIAEFTGKIITKPLTMAS  484

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +PSYD+V
Sbjct  485  YGDVMNVPSYDSV  497



>emb|CDY33843.1| BnaC06g05100D [Brassica napus]
Length=502

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  307  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +S +F++KA+++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFTSIFNNTGLFGIYGCSSPEFAAKAIELAAKELKDVAG-GKVNQKHLDRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLK ++ ++ KDI     K+IS PLTM S
Sbjct  425  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKTVDGLTLKDITDFTSKIISKPLTMGS  484

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSYDTV
Sbjct  485  FGEVLSVPSYDTV  497



>emb|CDX87868.1| BnaC06g09300D [Brassica napus]
Length=504

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  309  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSSIFN+TGLFGI   +S +F++KA+++A KE+  +A  G+V+Q+ LDRAK ATKS
Sbjct  368  SCTAFSSIFNNTGLFGIYGCSSPEFAAKAIELAAKEMKDVAG-GKVNQKHLDRAKAATKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLES+M+A+EDIGRQILTYGERKPVE FLK ++ ++ KDI     K+IS PLTM S
Sbjct  427  AVLMNLESQMIAAEDIGRQILTYGERKPVEQFLKTVDGLTLKDITDFTSKIISKPLTMGS  486

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDTV
Sbjct  487  FGDVLSVPSYDTV  499



>gb|KGN58021.1| hypothetical protein Csa_3G435020 [Cucumis sativus]
Length=484

 Score =   239 bits (609),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 155/193 (80%), Gaps = 21/193 (11%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWHKEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+ 
Sbjct  306  THVALAFEVPGGWHKEKDAIVLTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+T S+F +KAVDIA  EL +IA+PG+V Q            
Sbjct  366  SFSAFNSIFNNTGLFGIYASTGSNFVAKAVDIAASELISIATPGQVSQ------------  413

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
                     M+ SEDIGRQILTYGERKPVEHFLKA++ ++  DI +IAQK+ISSPLTMAS
Sbjct  414  ---------MIVSEDIGRQILTYGERKPVEHFLKAVDSITLNDITNIAQKVISSPLTMAS  464

Query  422  YGDVLYLPSYDTV  384
            YGDV+ +P+Y++V
Sbjct  465  YGDVINVPTYESV  477



>emb|CDM84014.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGW++EK A+T+TVLQ LMGGG  F  GG GKG+YSRL LR+L+ Y Q+ 
Sbjct  300  THFALAFEVPGGWYEEKTAITVTVLQKLMGGGDWFCTGGVGKGLYSRLSLRILSHYHQIE  359

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+ I N +GLFGI ATTS DF+SKAVD+A  EL  +A+PG V Q QLDRAK+A K 
Sbjct  360  SFSAFNHIHNYSGLFGILATTSPDFASKAVDLAAGELLEVATPGNVTQGQLDRAKRAAKC  419

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
             +LM+LESR VA EDIGRQ++TYGER+P+E FLK +E ++  DI+S A+ +IS+PLTMAS
Sbjct  420  KVLMDLESRAVACEDIGRQVMTYGEREPIEKFLKDVEAITLNDISSTAKNIISTPLTMAS  479

Query  422  YGDVLYLPSYDTV  384
            +GDV  +P+Y++V
Sbjct  480  WGDVTNIPTYESV  492



>ref|XP_010500794.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Camelina sativa]
Length=503

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY QV 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQQVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +SS+F++ A+++A KEL  +A  G+V+QQ LDRAK ATKS
Sbjct  367  SCTAFTSIFNNTGLFGIYGCSSSEFAATAIELAAKELKDVAG-GQVNQQHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+IS PLTM +
Sbjct  426  AVLMNLESRMIEAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVISKPLTMGA  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  486  FGDVLAVPSYDTI  498



>ref|NP_175610.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
 sp|Q9ZU25.1|MPPA1_ARATH RecName: Full=Probable mitochondrial-processing peptidase subunit 
alpha-1; AltName: Full=Alpha-MPP 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD12673.1| Strong similarity to gi|2062155 T02O04.2 mitochondrial processing 
peptidase alpha subunit precusor isolog from Arabidopsis 
thaliana BAC gb|AC001645. ESTs gb|Z18504 and gb|AA395715 come 
from this gene [Arabidopsis thaliana]
 gb|AAL38862.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AAM14194.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AEE32742.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
Length=503

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY +V 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN TGLFGI   +S  F++KA+++A KEL  +A  G+V+Q  LDRAK ATKS
Sbjct  367  SCTAFTSIFNDTGLFGIYGCSSPQFAAKAIELAAKELKDVAG-GKVNQAHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPV+ FLK++++++ KDIA    K+IS PLTM S
Sbjct  426  AVLMNLESRMIAAEDIGRQILTYGERKPVDQFLKSVDQLTLKDIADFTSKVISKPLTMGS  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  486  FGDVLAVPSYDTI  498



>gb|EMT18398.1| Mitochondrial-processing peptidase subunit alpha [Aegilops tauschii]
Length=562

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK A+T+TVLQ LMGGG  F  GG GKG+YSRL LR+L+ Y Q+ 
Sbjct  233  THVALAFEVPGGWYEEKTAITVTVLQKLMGGGDWFCTGGVGKGLYSRLSLRILSHYHQIE  292

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+ I+N +GLFGI ATTS DF+SKAVD+A  EL  +A+PG V Q QLDRAKQA K 
Sbjct  293  SFSAFNHIYNYSGLFGILATTSPDFASKAVDLAAGELLEVATPGNVTQGQLDRAKQAAKC  352

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
             +LM+LESR VA EDIGRQ++TYGERKP+E FL  +E ++  DI+S A+ +IS+PLTMAS
Sbjct  353  KVLMDLESRAVACEDIGRQVMTYGERKPIEKFLNDVEAITLNDISSTAKNIISTPLTMAS  412

Query  422  YGDVLYLPSYDTV  384
            +GDV  +P+Y++V
Sbjct  413  WGDVTNVPTYESV  425



>gb|AAM65922.1| mitochondrial processing peptidase alpha subunit, putative [Arabidopsis 
thaliana]
Length=503

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY +V 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN TGLFGI   +S  F++KA+++A KEL  +A  G+V+Q  LDRAK ATKS
Sbjct  367  SCTAFTSIFNDTGLFGIYGCSSPQFAAKAIELAAKELKDVAG-GKVNQAHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPV+ FLK++++++ KDIA    K+IS PLTM S
Sbjct  426  AVLMNLESRMIAAEDIGRQILTYGERKPVDQFLKSVDQLTLKDIADFTSKVISKPLTMGS  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL  PSYDT+
Sbjct  486  FGDVLAFPSYDTI  498



>emb|CDY53441.1| BnaC03g78020D [Brassica napus]
Length=502

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W  EK+A+  +VLQMLMGGGGSFSAGGPGKGM+S LYLR+LN+Y QV 
Sbjct  307  THFALAFEVPG-WKNEKEALIASVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNQYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIF++TGLFGI   +  +F++KA+++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFTSIFDNTGLFGIYGCSGPEFAAKAIELAAKELKDVAG-GKVNQKHLDRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLKA++E++ KDI     ++IS PLTM S
Sbjct  425  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKAVDELTLKDITDFTSEIISKPLTMGS  484

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDTV
Sbjct  485  FGDVLSVPSYDTV  497



>ref|XP_002894348.1| hypothetical protein ARALYDRAFT_474319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70607.1| hypothetical protein ARALYDRAFT_474319 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY +V 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +S +F++KA+++A KEL  +A  G+V+Q  LDRAK ATKS
Sbjct  367  SCTAFTSIFNNTGLFGIYGCSSPEFAAKAIELAAKELKDVAG-GKVNQAHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+IS PLTM +
Sbjct  426  AVLMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVISKPLTMGA  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  486  FGDVLAVPSYDTI  498



>emb|CDY22877.1| BnaA06g02000D [Brassica napus]
Length=504

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  309  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +S +F++KA+++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  368  SCTAFTSIFNNTGLFGIYGCSSPEFAAKAIELAAKELKDVAG-GKVNQKHLDRAKAATKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQ LTYGERKPVE FLK ++ ++ KDI     K+IS PLTM S
Sbjct  427  AVLMNLESRMIAAEDIGRQTLTYGERKPVEQFLKTVDGLTLKDITDFTSKIISKPLTMGS  486

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSYDTV
Sbjct  487  FGEVLSVPSYDTV  499



>ref|XP_010479701.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Camelina sativa]
Length=503

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY QV 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQQVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +S +F++ A+++A KEL  +A  G+V+QQ LDRAK ATKS
Sbjct  367  SCTAFTSIFNNTGLFGIYGCSSPEFAATAIELAAKELKDVAG-GKVNQQHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+IS PLTM +
Sbjct  426  AVLMNLESRMIEAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVISKPLTMGA  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  486  FGDVLTVPSYDTI  498



>ref|XP_010487509.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 [Camelina sativa]
Length=501

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEYP+V 
Sbjct  306  THFALAFEVPG-WNNEKEAIIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYPEVQ  364

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSS+FN+TGLFGI   TS  F+S+ + +   E+  +A  G VDQ+ LDRAK ATKS
Sbjct  365  SCTAFSSVFNNTGLFGIYGCTSPGFASEGIKLVAAEIKDVAE-GRVDQKHLDRAKAATKS  423

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+A+EDIGRQILTYGERKPV+ FL  ++E++ KDIA    K+I+ PLTMAS
Sbjct  424  AILMNLESRMIAAEDIGRQILTYGERKPVDQFLNTVDELTLKDIADFTSKVITKPLTMAS  483

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSYD+V
Sbjct  484  FGEVLNVPSYDSV  496



>ref|XP_006307303.1| hypothetical protein CARUB_v10008921mg [Capsella rubella]
 gb|EOA40201.1| hypothetical protein CARUB_v10008921mg [Capsella rubella]
Length=503

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY +V 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN TGLFGI   +S  F++KA+++A KEL  +A+ G+V+Q+ LDRAK ATKS
Sbjct  367  SCTAFTSIFNDTGLFGIYGCSSPGFAAKAIELAAKELKDVAN-GKVNQKHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPV+ FLK +++++ KDI     K+IS PLTM +
Sbjct  426  AVLMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIQDFTSKVISKPLTMGA  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  486  FGDVLSVPSYDTI  498



>ref|XP_006299456.1| hypothetical protein CARUB_v10015621mg [Capsella rubella]
 gb|EOA32354.1| hypothetical protein CARUB_v10015621mg [Capsella rubella]
Length=501

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W  EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNE+P+V 
Sbjct  306  THFALAFEVPG-WDNEKEAIVATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEHPEVQ  364

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+S+FN+TGLFGI   TS DF+S  + +   E+ A+A  G V+Q+ LDRAK ATKS
Sbjct  365  SCTAFTSVFNNTGLFGIYGCTSPDFASTGIALVADEMKAVAE-GRVNQKHLDRAKAATKS  423

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+A+EDIGRQILTYGERKPV+ FLK I++++ KDIA    K+I+ PLTMAS
Sbjct  424  AILMNLESRMIAAEDIGRQILTYGERKPVDEFLKTIDQLNLKDIADFTSKVIAKPLTMAS  483

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSY++V
Sbjct  484  FGEVLNVPSYESV  496



>ref|XP_009147720.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Brassica rapa]
Length=506

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKG++S LYLR+LNEY QV 
Sbjct  311  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGVHSWLYLRILNEYQQVQ  369

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIF +TGLFGI   +S +F++KA+++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  370  SCTAFTSIFKNTGLFGIYGCSSPEFAAKAIELAAKELKDVAG-GKVNQKHLDRAKAATKS  428

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPVE FLK ++ ++ KDI     K+IS PLTM S
Sbjct  429  AVLMNLESRMIAAEDIGRQILTYGERKPVEQFLKTVDGLTLKDITDFTSKIISKPLTMGS  488

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSYDTV
Sbjct  489  FGEVLSVPSYDTV  501



>ref|XP_010462039.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 isoform X1 [Camelina sativa]
 ref|XP_010462040.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 isoform X2 [Camelina sativa]
Length=503

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY QV 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQQVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN+TGLFGI   +S +F++ A+++A KEL  +A  G+V+QQ LDRAK ATKS
Sbjct  367  SCTAFTSIFNNTGLFGIYGCSSPEFAATAIELAAKELKDVAG-GKVNQQHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            ++LMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDI     K+IS PLTM +
Sbjct  426  SVLMNLESRMIEAEDIGRQILTYGERKPVDQFLKTVDQLTLKDITDFTSKVISKPLTMGA  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDT+
Sbjct  486  FGDVLTVPSYDTI  498



>gb|EMS48740.1| Mitochondrial-processing peptidase subunit alpha [Triticum urartu]
Length=498

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGW++EK A+T+TVLQ LMG     + G     +YSRL LR+L+ Y Q+ 
Sbjct  300  THFALAFEVPGGWYEEKTAITVTVLQKLMGVDWFCTGGVGKG-LYSRLSLRILSHYHQIE  358

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+ I+N +G+FGI ATTS DF+SKAVD+A  EL  +A+PG V Q QLDRAK+A K 
Sbjct  359  SFSAFNRIYNYSGIFGILATTSPDFASKAVDLAAGELLEVATPGNVTQGQLDRAKRAAKC  418

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
             +LM+LESR VA EDIGRQ++TYGER+P+E FL  +E ++  DI+S A+ +IS+PLTMAS
Sbjct  419  KVLMDLESRAVACEDIGRQVMTYGEREPIEKFLNDVEAITLNDISSTAKNIISTPLTMAS  478

Query  422  YGDVLYLPSYDTV  384
            +GDV  +P+Y++V
Sbjct  479  WGDVTNVPTYESV  491



>gb|KJB83098.1| hypothetical protein B456_013G229300 [Gossypium raimondii]
Length=484

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGWHKEK+A+ LTVLQ+LMGGGGSFSAGGPGKGMYSRLY+RVLNEYPQV+
Sbjct  308  THFALAFELPGGWHKEKEAIILTVLQILMGGGGSFSAGGPGKGMYSRLYVRVLNEYPQVY  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N TG+FGIQATT SDF+  A+D+AVKEL A+A+PG+VDQ QLDRAKQ+TKS
Sbjct  368  SFSAFNSIYNHTGIFGIQATTGSDFAPTAIDVAVKELIAVATPGQVDQIQLDRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAI  495
            AILMNLESRMVASEDIG+Q+LTYGER    +F   +
Sbjct  428  AILMNLESRMVASEDIGKQVLTYGERYDFSNFFAVV  463



>ref|NP_566548.1| mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 sp|O04308.1|MPPA2_ARATH RecName: Full=Probable mitochondrial-processing peptidase subunit 
alpha-2; AltName: Full=Alpha-MPP 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB63629.1| mitochondrial processing peptidase alpha subunit precusor isolog 
[Arabidopsis thaliana]
 dbj|BAB01147.1| mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AAN13101.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
 gb|AEE75825.1| mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
Length=499

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LN++ Q  
Sbjct  304  THFALAFEVPG-WNNEKEAIIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRLLNQHQQFQ  362

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+S+FN+TGLFGI   TS +F+S+ +++   E+ A+A  G+V+Q+ LDRAK ATKS
Sbjct  363  SCTAFTSVFNNTGLFGIYGCTSPEFASQGIELVASEMNAVAD-GKVNQKHLDRAKAATKS  421

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+A+EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTMA+
Sbjct  422  AILMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVITKPLTMAT  481

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYD+V
Sbjct  482  FGDVLNVPSYDSV  494



>emb|CBI30865.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH  LAFE+PGGWH EK+A+TLTVLQ+LMGGGGSFS GGPGKGM+SRLYLRVLNEY Q+
Sbjct  185  ITHLVLAFEVPGGWHNEKEAITLTVLQILMGGGGSFSTGGPGKGMHSRLYLRVLNEYQQL  244

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF++IFN+T +FGI A+T SDF +KA+DIAV EL +I SPG+VDQ QL RAK+ATK
Sbjct  245  QSFSAFNNIFNNTRIFGIYASTGSDFVAKAIDIAVGELLSIVSPGQVDQVQLTRAKEATK  304

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSA  480
            SA+LMNLESRM+ASEDIGRQILTYGERKP+EHFLKA++E+ A
Sbjct  305  SAVLMNLESRMIASEDIGRQILTYGERKPLEHFLKAVDEIKA  346



>ref|XP_006392973.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
 gb|ESQ30259.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
Length=502

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  307  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSSIFN TGLFGI   +S +F++ A+ +A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFSSIFNDTGLFGIYGCSSPEFAANAIALAAKELKDVAG-GKVNQKHLDRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQ+LTYGERKPVE FLK +++++ KDIA    K+IS PLTM S
Sbjct  425  AVLMNLESRMIAAEDIGRQLLTYGERKPVEQFLKTVDQLTLKDIADFTGKIISKPLTMGS  484

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYDTV
Sbjct  485  FGDVLAVPSYDTV  497



>ref|XP_002987658.1| hypothetical protein SELMODRAFT_126515, partial [Selaginella 
moellendorffii]
 gb|EFJ11233.1| hypothetical protein SELMODRAFT_126515, partial [Selaginella 
moellendorffii]
Length=495

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW  E D+  +TVLQ L+GGGGSFS+GGPGKGMYSRLY RVLN Y +V 
Sbjct  298  THIALAFEVPGGWRNEHDSFAVTVLQTLLGGGGSFSSGGPGKGMYSRLYTRVLNHYDKVQ  357

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +F+AF+SI+N TG+FGI AT++SDF    +D+A  ELT +A+ GEV +++L+RAK AT S
Sbjct  358  SFTAFNSIYNDTGIFGIHATSTSDFVPNLIDLATDELTTVATAGEVTEEELERAKNATIS  417

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+V +EDIGRQILTYG+RKP++ F+ A++ ++ ++I S A KL+SSPLTMAS
Sbjct  418  AVLMNLESRVVVTEDIGRQILTYGKRKPIQDFISAVQGLTLENITSTASKLLSSPLTMAS  477

Query  422  YGDVLYLPSYDTV  384
            +GDV+++P Y+ V
Sbjct  478  WGDVVHVPRYEEV  490



>ref|XP_002987595.1| hypothetical protein SELMODRAFT_183257 [Selaginella moellendorffii]
 gb|EFJ11431.1| hypothetical protein SELMODRAFT_183257 [Selaginella moellendorffii]
Length=506

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW  E D+  +TVLQ L+GGGGSFS+GGPGKGMYSRLY RVLN Y +V 
Sbjct  308  THIALAFEVPGGWRNEHDSFAVTVLQTLLGGGGSFSSGGPGKGMYSRLYTRVLNHYDKVQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +F+AF+SI+N TG+FGI AT++SDF    +D+A  ELT +A+ GEV +++L+RAK AT S
Sbjct  368  SFTAFNSIYNDTGIFGIHATSTSDFVPNLIDLATDELTTVATGGEVTEEELERAKNATIS  427

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+V +EDIGRQILTYG+RKP++ F+ A++ ++ ++I S A KL+SSPLTMAS
Sbjct  428  AVLMNLESRVVVTEDIGRQILTYGKRKPIQDFISAVQGLTLENITSTASKLLSSPLTMAS  487

Query  422  YGDVLYLPSYDTV  384
            +GDV+++P Y+ V
Sbjct  488  WGDVVHVPRYEEV  500



>gb|ERN16185.1| hypothetical protein AMTR_s00030p00236070, partial [Amborella 
trichopoda]
Length=496

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T+ AL FE+PGGW  EKDA+   VLQ LMGGGGSFSAGGPGKGM+SRLY+RVLNEY Q+ 
Sbjct  314  TYVALVFEVPGGWRDEKDAIITIVLQNLMGGGGSFSAGGPGKGMHSRLYIRVLNEYQQIQ  373

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFS+++N TGLFGI+A+T SDF ++AVDIA +EL AIA+PG+V + +L RAK +TKS
Sbjct  374  SFSAFSTVYNDTGLFGIRASTGSDFVAEAVDIAAEELIAIATPGKVKEVELIRAKNSTKS  433

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRMV +EDIGRQILTYG RK VEHFLKA++ ++  D+++ A K++SSP+TM S
Sbjct  434  AVLMNLESRMVVTEDIGRQILTYGCRKHVEHFLKAVDAITLDDLSATAHKILSSPVTMGS  493

Query  422  YGD  414
            +GD
Sbjct  494  WGD  496



>gb|AAK59675.1| putative mitochondrial processing peptidase alpha subunit [Arabidopsis 
thaliana]
Length=499

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = -2

Query  959  HFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHA  780
            HFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LN++ Q  +
Sbjct  305  HFALAFEVPG-WNNEKEAIIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRLLNQHQQFQS  363

Query  779  FSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSA  600
             +AF+S+FN+TGLFGI   TS +F+S+ +++   E+ A+A  G+V+Q+ LDRAK ATKSA
Sbjct  364  CTAFTSVFNNTGLFGIYGCTSPEFASQGIELVASEMNAVAD-GKVNQKHLDRAKAATKSA  422

Query  599  ILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASY  420
            ILMNLESRM+A+EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTMA++
Sbjct  423  ILMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVITKPLTMATF  482

Query  419  GDVLYLPSYDTV  384
            GDVL +PSYD+V
Sbjct  483  GDVLNVPSYDSV  494



>ref|XP_004287497.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Fragaria vesca subsp. vesca]
Length=524

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 158/193 (82%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW + KDAM L VLQMLMGGG SFS+GGPGKGM SRLY+ VL + P+V 
Sbjct  315  THFALAFELPGGWLRMKDAMILNVLQMLMGGGESFSSGGPGKGMNSRLYIHVLAQNPEVK  374

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SA +SI+N++ +FGIQA+ SSD+ ++A+DIA  EL A+A+PGEVD  QLDRAKQ+TKS
Sbjct  375  SISAINSIYNNSAIFGIQASASSDYVAEAIDIAADELVALATPGEVDVVQLDRAKQSTKS  434

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            +ILM++ESRMV  +DIG+QILTY + K +E  +KA++EVS +DI S  QKL+S+PLTMAS
Sbjct  435  SILMHMESRMVVVDDIGKQILTYNDWK-LEQLMKAVDEVSMEDITSTTQKLLSTPLTMAS  493

Query  422  YGDVLYLPSYDTV  384
            YGDV  +P YD V
Sbjct  494  YGDVTKVPRYDLV  506



>ref|XP_008354423.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Malus domestica]
Length=514

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 159/196 (81%), Gaps = 4/196 (2%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFELPGGW  EKDAM + VLQ+LMGGGGSFSAGGPGKGM+SRLY RVLN     H
Sbjct  313  THFALAFELPGGWRNEKDAMIVNVLQVLMGGGGSFSAGGPGKGMHSRLYSRVLNRCSAFH  372

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +  AFSS++N+TG+FGIQA+T+ DF + A+D+A  EL AIA+PG+VDQ +LDRAK++TK 
Sbjct  373  SILAFSSLYNNTGIFGIQASTAPDFVATAIDMAANELIAIATPGDVDQVELDRAKKSTKX  432

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            +ILMNLESR V ++DIGRQILTY + K +   LKA++EVS +DIASI QKL+SSPL MA+
Sbjct  433  SILMNLESRTVVADDIGRQILTYNDWK-LSQLLKAVDEVSLEDIASIGQKLLSSPLXMAT  491

Query  422  YGD---VLYLPSYDTV  384
            YGD   V  + SYD+V
Sbjct  492  YGDFTSVTGVSSYDSV  507



>ref|XP_010545654.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-1 [Tarenaya hassleriana]
Length=502

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 164/193 (85%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG WH EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLRVLNEY QV 
Sbjct  307  THFALAFEVPG-WHNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRVLNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSSIFN+TGLFGI   +S +F++KAV++A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFSSIFNNTGLFGIYGCSSPEFAAKAVEVAAKELKDVAG-GKVNQKHLDRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTMAS
Sbjct  425  AILMNLESRMIVAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKIIAKPLTMAS  484

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +P+YDTV
Sbjct  485  FGDVMGVPTYDTV  497



>gb|EAY77359.1| hypothetical protein OsI_05342 [Oryza sativa Indica Group]
Length=434

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW +E+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVL +Y  V
Sbjct  237  MTHVALAFEVPGGWLEERDATIMTVVQTLMGGGGSFSSGGPGKGMHSRLYLRVLTKYHTV  296

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FS FS+ F+ +GLFGI  TT SDF +KAVDIA KEL AIA+PG+V   +L RAK +T 
Sbjct  297  ESFSVFSNAFDRSGLFGIYLTTPSDFVAKAVDIATKELIAIATPGQVTDIELARAKNSTI  356

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESR++ +EDIGRQILTYG RKPV+HFL+ ++E++  DI + A+K++SSP TMA
Sbjct  357  SAVLMNLESRVIVAEDIGRQILTYGCRKPVDHFLQCMDEMTLDDITAFAKKMLSSPPTMA  416

Query  425  SYGDVLYLPSYDTV  384
            S+GDV  +P Y+ V
Sbjct  417  SWGDVDKVPPYEFV  430



>ref|XP_010504356.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 isoform X1 [Camelina sativa]
Length=502

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYL +LN+YP+V 
Sbjct  306  THFALAFEVPG-WNNEKEAIIATVLQMLMGGGGSFSAGGPGKGMHSSLYLNILNKYPEVQ  364

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSS+FN+TGLFGI   TS  F+S+ + +   E+  +A    VDQ+ LDRAK ATKS
Sbjct  365  SCTAFSSVFNNTGLFGIYGCTSPGFASEGIQLVAAEIENVAGGYSVDQKHLDRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+A+EDIGRQILTYGERK V+ FL  ++E++ +DIA    K+I+ PLTMAS
Sbjct  425  AILMNLESRMIAAEDIGRQILTYGERKSVDQFLNTVDELTLQDIADFTSKVITKPLTMAS  484

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSYD+V
Sbjct  485  FGEVLNVPSYDSV  497



>gb|KFK38993.1| hypothetical protein AALP_AA3G186200 [Arabis alpina]
Length=503

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W  EK+A T  VLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  308  THFALAFEVPG-WDNEKEAETAIVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SI+N+TGLFGI   TS + +++ + +   E+ A+A  G+VDQ+ LDRAK ATKS
Sbjct  367  SCTAFTSIYNNTGLFGIYGCTSPEHAAEGIKLVADEMKAVAE-GKVDQKHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLES+M+ASEDIGRQILTYGERKP++ FL+ +++++ KDIA    K+I+ PLT+AS
Sbjct  426  AILMNLESQMIASEDIGRQILTYGERKPMDQFLQTVDQLTLKDIADFTSKVIAKPLTLAS  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +PSYD+V
Sbjct  486  FGDVLSVPSYDSV  498



>ref|NP_001045501.1| Os01g0966300 [Oryza sativa Japonica Group]
 dbj|BAD88255.1| putative mitochondrial processing peptidase [Oryza sativa Japonica 
Group]
 dbj|BAF07415.1| Os01g0966300 [Oryza sativa Japonica Group]
 gb|EAZ14954.1| hypothetical protein OsJ_04885 [Oryza sativa Japonica Group]
 dbj|BAG93327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW +E+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVL +Y  V
Sbjct  293  MTHVALAFEVPGGWLEERDATIMTVVQTLMGGGGSFSSGGPGKGMHSRLYLRVLTKYHTV  352

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FS FS+ F+ +GLFGI  TT SDF +KAVDIA KEL AIA+PG+V   +L RAK +T 
Sbjct  353  ESFSVFSNAFDRSGLFGIYLTTPSDFVAKAVDIATKELIAIATPGQVTDIELARAKNSTI  412

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESR++ +EDIGRQILTYG RKPV+HFL+ ++E++  DI + A+K++SSP TMA
Sbjct  413  SAVLMNLESRVIVAEDIGRQILTYGCRKPVDHFLQCMDEMTLDDITAFAKKMLSSPPTMA  472

Query  425  SYGDVLYLPSYDTV  384
            S+GDV  +P Y+ V
Sbjct  473  SWGDVDKVPPYEFV  486



>ref|XP_006406832.1| hypothetical protein EUTSA_v10020561mg [Eutrema salsugineum]
 gb|ESQ48285.1| hypothetical protein EUTSA_v10020561mg [Eutrema salsugineum]
Length=503

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAF +PG W  EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY Q  
Sbjct  308  THFALAFGVPG-WDNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQFQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN++GLFGI   TS +F+++ +++   E+ A+A  G+V+Q+ LDRAK ATKS
Sbjct  367  SCTAFTSIFNNSGLFGIYGCTSPEFAARGIELVADEMKAVAE-GKVNQKHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTMAS
Sbjct  426  AILMNLESRMIVAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVIAKPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G VL +PSYD V
Sbjct  486  FGQVLSVPSYDAV  498



>ref|XP_001759462.1| predicted protein [Physcomitrella patens]
 gb|EDQ75764.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH A+AFE+PGGW  EKD+  +TVLQ L+GGGGSFSAGGPGKGMYSRLY  +LN++ QV 
Sbjct  315  THVAIAFEVPGGWRNEKDSYAVTVLQTLLGGGGSFSAGGPGKGMYSRLYTGILNKWEQVQ  374

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +F+AF+S++N TGLFGI AT++ DF  K VD+A ++L  +A+PG+V + +L RAK +T S
Sbjct  375  SFTAFNSVYNDTGLFGIHATSTGDFVPKLVDLACEQLELVATPGKVTEAELQRAKNSTIS  434

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESR+V +EDIGRQILTYG RKPV  F+++++ ++ +DIA ++ K+IS+PLTMAS
Sbjct  435  AVLMNLESRVVVTEDIGRQILTYGHRKPVAEFIQSVQALTLQDIADVSSKIISTPLTMAS  494

Query  422  YGDVLYLPSYDTV  384
            +GDV+ +P +D V
Sbjct  495  WGDVVRVPRFDAV  507



>ref|XP_010504362.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 isoform X2 [Camelina sativa]
Length=501

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYL +LN+YP+V 
Sbjct  306  THFALAFEVPG-WNNEKEAIIATVLQMLMGGGGSFSAGGPGKGMHSSLYLNILNKYPEVQ  364

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSS+FN+TGLFGI   TS  F+S+ + +   E+  +A  G  DQ+ LDRAK ATKS
Sbjct  365  SCTAFSSVFNNTGLFGIYGCTSPGFASEGIQLVAAEIENVAG-GYFDQKHLDRAKAATKS  423

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+A+EDIGRQILTYGERK V+ FL  ++E++ +DIA    K+I+ PLTMAS
Sbjct  424  AILMNLESRMIAAEDIGRQILTYGERKSVDQFLNTVDELTLQDIADFTSKVITKPLTMAS  483

Query  422  YGDVLYLPSYDTV  384
            +G+VL +PSYD+V
Sbjct  484  FGEVLNVPSYDSV  496



>ref|XP_001765307.1| predicted protein [Physcomitrella patens]
 gb|EDQ70035.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 157/194 (81%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            ++H A+AFE+PGGW  EKD+  +TVLQ L+GGGGSFSAGGPGKGMYSRLY  VLN++ QV
Sbjct  314  LSHIAIAFEVPGGWRNEKDSYAVTVLQQLLGGGGSFSAGGPGKGMYSRLYTGVLNKWEQV  373

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +F+AFSSI+N TGLFGI AT+S DF  K VD+A ++LT +A+PG+V + +L RAK +T 
Sbjct  374  QSFTAFSSIYNDTGLFGIHATSSGDFVPKLVDLACEQLTLVATPGKVSEAELQRAKNSTI  433

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+LMNLESR V +EDIGRQILTYG RKPV   ++ ++ ++ +DIA ++ ++I++PLTMA
Sbjct  434  SAVLMNLESRAVVTEDIGRQILTYGHRKPVAELIQGVQALTVQDIADVSSRVITTPLTMA  493

Query  425  SYGDVLYLPSYDTV  384
            S+GD++ +P +D V
Sbjct  494  SWGDIVRVPRFDAV  507



>ref|XP_004971384.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Setaria italica]
Length=495

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW +E+DA  +T++Q LMGGGGSFS+GGPGKGM+SRLYLRVLN+Y  V
Sbjct  297  MTHVALAFEVPGGWLQERDATIMTIIQTLMGGGGSFSSGGPGKGMHSRLYLRVLNKYHAV  356

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAFS+++++TGLFGI  TTSSDF +KAVD+A+ EL A+A+PGEV + +L RAK +T 
Sbjct  357  QSFSAFSNVYDNTGLFGIYLTTSSDFVAKAVDVAISELIAVATPGEVTEVELQRAKNSTI  416

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR++ +EDIGRQ+LTYG RKP+++FL+ +EE++  DI + A+K++SS  T  
Sbjct  417  SSVLMNLESRVIVAEDIGRQLLTYGCRKPIDYFLQCMEEITLDDITTFARKMLSSQPTTV  476

Query  425  SYGDVLYLPSYDTV  384
            S+GDV  +P Y+ V
Sbjct  477  SWGDVDKVPPYEFV  490



>ref|XP_002883011.1| mppalpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59270.1| mppalpha [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 160/204 (78%), Gaps = 13/204 (6%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRL-----------Y  816
            THFALAFE+PG W+ E +A+  TVLQMLMGGGGSFSAGGPGKGM+SRL           +
Sbjct  308  THFALAFEVPG-WNNETEAIIATVLQMLMGGGGSFSAGGPGKGMHSRLCKSLNVFSFYLH  366

Query  815  LRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQ  636
            L +LN++ Q  + +AF+S+FN+TGLFGI   TS DF+S+ +++   E+  +A  G V+Q+
Sbjct  367  LNILNQHQQFQSCTAFTSVFNNTGLFGIYGCTSPDFASQGIELVATEMYGVAG-GAVNQK  425

Query  635  QLDRAKQATKSAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQ  456
             LDRAK ATKSAILMNLESRM+A+EDIGRQILTYGERKPV+HFLK +++++ KDIA    
Sbjct  426  HLDRAKAATKSAILMNLESRMIAAEDIGRQILTYGERKPVDHFLKTVDQLTLKDIADFTS  485

Query  455  KLISSPLTMASYGDVLYLPSYDTV  384
            K+I+ PLTMAS+GDVL +PSYD+V
Sbjct  486  KVITKPLTMASFGDVLNVPSYDSV  509



>dbj|BAE98617.1| hypothetical protein [Arabidopsis thaliana]
Length=494

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 154/184 (84%), Gaps = 2/184 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY +V 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN TGLFGI   +S  F++KA+++A KEL  +A  G+V+Q  LDRAK ATKS
Sbjct  367  SCTAFTSIFNDTGLFGIYGCSSPQFAAKAIELAAKELKDVAG-GKVNQAHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLESRM+A+EDIGRQILTYGERKPV+ FLK++++++ KDIA    K+IS PLTM S
Sbjct  426  AVLMNLESRMIAAEDIGRQILTYGERKPVDQFLKSVDQLTLKDIADFTSKVISKPLTMGS  485

Query  422  YGDV  411
            +GDV
Sbjct  486  FGDV  489



>ref|XP_002457003.1| hypothetical protein SORBIDRAFT_03g047030 [Sorghum bicolor]
 gb|EES02123.1| hypothetical protein SORBIDRAFT_03g047030 [Sorghum bicolor]
Length=489

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW +E+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVLN+Y  V
Sbjct  291  MTHVALAFEVPGGWLQERDATIMTVIQTLMGGGGSFSSGGPGKGMHSRLYLRVLNKYHSV  350

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAFS++++S+GLFGI  TT SDF +KAVDIA+ EL A+A+PGEV + +L RAK +T 
Sbjct  351  ESFSAFSNVYDSSGLFGIYLTTPSDFVAKAVDIAISELVAVATPGEVTEVELQRAKNSTI  410

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR+V +EDIGRQ+L+YG RKP+++FL+ +EE++  D+A+ A+K+++S  TM 
Sbjct  411  SSVLMNLESRVVVAEDIGRQMLSYGCRKPIDYFLQCMEEITLDDVATFARKMLASQPTMV  470

Query  425  SYGDVLYLPSYDTV  384
            S+G+V  +P Y+ +
Sbjct  471  SWGNVDKVPPYEFI  484



>ref|XP_006595117.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Glycine max]
Length=470

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 151/194 (78%), Gaps = 21/194 (11%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            V   A+AFE+PGGW KEK+A+ LT+LQMLMGGGGSFSAGGPGKGM+SRL+LRVLNE+ Q+
Sbjct  291  VARVAIAFEVPGGWKKEKEAIALTILQMLMGGGGSFSAGGPGKGMHSRLFLRVLNEHQQI  350

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H+FSAF+S+FN+TGLFGI A+T SDF +KAVD+A +EL AIASPG+V Q           
Sbjct  351  HSFSAFNSLFNNTGLFGIYASTGSDFVAKAVDLAARELIAIASPGQVTQ-----------  399

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
                      M+ASEDIGRQ+LTYGERKP+E FL A++ ++  DI  I+QK+ISSPLTMA
Sbjct  400  ----------MIASEDIGRQVLTYGERKPLEQFLNAVDGITLNDITKISQKIISSPLTMA  449

Query  425  SYGDVLYLPSYDTV  384
            SYGDV  +P Y++V
Sbjct  450  SYGDVFNVPCYESV  463



>dbj|BAJ89700.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW KE+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVL +Y  V
Sbjct  298  MTHVALAFEVPGGWLKERDATIMTVIQTLMGGGGSFSSGGPGKGMHSRLYLRVLTKYHDV  357

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             AFSAFS+++++TGLFGI  TT   F +KAVD+AV+EL AIA+PG+V + +L RAK +T 
Sbjct  358  QAFSAFSNLYDNTGLFGIYLTTPPYFVAKAVDVAVQELIAIATPGQVTEVELRRAKNSTI  417

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR++ +EDIGRQ+LTYG RKP++HFL+ ++E++  D+ S ++ L+SS  TMA
Sbjct  418  SSVLMNLESRVIVAEDIGRQLLTYGCRKPIDHFLQCMDELTLNDVTSFSKMLLSSQPTMA  477

Query  425  SYGDVLYLPSYDTV  384
            SYGDV  +P Y+ V
Sbjct  478  SYGDVDKVPPYEFV  491



>emb|CDJ26330.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW KE++A  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVL +Y  V
Sbjct  302  MTHVALAFEVPGGWLKEREATIMTVIQTLMGGGGSFSSGGPGKGMHSRLYLRVLTKYHGV  361

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAFS+++++TGLFGI  TT  DF SKAV IAV+EL AIA+PG+V + +L RAK +T 
Sbjct  362  QSFSAFSNVYDNTGLFGIYLTTPPDFVSKAVVIAVQELIAIATPGQVTEVELTRAKNSTI  421

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR++ +EDIGRQ+LTYG RKP++HFL+ +EE++  D+ + A+ ++SS  TMA
Sbjct  422  SSVLMNLESRVIVAEDIGRQLLTYGSRKPIDHFLQCMEELTLDDVTAFAKMMLSSQPTMA  481

Query  425  SYGDVLYLPSYD  390
            SYGDV  +P Y+
Sbjct  482  SYGDVNKVPPYE  493



>ref|XP_009146083.1| PREDICTED: probable mitochondrial-processing peptidase subunit 
alpha-2 [Brassica rapa]
Length=495

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFAL+F +PG W KEK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLRVLN+Y +  
Sbjct  300  THFALSFGVPG-WDKEKEAVMATVLQMLMGGGGSFSAGGPGKGMHSWLYLRVLNQYQEFQ  358

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN++GLFGI   TS ++++K +++   E+ A+A  G+V+Q+ LDRAK ATKS
Sbjct  359  SCTAFTSIFNNSGLFGIYGCTSPEYAAKGIELVADEMKAVAE-GKVNQKHLDRAKAATKS  417

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTM S
Sbjct  418  AILMNLESRMIVAEDIGRQILTYGERKPVDAFLKTVDQLTLKDIADFTSKIIAKPLTMGS  477

Query  422  YGDVLYLPSYDTV  384
             G VL +PSYD+V
Sbjct  478  LGAVLNVPSYDSV  490



>emb|CDX92075.1| BnaA05g23320D [Brassica napus]
Length=495

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFAL+F +PG W KEK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLRVLN+Y +  
Sbjct  300  THFALSFGVPG-WDKEKEAVMATVLQMLMGGGGSFSAGGPGKGMHSWLYLRVLNQYQEFQ  358

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN++GLFGI   TS ++++K +++   E+ A+A  G+V+Q+ LDRAK ATKS
Sbjct  359  SCTAFTSIFNNSGLFGIYGCTSPEYAAKGIELVADEMKAVAE-GKVNQKHLDRAKAATKS  417

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTM S
Sbjct  418  AILMNLESRMIVAEDIGRQILTYGERKPVDAFLKTVDQLTLKDIADFTSKIIAKPLTMGS  477

Query  422  YGDVLYLPSYDTV  384
             G VL +PSYD+V
Sbjct  478  LGAVLNVPSYDSV  490



>ref|NP_001167727.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
 gb|ACN25901.1| unknown [Zea mays]
 tpg|DAA55705.1| TPA: putative mitochondrial processing peptidase alpha subunit 
family protein [Zea mays]
Length=488

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW +E+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLY RVLN+Y  V
Sbjct  290  MTHVALAFEVPGGWLQERDATIMTVIQTLMGGGGSFSSGGPGKGMHSRLYRRVLNKYHLV  349

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+++++S+GLFGI  TT SDF +KAVDIAV EL A+A+PGEV + +L RAK +T 
Sbjct  350  DSFSAFNNVYDSSGLFGIYLTTPSDFVAKAVDIAVSELIAVATPGEVTEVELQRAKNSTI  409

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR+V +EDIGRQ+L+YG RKP+++FL+ +EE++  D+A+ A+K++++  TMA
Sbjct  410  SSVLMNLESRVVVAEDIGRQLLSYGCRKPIDYFLQCMEEITLDDVATFARKMLATQPTMA  469

Query  425  SYGDVLYLPSYDTV  384
            S+G+V  +P Y+ +
Sbjct  470  SWGNVDKVPPYEFI  483



>gb|EMT01864.1| ABC transporter D family member 1 [Aegilops tauschii]
Length=1721

 Score =   229 bits (583),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -2

Query  965   VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
             +TH ALAFE+PGGW KE+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVL  Y  V
Sbjct  1520  MTHVALAFEVPGGWLKERDATIMTVIQTLMGGGGSFSSGGPGKGMHSRLYLRVLTRYHDV  1579

Query  785   HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
              +FSAFS++++STGLFGI  TT  DF +KAVDIAV+EL AIA+PG+V + +L RAK +T 
Sbjct  1580  QSFSAFSNVYDSTGLFGIYLTTPPDFVAKAVDIAVQELIAIATPGQVTEVELTRAKNSTI  1639

Query  605   SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
             S++LMNLESR++ +EDIGRQ+LTYG RKP++HFL+ +EE++  DI + A+ L+SS  TMA
Sbjct  1640  SSVLMNLESRVIVAEDIGRQLLTYGSRKPIDHFLQCMEELTLDDITAFAKMLLSSQPTMA  1699

Query  425   SYGDVLYLPSYDTV  384
             SYGDV  +P Y+ V
Sbjct  1700  SYGDVDKVPPYEFV  1713



>emb|CDY43102.1| BnaC05g36750D [Brassica napus]
Length=494

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFAL+F +PG W KEK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LN+Y +  
Sbjct  299  THFALSFGVPG-WDKEKEAVMATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNQYQEFQ  357

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+ IFN++GLFGI   TS ++++K +++   E+ A+A  G+V+Q+ LDRAK ATKS
Sbjct  358  SCTAFTGIFNNSGLFGIYGCTSPEYAAKGIELVADEMKAVAE-GKVNQKHLDRAKAATKS  416

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLESRM+ +EDIGRQILTYGERKPV+ FLK +++++ KDIA    K+I+ PLTM S
Sbjct  417  AILMNLESRMIVAEDIGRQILTYGERKPVDAFLKTVDQLTLKDIADFTSKIIAKPLTMGS  476

Query  422  YGDVLYLPSYDTV  384
             G VL +PSYD+V
Sbjct  477  LGAVLNVPSYDSV  489



>ref|XP_006645345.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Oryza brachyantha]
Length=489

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 157/194 (81%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW +E+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVL +Y  V
Sbjct  292  MTHVALAFEVPGGWLQERDATIMTVVQTLMGGGGSFSSGGPGKGMHSRLYLRVLTKYHTV  351

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAFS++F+ +GLFGI  TT  +F +KAVDIA KEL A+A+PG+V   +L RAK +T 
Sbjct  352  ESFSAFSNVFDRSGLFGIYLTTPPEFVAKAVDIATKELIALATPGQVTDIELKRAKNSTI  411

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            SA+L+NLESR++ +EDIGRQ+LTYG RKPV+HFL+ ++E++  DI   AQK++SS  T+A
Sbjct  412  SAVLLNLESRVIVAEDIGRQLLTYGCRKPVDHFLQCMDEITLDDITDFAQKMLSSQPTVA  471

Query  425  SYGDVLYLPSYDTV  384
            S+GDV  +P Y+ +
Sbjct  472  SWGDVDKVPPYEFI  485



>ref|NP_001150614.1| mitochondrial-processing peptidase alpha subunit [Zea mays]
 gb|ACG39762.1| mitochondrial-processing peptidase alpha subunit [Zea mays]
Length=505

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+P GW KEKD +T++VLQ L+GGGG FS G  GKG++SRL  R++NE+ Q+ 
Sbjct  307  TDVALAFEVPSGWLKEKDCVTVSVLQALLGGGGKFSWGRQGKGLHSRLN-RLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF  + ++TG+FGI  +T + F  KA+D+A +ELT++A+PG+VDQ QLDRAK + KS
Sbjct  366  SISAFKDVHSNTGIFGIHTSTDASFVPKAIDLAARELTSLATPGQVDQSQLDRAKASAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL NLES+   +ED+GRQ+L +GERKP EH LKA++ V+ KDI S+A+K+ISSPLTMAS
Sbjct  426  AILANLESQASLTEDMGRQVLAFGERKPAEHLLKAVDGVTMKDITSVAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+Y++V
Sbjct  486  HGNVLNMPTYESV  498



>ref|XP_001777355.1| predicted protein [Physcomitrella patens]
 gb|EDQ57885.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH A+AFE+PGGW  EKD+  +TVLQ L+GGG SFSAGGPGKGM+SRLY RVLN   QV
Sbjct  314  LTHVAIAFEVPGGWRNEKDSCAVTVLQSLLGGGASFSAGGPGKGMFSRLYTRVLNRREQV  373

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H+ +AF+SI+  TGL GI AT+S D+    VDI  +E+  +A+PGEV + +L RAK +  
Sbjct  374  HSCTAFNSIYRDTGLVGIHATSSGDYIPYLVDIMCQEINQVATPGEVTEAELHRAKNSAI  433

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S+ LMNLESR+V +EDIG QILTYG+RKPV  F++ I+ V+ +DIA +++K+ISSPLTMA
Sbjct  434  SSTLMNLESRVVITEDIGSQILTYGQRKPVAKFIQRIQAVTLEDIAEVSRKIISSPLTMA  493

Query  425  SYGDVLYLPSYDTV  384
            S+GDV+ +P YD V
Sbjct  494  SWGDVVQVPRYDAV  507



>ref|XP_001753960.1| predicted protein [Physcomitrella patens]
 gb|EDQ81282.1| predicted protein [Physcomitrella patens]
Length=474

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 149/193 (77%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T+ ALAFE+PGGW  EKD+  +TVLQ L+GGGGSFSAGGPGKGMYSRLY +VLN+Y QV 
Sbjct  277  TNIALAFEIPGGWRNEKDSFAVTVLQTLLGGGGSFSAGGPGKGMYSRLYSQVLNKYEQVQ  336

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +F+AF+ I+N  G+F I AT+ S+F    VD+A KE  A+A+PGEV + ++ RAK  T S
Sbjct  337  SFTAFNCIYNQPGIFCIHATSGSEFVPHLVDLATKEFIAVATPGEVTEAEIQRAKNMTIS  396

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            A+LMNLES +V +EDIGRQILTYG RKPV  F+  ++ ++  D++ +AQK+I +PLTMAS
Sbjct  397  AVLMNLESSVVVTEDIGRQILTYGNRKPVAEFIHGVQSLTLADLSRVAQKIIFTPLTMAS  456

Query  422  YGDVLYLPSYDTV  384
            +GDV  +P YD V
Sbjct  457  WGDVTQVPRYDQV  469



>gb|EAY72858.1| hypothetical protein OsI_00727 [Oryza sativa Indica Group]
Length=505

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+PGGW KEK+ +T++VLQ L+GGGG++S G  GKG++S L   + NE+ Q+ 
Sbjct  307  TDVALAFEVPGGWLKEKEFVTVSVLQTLLGGGGTYSWGRHGKGLHSSLN-HLANEFDQIR  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF  + ++TG+FGI  +T + F  KA+D+A +ELT++A+PG+VDQ QLDRAK   KS
Sbjct  366  SIAAFKDVHSNTGIFGIHTSTDAAFVPKAIDLATRELTSLATPGKVDQTQLDRAKATAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLES+  A+ED+GRQIL +GERKPVEH LKA++ V+ KDI ++A+K+ISSPLTMAS
Sbjct  426  AILMNLESKASATEDMGRQILAFGERKPVEHLLKAVDGVTLKDITALAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+YD+V
Sbjct  486  HGNVLNVPTYDSV  498



>ref|NP_001042272.1| Os01g0191500 [Oryza sativa Japonica Group]
 dbj|BAD72225.1| putative mitochondrial processing peptidase [Oryza sativa Japonica 
Group]
 dbj|BAF04186.1| Os01g0191500 [Oryza sativa Japonica Group]
 gb|EAZ10865.1| hypothetical protein OsJ_00704 [Oryza sativa Japonica Group]
 dbj|BAG92759.1| unnamed protein product [Oryza sativa Japonica Group]
Length=505

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+PGGW KEK+ +T++VLQ L+GGGG++S G  GKG++S L   + NE+ Q+ 
Sbjct  307  TDVALAFEVPGGWLKEKEFVTVSVLQTLLGGGGTYSWGRHGKGLHSSLN-HLANEFDQIR  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF  + ++TG+FGI  +T + F  KA+D+A +ELT++A+PG+VDQ QLDRAK   KS
Sbjct  366  SIAAFKDVHSNTGIFGIHTSTDAAFVPKAIDLATRELTSLATPGKVDQTQLDRAKATAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLES+  A+ED+GRQIL +GERKPVEH LKA++ V+ KDI ++A+K+ISSPLTMAS
Sbjct  426  AILMNLESKASATEDMGRQILAFGERKPVEHLLKAVDGVTLKDITALAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+YD+V
Sbjct  486  HGNVLNVPTYDSV  498



>gb|ACG24289.1| mitochondrial-processing peptidase alpha subunit [Zea mays]
Length=505

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 153/193 (79%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+P GW KEKD +T++VLQ L+GGGG FS G  GKG++SRL  R++NE+ Q+ 
Sbjct  307  TDVALAFEVPSGWLKEKDCVTVSVLQALLGGGGKFSWGRQGKGLHSRLK-RLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF  + ++TG+FGI  +T + F  KA+D+A +EL ++A+PG+VDQ QLDRAK + KS
Sbjct  366  SISAFKDVHSNTGIFGIHTSTDASFVPKAIDLAARELISLATPGQVDQSQLDRAKASAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL NLES+   +ED+GRQ+L +GERKP EH LKAI+ V+ KDI S+A+K+ISSPLTMAS
Sbjct  426  AILANLESQASLTEDMGRQVLAFGERKPAEHLLKAIDGVTMKDITSVAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+Y++V
Sbjct  486  HGNVLNMPTYESV  498



>ref|NP_001241707.1| putative mitochondrial processing peptidase alpha subunit family 
protein [Zea mays]
 gb|ACF85240.1| unknown [Zea mays]
 tpg|DAA53038.1| TPA: putative mitochondrial processing peptidase alpha subunit 
family protein [Zea mays]
Length=505

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 153/193 (79%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+P GW KEKD +T++VLQ L+GGGG FS G  GKG++SRL  R++NE+ Q+ 
Sbjct  307  TDVALAFEVPSGWLKEKDCVTVSVLQALLGGGGKFSWGRQGKGLHSRLN-RLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF  + ++TG+FGI  +T + F  KA+D+A +ELT++A+PG+VDQ QLDRAK + K 
Sbjct  366  SISAFKDVHSNTGIFGIHTSTDASFVPKAIDLAARELTSLATPGQVDQSQLDRAKASAKY  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL NLES+   +ED+GRQ+L +GERKP EH LKA++ V+ KDI S+A+K+ISSPLTMAS
Sbjct  426  AILANLESQASLTEDMGRQVLAFGERKPAEHLLKAVDGVTMKDITSVAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+Y++V
Sbjct  486  HGNVLNMPTYESV  498



>gb|ACN28785.1| unknown [Zea mays]
 tpg|DAA55703.1| TPA: putative mitochondrial processing peptidase alpha subunit 
family protein [Zea mays]
Length=489

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 161/194 (83%), Gaps = 2/194 (1%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH ALAFE+PGGW +E+DA  +TV+Q LMGGGGSFS+GGPGKGM+SRLY RVLN+Y  V
Sbjct  293  MTHVALAFEVPGGWLQERDATIMTVIQTLMGGGGSFSSGGPGKGMHSRLYRRVLNKYHLV  352

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF+++++S+GLFGI  TT SDF +KAVDIAV EL A+A+PGE  + +L RAK +T 
Sbjct  353  DSFSAFNNVYDSSGLFGIYLTTPSDFVAKAVDIAVSELIAVATPGE--EVELQRAKNSTI  410

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR+V +EDIGRQ+L+YG RKP+++FL+ +EE++  D+A+ A+K++++  TMA
Sbjct  411  SSVLMNLESRVVVAEDIGRQLLSYGCRKPIDYFLQCMEEITLDDVATFARKMLATQPTMA  470

Query  425  SYGDVLYLPSYDTV  384
            S+G+V  +P Y+ +
Sbjct  471  SWGNVDKVPPYEFI  484



>ref|XP_003564704.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Brachypodium distachyon]
Length=505

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+PGGW +EKD +T++VLQ L+GGGG FS G  GKG++SRL  R++NE+ Q+ 
Sbjct  307  TDVALAFEIPGGWLREKDFVTVSVLQTLLGGGGVFSWGRSGKGLHSRLN-RLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF  + ++TG+FGI  +T + F  KA+D+A +ELT++A+PG+VDQ QLDRAK + KS
Sbjct  366  SISAFKDVHSNTGIFGIHTSTEAAFVPKAIDLAARELTSLATPGQVDQTQLDRAKASAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL +LES+  A+ED+GRQ+L + +RKPVEH LK ++ V+ KD+++ A+K+ISSPLTMAS
Sbjct  426  AILTSLESKASATEDMGRQVLAFADRKPVEHLLKVLDGVTLKDVSTFAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+YDTV
Sbjct  486  HGNVLNVPTYDTV  498



>ref|XP_006583043.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Glycine max]
Length=454

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH A+AFE+PGGW KEKDA+ LTVLQMLMGGGGSFSAGGPGKGM+SRLYL VLNEY Q+ 
Sbjct  306  THVAIAFEVPGGWQKEKDAIALTVLQMLMGGGGSFSAGGPGKGMHSRLYLNVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A+TS DF  K VDIA KEL AIASPG+V Q QLDRAK++TKS
Sbjct  366  SFSAFNSIFNNTGLFGIYASTSPDFVPKTVDIAAKELIAIASPGQVTQVQLDRAKKSTKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGE  528
            A+LMNLESRM+ASEDIGRQILTYGE
Sbjct  426  AVLMNLESRMIASEDIGRQILTYGE  450



>ref|XP_002457199.1| hypothetical protein SORBIDRAFT_03g003160 [Sorghum bicolor]
 gb|EES02319.1| hypothetical protein SORBIDRAFT_03g003160 [Sorghum bicolor]
Length=505

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 152/193 (79%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+P GW KEKD +T +VLQ L+GGGG FS G  GKG++SRL   ++NE+ Q+ 
Sbjct  307  TDVALAFEVPSGWLKEKDFVTASVLQTLLGGGGKFSWGRQGKGLHSRLN-HLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF  + ++TG+FGI  +T + F  KA+D+A +ELT++A+PG+VDQ QLDRAK + KS
Sbjct  366  SISAFKDVHSNTGIFGIHTSTDASFVPKAIDLAARELTSLATPGQVDQSQLDRAKASAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL NLES+   +ED+GRQ+L +GERKP EH LKAI+ V+ KD+ S+A+K+ISSPLTMAS
Sbjct  426  AILANLESQASLTEDMGRQVLAFGERKPAEHLLKAIDGVTLKDVTSVAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+Y++V
Sbjct  486  HGNVLNMPTYESV  498



>gb|AAG42149.1| mitochondrial processing peptidase alpha-chain precursor [Dactylis 
glomerata]
Length=505

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFELPGGW KEKD +T +VLQ L+GGGG FS G PGKG++SRL   ++NE+ Q+ 
Sbjct  307  TEIALAFELPGGWLKEKDYVTASVLQALLGGGGLFSWGRPGKGLHSRLN-HLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF  + ++TG+FGI  +T + F+ KA+D+A +ELT++A+PG+VDQ QLDRAK   KS
Sbjct  366  SISAFKDVHSTTGIFGIHTSTDAAFAPKAIDLAARELTSLATPGQVDQTQLDRAKALAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL +LES+  A+ED+GRQ+L +GERKPVE  LK ++ VS KD++++A+K+ISSPLTMAS
Sbjct  426  AILASLESKASATEDMGRQVLAFGERKPVEQLLKIVDGVSLKDVSALAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +GDVL +P+Y+TV
Sbjct  486  HGDVLNVPAYETV  498



>ref|XP_006643862.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Oryza brachyantha]
Length=505

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+PGGW KEK+ +T++VLQ L+GGGG+FS G  GKG++SRL   + +E+ Q+ 
Sbjct  307  TDVALAFEVPGGWLKEKEFVTVSVLQTLLGGGGTFSWGRHGKGLHSRLN-HLSSEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF  + ++TG+FGI  +T + F  KA+D+  +ELT++A+PG+VDQ QLDRAK   KS
Sbjct  366  SIAAFKDVHSNTGIFGIHTSTDAAFVPKAIDLVTRELTSLATPGQVDQTQLDRAKATAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AILMNLES++ ASED+GRQ+L +GERKP EH LK ++ V+ KDI ++A+K+ISSPLTMAS
Sbjct  426  AILMNLESQVSASEDMGRQVLAFGERKPAEHLLKVVDGVTPKDITALAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+YD+V
Sbjct  486  HGNVLNVPTYDSV  498



>ref|XP_010233616.1| PREDICTED: ABC transporter D family member 1-like [Brachypodium 
distachyon]
Length=1985

 Score =   218 bits (554),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 159/194 (82%), Gaps = 0/194 (0%)
 Frame = -2

Query  965   VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
             +TH ALAFE+PGGW +E++A  +TV+Q LMGGGGSFS+GGPGKGM+SRLYLRVL +Y  V
Sbjct  1784  MTHVALAFEVPGGWLEERNATIMTVIQTLMGGGGSFSSGGPGKGMHSRLYLRVLTKYHAV  1843

Query  785   HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
              AFSAFS++++ +GLFGI  TT  DF  KAV++A++EL AIA+PG+V + +L RAK +T 
Sbjct  1844  QAFSAFSNVYDDSGLFGIYLTTPPDFVGKAVEVAMQELIAIATPGKVTEVELTRAKNSTI  1903

Query  605   SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
             S++LMNLESR++ +EDIGRQ+LTYG RKP++HFL+ ++E++  D+ + AQK++SS  TMA
Sbjct  1904  SSVLMNLESRVIVAEDIGRQLLTYGCRKPIDHFLQWMDEITLDDVTAFAQKMLSSQPTMA  1963

Query  425   SYGDVLYLPSYDTV  384
             S+GDV  +P Y+ V
Sbjct  1964  SWGDVNEVPPYEFV  1977



>ref|XP_004968500.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Setaria italica]
Length=505

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 154/193 (80%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFE+P GW KEKD +T++VLQ L+GGGG+FS G  GKG++SRL   ++NE+ Q+ 
Sbjct  307  TDVALAFEVPSGWLKEKDFVTVSVLQTLLGGGGTFSWGRQGKGLHSRLN-HLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF  + ++TG+FGI  +T + F  KA+D+A +EL ++A+PG+V+Q QLDRAK + KS
Sbjct  366  SISAFKDVHSNTGIFGIHTSTDASFVPKAIDLAARELISLATPGQVEQSQLDRAKASAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            AIL NLES+   +ED+GRQ+L +GERKPVEH LKA++ V+ KD+ ++A+K+ISSPLTMAS
Sbjct  426  AILANLESKASLTEDMGRQLLAFGERKPVEHLLKAVDGVTLKDVTAVAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+VL +P+Y++V
Sbjct  486  HGNVLNMPTYESV  498



>dbj|BAH57110.1| AT3G16480 [Arabidopsis thaliana]
Length=154

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -2

Query  833  MYSRLYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASP  654
            M+S LYLR+LN++ Q  + +AF+S+FN+TGLFGI   TS +F+S+ +++   E+ A+A  
Sbjct  1    MHSWLYLRLLNQHQQFQSCTAFTSVFNNTGLFGIYGCTSPEFASQGIELVASEMNAVAD-  59

Query  653  GEVDQQQLDRAKQATKSAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKD  474
            G+V+Q+ LDRAK ATKSAILMNLESRM+A+EDIGRQILTYGERKPV+ FLK +++++ KD
Sbjct  60   GKVNQKHLDRAKAATKSAILMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKD  119

Query  473  IASIAQKLISSPLTMASYGDVLYLPSYDTV  384
            IA    K+I+ PLTMA++GDVL +PSYD+V
Sbjct  120  IADFTSKVITKPLTMATFGDVLNVPSYDSV  149



>emb|CDM81679.1| unnamed protein product [Triticum aestivum]
Length=505

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 152/193 (79%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFELPGGW KEK+  T +VLQ L+GGGG F+ G PGKG++SRL   ++NE+ Q+ 
Sbjct  307  TDLALAFELPGGWLKEKEFATASVLQALLGGGGVFTWGRPGKGLHSRLN-PLVNEFDQIK  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF ++ ++TG+FGI A+T + F  K +D+A +ELT++A+PG+VDQ QLDRAK + KS
Sbjct  366  SISAFKNVHSNTGIFGIHASTEAAFVPKVIDLAARELTSLATPGQVDQTQLDRAKASAKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
             IL NLES+   +ED+GRQ L +GERKPVE  LKA++ ++  D++S+A+K+ISSPLTMAS
Sbjct  426  VILKNLESKASTTEDMGRQALAFGERKPVEQLLKAVDGITLADVSSVAEKIISSPLTMAS  485

Query  422  YGDVLYLPSYDTV  384
            +G+V+ +P+Y+TV
Sbjct  486  HGNVINVPAYETV  498



>ref|XP_010232284.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Brachypodium distachyon]
Length=477

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW++EK A+ +TVLQMLMGGGGSFSAGGPGKGM+SRLYLR+LN Y Q+ 
Sbjct  299  THVALAFEVPGGWYEEKTAIIVTVLQMLMGGGGSFSAGGPGKGMHSRLYLRILNHYQQIE  358

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SI+N +GLFGI ATTS DF+SKAVD+A  EL  +A+PG V Q+QLDRAKQATKS
Sbjct  359  SFSAFTSIYNHSGLFGIHATTSPDFASKAVDLAAGELLEVATPGNVTQEQLDRAKQATKS  418

Query  602  AILMNLESRMVASEDIGRQILTYGER  525
            A+LMNLESR VASED+GRQILTYGER
Sbjct  419  AVLMNLESRAVASEDMGRQILTYGER  444



>ref|XP_010655809.1| PREDICTED: uncharacterized protein LOC100255464 [Vitis vinifera]
Length=782

 Score =   209 bits (533),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH  LAFE+PGGWH EK+A+TLTVLQ+LMGGGGSFS GGPGKGM+SRLYLRVLNEY Q+
Sbjct  636  ITHLVLAFEVPGGWHNEKEAITLTVLQILMGGGGSFSTGGPGKGMHSRLYLRVLNEYQQL  695

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAF++IFN+T +FGI A+T SDF +KA+DIAV EL +I SPG+VDQ QL RAK+ATK
Sbjct  696  QSFSAFNNIFNNTRIFGIYASTGSDFVAKAIDIAVGELLSIVSPGQVDQVQLTRAKEATK  755

Query  605  SAILMNLESRMVASEDIGRQILTYGER  525
            SA+LMNLESRM+ASEDIGRQILTYGER
Sbjct  756  SAVLMNLESRMIASEDIGRQILTYGER  782



>ref|XP_008655316.1| PREDICTED: uncharacterized protein LOC100384208 isoform X1 [Zea 
mays]
Length=496

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 156/194 (80%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +T  ALAFE+PGGW +E+DA  +TV+Q LMGGGGSFS GGPGKGM+SRL LRVLN+Y  V
Sbjct  298  MTDVALAFEVPGGWFQERDAAIMTVIQTLMGGGGSFSTGGPGKGMHSRLSLRVLNKYHFV  357

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             + SAFS+++++TGLFGI  TTS    +KAVDIA+ EL A+A+PGEV + +L RAK +T 
Sbjct  358  ESLSAFSNVYDNTGLFGIYLTTSPYHVAKAVDIAISELIAVATPGEVTEVELRRAKNSTI  417

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR+V +EDIGRQ+L+YG RKP+++FL+ +E ++  D+A+ A+K+++S  TM 
Sbjct  418  SSVLMNLESRVVVAEDIGRQMLSYGSRKPMDNFLQRMEGITLDDVATFARKMLASRPTMV  477

Query  425  SYGDVLYLPSYDTV  384
            S+GDV  +P Y+++
Sbjct  478  SWGDVDKVPPYESI  491



>dbj|BAH20269.1| AT3G16480 [Arabidopsis thaliana]
Length=150

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  821  LYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVD  642
            LYLR+LN++ Q  + +AF+S+FN+TGLFGI   TS +F+S+ +++   E+ A+A  G+V+
Sbjct  1    LYLRLLNQHQQFQSCTAFTSVFNNTGLFGIYGCTSPEFASQGIELVASEMNAVAD-GKVN  59

Query  641  QQQLDRAKQATKSAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASI  462
            Q+ LDRAK ATKSAILMNLESRM+A+EDIGRQILTYGERKPV+ FLK +++++ KDIA  
Sbjct  60   QKHLDRAKAATKSAILMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADF  119

Query  461  AQKLISSPLTMASYGDVLYLPSYDTV  384
              K+I+ PLTMA++GDVL +PSYD+V
Sbjct  120  TSKVITKPLTMATFGDVLNVPSYDSV  145



>gb|KJB68194.1| hypothetical protein B456_010G231200 [Gossypium raimondii]
Length=430

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGW+ EKD + LTVLQMLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+H
Sbjct  285  THFALAFEVPGGWNNEKDTVALTVLQMLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIH  344

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI  +TSSDF S+AV+IA +EL  +A+ G V Q  + RA++ATKS
Sbjct  345  SFSAFNSIFNNTGLFGIYGSTSSDFVSRAVEIAAEELLVLATEGSVSQLMIKRAQEATKS  404

Query  602  AILMNLESRMVASEDIGRQILTYGER  525
            A+LMNLESRM+ +EDIGRQILTYGER
Sbjct  405  AVLMNLESRMIIAEDIGRQILTYGER  430



>ref|XP_002992589.1| hypothetical protein SELMODRAFT_448827 [Selaginella moellendorffii]
 gb|EFJ06291.1| hypothetical protein SELMODRAFT_448827 [Selaginella moellendorffii]
Length=512

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 147/193 (76%), Gaps = 0/193 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ++AFE+PGGW  E+DA+  TVLQ L+GGGGSFS+GGPGKG++SRLY RVL  +P+V 
Sbjct  315  TSVSIAFEIPGGWRNERDAVMATVLQSLLGGGGSFSSGGPGKGVHSRLYTRVLAVHPKVE  374

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
             F+AF+S++N TGLFGI A++   F  + VD+   EL ++A PGEVD+ +L+RAK AT S
Sbjct  375  NFTAFTSVYNDTGLFGIHASSEHKFVGELVDLIGDELISVAEPGEVDEIELERAKNATVS  434

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
             +LMNLESR+V +EDIGRQILTYG RKP + F+  + E++  DI  +A+K+IS+P+TMA 
Sbjct  435  LVLMNLESRVVVNEDIGRQILTYGCRKPAKEFIDTVRELTLDDIRKVAEKIISTPVTMAC  494

Query  422  YGDVLYLPSYDTV  384
            YGDV  +P  D V
Sbjct  495  YGDVKRVPLLDKV  507



>gb|KCW82289.1| hypothetical protein EUGRSUZ_C03704 [Eucalyptus grandis]
Length=451

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+ FELPGGWHKEK+AM LTVLQML+GGGGSFSAGGPGKGMYSRLYLRVLNEYPQV 
Sbjct  307  THFAVGFELPGGWHKEKEAMNLTVLQMLLGGGGSFSAGGPGKGMYSRLYLRVLNEYPQVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFS+I+N+TG+FGIQATT SDF+++A+DIA KEL A+A+PGEVDQ QLDRAKQ+T++
Sbjct  367  SFSAFSNIYNNTGIFGIQATTGSDFAAQAIDIAAKELIAVATPGEVDQVQLDRAKQSTRA  426

Query  602  AILMNLESRM  573
            AILMNLESR+
Sbjct  427  AILMNLESRV  436



>gb|KDO55872.1| hypothetical protein CISIN_1g0104472mg, partial [Citrus sinensis]
 gb|KDO55873.1| hypothetical protein CISIN_1g0104472mg, partial [Citrus sinensis]
 gb|KDO55874.1| hypothetical protein CISIN_1g0104472mg, partial [Citrus sinensis]
 gb|KDO55875.1| hypothetical protein CISIN_1g0104472mg, partial [Citrus sinensis]
Length=119

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  716  SDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSAILMNLESRMVASEDIGRQILT  537
            SDF SKA+D+A +EL ++A+PGEVDQ QLDRAKQ+TKSAILMNLESRMV SEDIGRQ+LT
Sbjct  2    SDFVSKAIDLAARELISVATPGEVDQVQLDRAKQSTKSAILMNLESRMVVSEDIGRQVLT  61

Query  536  YGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDVLYLPSYDTV  384
            YGERKPVEHFLK +E V+AKDIAS+AQKL+SSPLTMASYGDV+ +PSYD V
Sbjct  62   YGERKPVEHFLKTVEGVTAKDIASVAQKLLSSPLTMASYGDVINVPSYDAV  112



>ref|XP_006451348.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
 gb|ESR64588.1| hypothetical protein CICLE_v10008040mg [Citrus clementina]
Length=449

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THF LAFELPGGWHK+KDAMTLTVLQML+GGGGSFSAGGPGKGMYSRLY RVLNE+PQV
Sbjct  310  LTHFVLAFELPGGWHKDKDAMTLTVLQMLLGGGGSFSAGGPGKGMYSRLYRRVLNEFPQV  369

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             +FSAFS+I+N +G+FGIQ TT SDF SKA+D+A +EL ++A+PGEVDQ QLDRAKQ+TK
Sbjct  370  QSFSAFSNIYNHSGMFGIQGTTGSDFVSKAIDLAARELISVATPGEVDQVQLDRAKQSTK  429

Query  605  SAILMNLESRMV  570
            SAILMNLESR+ 
Sbjct  430  SAILMNLESRVC  441



>ref|XP_008799681.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
[Phoenix dactylifera]
Length=457

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGWH++KDA  LTVLQ LMGGGGSFSAGGPGKGM+SRLYLRVLN+Y QV 
Sbjct  312  THVALAFEVPGGWHQDKDATVLTVLQTLMGGGGSFSAGGPGKGMHSRLYLRVLNQYQQVQ  371

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAFSSI+N +GLFGI +TT SDF +KAVDIA  EL A+A+PG+V + +L RAK ATKS
Sbjct  372  SLSAFSSIYNDSGLFGIHSTTGSDFVAKAVDIAANELLAVATPGQVTEVELRRAKNATKS  431

Query  602  AILMNLESRMVASEDIGRQILTYGER  525
            A+LMNLESR + +EDIGRQILTYG R
Sbjct  432  AVLMNLESRAIVTEDIGRQILTYGCR  457



>ref|XP_006378186.1| hypothetical protein POPTR_0010s04610g [Populus trichocarpa]
 gb|ERP55983.1| hypothetical protein POPTR_0010s04610g [Populus trichocarpa]
Length=477

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAF L GGWH  K+AMTLTVLQ+LMGGGGSFSAGGPGKGMYSRLY RVLN+Y +V 
Sbjct  307  THFALAFGLKGGWHDVKEAMTLTVLQILMGGGGSFSAGGPGKGMYSRLYQRVLNQYHKVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAFS I+N + +FGIQATT +DF+S A+ +A +ELT +ASPG VD  QL RAKQ+TKS
Sbjct  367  SFSAFSHIYNHSAIFGIQATTDADFASSAIKLAARELTEVASPGAVDPVQLQRAKQSTKS  426

Query  602  AILMNLESRMVASEDIGRQILTYGER  525
            AILMNLESRMVASEDIGRQIL Y +R
Sbjct  427  AILMNLESRMVASEDIGRQILMYNKR  452



>ref|XP_002311791.2| hypothetical protein POPTR_0008s19750g, partial [Populus trichocarpa]
 gb|EEE89158.2| hypothetical protein POPTR_0008s19750g, partial [Populus trichocarpa]
Length=452

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAF L GGWH  K+A+TLTVLQ+LMGGGGSFSAGGPGKGMYSRLY RVLN Y ++ 
Sbjct  308  THFALAFGLKGGWHDVKEAITLTVLQVLMGGGGSFSAGGPGKGMYSRLYQRVLNRYHKIQ  367

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
             FSAF++I+N T +FGI+ATT +DF+S A+++ V+ELT +AS G VD  QL RAKQ+TKS
Sbjct  368  LFSAFNNIYNHTAIFGIEATTDADFASSAIELVVRELTEVASSGAVDPVQLQRAKQSTKS  427

Query  602  AILMNLESRMVASEDIGRQILTYGE  528
            AILMNLESRMV SEDIGRQILTY +
Sbjct  428  AILMNLESRMVVSEDIGRQILTYNK  452



>gb|EMS58411.1| Mitochondrial-processing peptidase subunit alpha [Triticum urartu]
Length=470

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 144/196 (73%), Gaps = 9/196 (5%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFELPGGW KEK+  T +VLQ L+GGGG F+ G PGKG++SRL   ++NE+ Q+ 
Sbjct  274  TDLALAFELPGGWLKEKEFATASVLQALLGGGGVFTWGRPGKGLHSRLN-PLVNEFDQIK  332

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF ++ ++TG+FGI  +T + F  K +D+A +ELT++A+PG+VDQ QLDRAK   KS
Sbjct  333  SISAFKNVHSNTGIFGIHTSTEAAFVPKVIDLAARELTSLATPGQVDQTQLDRAKAFAKS  392

Query  602  AILMNLESRMVASE---DIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLT  432
            AIL NLES+   S    DI     T G  KPVE  LKA++ ++  D++++A+K+ISSPLT
Sbjct  393  AILKNLESKKPGSPLSLDI-----TVGCWKPVEQLLKAVDAITLADVSTVAEKIISSPLT  447

Query  431  MASYGDVLYLPSYDTV  384
            MAS+G+VL +P+Y+TV
Sbjct  448  MASHGNVLNVPAYETV  463



>ref|XP_006595118.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X3 [Glycine max]
Length=443

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 129/194 (66%), Gaps = 48/194 (25%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            V   A+AFE+PGGW KEK+A+ LT+LQMLMGGGGSFSAGGPGKGM+SRL+LRVLNE+ Q+
Sbjct  291  VARVAIAFEVPGGWKKEKEAIALTILQMLMGGGGSFSAGGPGKGMHSRLFLRVLNEHQQI  350

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H+FSAF+S+FN+TGLFGI A+T                                      
Sbjct  351  HSFSAFNSLFNNTGLFGIYAST--------------------------------------  372

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
                      M+ASEDIGRQ+LTYGERKP+E FL A++ ++  DI  I+QK+ISSPLTMA
Sbjct  373  ----------MIASEDIGRQVLTYGERKPLEQFLNAVDGITLNDITKISQKIISSPLTMA  422

Query  425  SYGDVLYLPSYDTV  384
            SYGDV  +P Y++V
Sbjct  423  SYGDVFNVPCYESV  436



>gb|EMT19127.1| Mitochondrial-processing peptidase subunit alpha [Aegilops tauschii]
Length=702

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 145/195 (74%), Gaps = 9/195 (5%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            T  ALAFELPGGW KEK+  T +VLQ L+GGGG F+ G PGKG++SRL   ++NE+ Q+ 
Sbjct  323  TDLALAFELPGGWLKEKEFATASVLQALLGGGGVFTWGRPGKGLHSRLN-PLVNEFDQIK  381

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + SAF ++ ++TG+FGI  +T + F  K +D+A +ELT++A+PG+VDQ QLDRAK + KS
Sbjct  382  SISAFKNVHSNTGIFGIHTSTEAAFVPKVIDLAARELTSLATPGQVDQAQLDRAKASAKS  441

Query  602  AILMNLESRMVASE---DIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLT  432
            AIL NLES++  S    DI     T G  KPVE  LKA++ ++  D++++A+K+ISSPLT
Sbjct  442  AILKNLESKIPGSPLSLDI-----TVGCWKPVEQLLKAVDGITLADVSTVAEKIISSPLT  496

Query  431  MASYGDVLYLPSYDT  387
            MAS+G+VL +P+Y+T
Sbjct  497  MASHGNVLNVPAYET  511



>ref|NP_001077701.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
 gb|AEE32743.1| putative mitochondrial-processing peptidase subunit alpha-1 [Arabidopsis 
thaliana]
Length=451

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFA+AFE+PG W+ EK+A+T TVLQMLMGGGGSFSAGGPGKGM+S LY RVLNEY +V 
Sbjct  308  THFAVAFEVPG-WNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQ  366

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AF+SIFN TGLFGI   +S  F++KA+++A KEL  +A  G+V+Q  LDRAK ATKS
Sbjct  367  SCTAFTSIFNDTGLFGIYGCSSPQFAAKAIELAAKELKDVAG-GKVNQAHLDRAKAATKS  425

Query  602  AILMNLESRMVASEDIGRQILTYGE  528
            A+LMNLESRM+A+EDIGRQILTYGE
Sbjct  426  AVLMNLESRMIAAEDIGRQILTYGE  450



>ref|XP_005846410.1| hypothetical protein CHLNCDRAFT_36005 [Chlorella variabilis]
 gb|EFN54308.1| hypothetical protein CHLNCDRAFT_36005 [Chlorella variabilis]
Length=499

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH  LAF+  GGW   K ++ +TVLQ L+GGGGSFSAGGPGKGM+SRLY RVLN++P +
Sbjct  303  LTHAILAFQYQGGWRDVKGSVAMTVLQYLLGGGGSFSAGGPGKGMHSRLYTRVLNQHPWM  362

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H  +A +SI+N+TGL G+ A+  S  + + VD+  KE+ A+A   +V + +L+RAK A  
Sbjct  363  HNCTALNSIYNNTGLVGVFASAESGQAGEMVDVLCKEMLAVAK--DVSEAELERAKSAAV  420

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR V +EDIGRQ+LTYG RKPV  F++ I  + A D++    KL+ S  +MA
Sbjct  421  SSVLMNLESRAVVAEDIGRQVLTYGHRKPVGEFVQEIRGLKASDLSGAVSKLLKSAPSMA  480

Query  425  SYGDVLYLPSYDTV  384
              GD+ ++P YD V
Sbjct  481  VLGDIAHVPRYDQV  494



>ref|XP_006392972.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
 gb|ESQ30258.1| hypothetical protein EUTSA_v10011412mg [Eutrema salsugineum]
Length=466

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PG W+ EK+A+  TVLQMLMGGGGSFSAGGPGKGM+S LYLR+LNEY QV 
Sbjct  307  THFALAFEVPG-WNNEKEAVIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNEYQQVQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            + +AFSSIFN TGLFGI   +S +F++ A+ +A KEL  +A  G+V+Q+ LDRAK ATKS
Sbjct  366  SCTAFSSIFNDTGLFGIYGCSSPEFAANAIALAAKELKDVAG-GKVNQKHLDRAKAATKS  424

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSA  480
            A+LMNLESRM+A+EDIGRQ+LTYGER   +  LK  EE+ +
Sbjct  425  AVLMNLESRMIAAEDIGRQLLTYGERY-TQILLKKTEEIQS  464



>gb|KDO51845.1| hypothetical protein CISIN_1g010650mg [Citrus sinensis]
Length=436

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH ALAFE+PGGW K+K+A+ LTVLQ+LMGGGGSFSAGGPGKGM++RLYLRVLNEY Q+ 
Sbjct  306  THIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQ  365

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN+TGLFGI A T SDF SKAVD+ V+EL  IA+P +V Q QL+RAK+ATKS
Sbjct  366  SFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKS  425

Query  602  AILMNLESRMV  570
            A+LMNLESR +
Sbjct  426  AVLMNLESRKI  436



>ref|XP_005645630.1| LuxS/MPP-like metallohydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21086.1| LuxS/MPP-like metallohydrolase [Coccomyxa subellipsoidea C-169]
Length=506

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 133/198 (67%), Gaps = 6/198 (3%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH  LAFE  GGW+  K ++ +TVLQ L+GGGGSFSAGGPGKGM+SRLY RVLN    V
Sbjct  306  LTHAMLAFEFAGGWNDMKGSVAVTVLQFLLGGGGSFSAGGPGKGMHSRLYRRVLNANEWV  365

Query  785  HAFSAFSSIFNSTGLFGI----QATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAK  618
            H  +AF+S++N TGL GI         +  S K VDI  +EL A+A    V   +L+RAK
Sbjct  366  HNCTAFNSLYNDTGLVGIFISGDCQGDARRSGKLVDILTQELQAVAK--GVPADELERAK  423

Query  617  QATKSAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSP  438
             A  S++ MNLESR V +EDIGRQILTYG RKPV  F+ AI+E++   IA +  K++ +P
Sbjct  424  LAAISSVYMNLESRAVVAEDIGRQILTYGHRKPVPEFVNAIKELTPDAIAKVVAKILKTP  483

Query  437  LTMASYGDVLYLPSYDTV  384
             T+A  GD+  LP YD +
Sbjct  484  PTVAVLGDISNLPRYDAI  501



>ref|XP_001422415.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00732.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=448

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 126/194 (65%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +T   L FE  GGW   K +  +TVL ML+GGGGSFSAGGPGKGMYSRLY RVLN Y   
Sbjct  251  ITSIVLGFEFKGGWRDTKASTAMTVLTMLLGGGGSFSAGGPGKGMYSRLYTRVLNRYSWA  310

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
               +AF SIFN TG+ GI A  +S  +   V +   EL A+A+ G V  Q+L+RAK AT 
Sbjct  311  QNCTAFHSIFNDTGIVGISAMANSAHTGDMVKVMAGELQAVAASGGVSPQELERAKNATV  370

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S+ILMNLES+ V +EDIGRQ+LTY  RK    F+  +  VSA+D+  +A  L++S  T+A
Sbjct  371  SSILMNLESKAVVAEDIGRQMLTYKYRKSAADFIAEVRAVSAQDVQKVASDLLASAPTVA  430

Query  425  SYGDVLYLPSYDTV  384
              G++   P Y+ +
Sbjct  431  MTGELHAAPRYEDI  444



>emb|CEG00820.1| Metalloenzyme, LuxS/M16 peptidase-like [Ostreococcus tauri]
Length=451

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 123/189 (65%), Gaps = 0/189 (0%)
 Frame = -2

Query  950  LAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSA  771
            L FE  GGW   K +  +TVL ML+GGGGSFSAGGPGKGMYSRLY RVLN Y      +A
Sbjct  258  LGFEFKGGWRDVKASTAMTVLTMLLGGGGSFSAGGPGKGMYSRLYTRVLNRYSWAQNCTA  317

Query  770  FSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSAILM  591
            F SIFN TG+ GI A  +S        +   EL A+A+ G +D ++L+RAK AT S+ILM
Sbjct  318  FHSIFNDTGIVGISAMANSAHVGDMAKVMASELQAVAAKGGIDAKELERAKNATVSSILM  377

Query  590  NLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDV  411
            NLES+ V +EDIGRQ+LTY  RK  + F+  +  V+A D+A  A  L++S  T A+ GD+
Sbjct  378  NLESKAVIAEDIGRQMLTYKYRKSADDFIAEVRAVTAADVAQAASNLLASEPTFAASGDL  437

Query  410  LYLPSYDTV  384
               P +D +
Sbjct  438  YAAPRFDEI  446



>ref|XP_002508413.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69671.1| predicted protein [Micromonas sp. RCC299]
Length=464

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 130/194 (67%), Gaps = 1/194 (1%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +T+  LAFE  GGW  +K +  +TVL  LMGGGGSFSAGGPGKGMYSRLY RVLN +   
Sbjct  268  LTNIILAFEFKGGWRDQKGSTAMTVLNTLMGGGGSFSAGGPGKGMYSRLYNRVLNRHAWA  327

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
               ++F S+F+ TG+ GI        +   V +  +EL A+A+ G+++ ++LDRAK AT 
Sbjct  328  QNCTSFHSVFDDTGVIGISGVADGPHAGDMVAVMARELAAVAN-GKIEAKELDRAKAATV  386

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S+ILMNLESR V +EDIGRQILTYGERK    F+ AI  ++A +I+++A + + S  T+ 
Sbjct  387  SSILMNLESRAVVAEDIGRQILTYGERKSPAEFIAAINALTAAEISAVAAEALKSNPTLC  446

Query  425  SYGDVLYLPSYDTV  384
              GD+   P ++ V
Sbjct  447  MVGDLTAAPRFEQV  460



>ref|XP_003084396.1| putative mitochondrial processing peptidase (ISS), partial [Ostreococcus 
tauri]
Length=855

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 123/189 (65%), Gaps = 0/189 (0%)
 Frame = -2

Query  950  LAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSA  771
            L FE  GGW   K +  +TVL ML+GGGGSFSAGGPGKGMYSRLY RVLN Y      +A
Sbjct  234  LGFEFKGGWRDVKASTAMTVLTMLLGGGGSFSAGGPGKGMYSRLYTRVLNRYSWAQNCTA  293

Query  770  FSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSAILM  591
            F SIFN TG+ GI A  +S        +   EL A+A+ G +D ++L+RAK AT S+ILM
Sbjct  294  FHSIFNDTGIVGISAMANSAHVGDMAKVMASELQAVAAKGGIDAKELERAKNATVSSILM  353

Query  590  NLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDV  411
            NLES+ V +EDIGRQ+LTY  RK  + F+  +  V+A D+A  A  L++S  T A+ GD+
Sbjct  354  NLESKAVIAEDIGRQMLTYKYRKSADDFIAEVRAVTAADVAQAASNLLASEPTFAASGDL  413

Query  410  LYLPSYDTV  384
               P +D +
Sbjct  414  YAAPRFDEI  422



>gb|KHG28938.1| Mitochondrial-processing peptidase subunit alpha [Gossypium arboreum]
Length=426

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 110/146 (75%), Gaps = 16/146 (11%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            THFALAFE+PGGW+ EKD +TLT   MLMGGGGSFSAGGPGKGM+SRLYLRVLNEY Q+H
Sbjct  279  THFALAFEVPGGWNNEKDTVTLT---MLMGGGGSFSAGGPGKGMHSRLYLRVLNEYQQIH  335

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +FSAF+SIFN TGLFGI  +TSSDF S+AV+IA +EL  +A+ G V +  L    Q    
Sbjct  336  SFSAFNSIFNYTGLFGIYGSTSSDFVSRAVEIAAEELLVLATEGSVFEPVLVAVSQ----  391

Query  602  AILMNLESRMVASEDIGRQILTYGER  525
                     M+ +EDIGRQILTYGER
Sbjct  392  ---------MIIAEDIGRQILTYGER  408



>ref|XP_007509007.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20093.1| predicted protein [Bathycoccus prasinos]
Length=504

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 128/194 (66%), Gaps = 0/194 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +T   L FE  GGW   K +  +TVL ML+GGGGSFSAGGPGKGMYSRLY RVLN Y   
Sbjct  307  LTSLILGFEFQGGWRDAKRSTAVTVLSMLLGGGGSFSAGGPGKGMYSRLYTRVLNRYGWA  366

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
               +AF SI+N TG+ GI A T     +  + +  +EL+A+A+  ++  ++++RAK AT 
Sbjct  367  QNCTAFHSIYNDTGIVGISAMTDGQHVNDMIAVMAEELSAVANASQITDEEVERAKNATI  426

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S+ILMNLES+ V +EDIGRQ+LTY  RK  E F+  + +++ +D++ +A +++ S  T+ 
Sbjct  427  SSILMNLESKAVVAEDIGRQMLTYNHRKSPEEFIAEVSKLTKQDLSEVAAQMLKSNPTLC  486

Query  425  SYGDVLYLPSYDTV  384
              GD+     ++TV
Sbjct  487  LSGDIAGAARFETV  500



>ref|XP_011399005.1| putative mitochondrial-processing peptidase subunit alpha-1 [Auxenochlorella 
protothecoides]
 gb|KFM26109.1| putative mitochondrial-processing peptidase subunit alpha-1 [Auxenochlorella 
protothecoides]
Length=476

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 132/194 (68%), Gaps = 1/194 (1%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +TH  LAFE  GGW   + ++  TVLQ L+GGGGSFSAGGPGKGM+SRLY RVLN++  V
Sbjct  279  LTHAILAFEFAGGWRDVQGSVAATVLQYLLGGGGSFSAGGPGKGMHSRLYRRVLNQHGWV  338

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
               +A SSI+N TGL GI A+  +D +   V +   E  A+ S  + D ++L+RAK A  
Sbjct  339  SNCTALSSIYNDTGLVGIFASADADRADHLVRVLADEAAALVSDLK-DGEELERAKAAAL  397

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR V +EDIGRQ+LTYG RKP   F  AI+ ++AKD+ +  +  ++ P T+A
Sbjct  398  SSVLMNLESRAVVAEDIGRQVLTYGSRKPAAEFAAAIQALTAKDLKASVKAALAKPPTLA  457

Query  425  SYGDVLYLPSYDTV  384
            + GDV  +PS + V
Sbjct  458  TLGDVARVPSLEAV  471



>gb|KIZ01234.1| processing peptidase alpha subunit [Monoraphidium neglectum]
Length=393

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 128/189 (68%), Gaps = 2/189 (1%)
 Frame = -2

Query  950  LAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSA  771
            LAFE  GGW   + ++ +TVL  LMGGG SFS+GGPGKGM+SRLY RVLN+Y  VH+ SA
Sbjct  169  LAFEYAGGWQDIQGSVVMTVLTYLMGGGNSFSSGGPGKGMHSRLYTRVLNQYHWVHSCSA  228

Query  770  FSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSAILM  591
            F++ FNS+GL GIQA++    +   +D+  +EL A+A+P    Q+QL+RAK+ + S I  
Sbjct  229  FANTFNSSGLLGIQASSEPQQARPMLDVMCRELEALATP--PPQEQLERAKKMSVSLIHN  286

Query  590  NLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDV  411
             LES+  ++EDIGRQ LTYG R     ++  IE V+ + I+   ++L+SS  ++A++GD 
Sbjct  287  ALESKSASAEDIGRQFLTYGHRISGREYVAMIEAVTPQMISDFVRQLLSSKPSLAAFGDG  346

Query  410  LYLPSYDTV  384
                SYD +
Sbjct  347  AEGVSYDQL  355



>emb|CDJ37319.1| mitochondrial-processing peptidase alpha subunit, putative [Eimeria 
tenella]
Length=572

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 123/192 (64%), Gaps = 4/192 (2%)
 Frame = -2

Query  959  HFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHA  780
            H A+AFE PGGW+   D +T +VLQ LMGGGG+FS GGPGKGMY+RLYL VLN+Y  V +
Sbjct  374  HIAVAFETPGGWNG-GDLVTYSVLQTLMGGGGAFSTGGPGKGMYTRLYLNVLNKYDWVES  432

Query  779  FSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSA  600
              AF++ +  TGLFG+    + + +S AV +  ++   +     V  ++L RAK + KS+
Sbjct  433  AMAFNTQYTDTGLFGLYMLANPNKASSAVKVMAEQFAGMT---RVTAEELQRAKNSIKSS  489

Query  599  ILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASY  420
            I MNLE+R +  EDIGRQ+L  G       F +AI+ V   DI  +A+K+ S P T+ +Y
Sbjct  490  IYMNLENRGIVMEDIGRQLLMSGRVISPAEFCRAIDNVKEADIRRVAEKMFSKPPTVVAY  549

Query  419  GDVLYLPSYDTV  384
            GD+  +P Y+ +
Sbjct  550  GDICSVPHYEEI  561



>emb|CDJ66462.1| mitochondrial-processing peptidase alpha subunit, putative [Eimeria 
necatrix]
Length=572

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 123/192 (64%), Gaps = 4/192 (2%)
 Frame = -2

Query  959  HFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHA  780
            H A+AFE PGGW+   D +T +VLQ LMGGGG+FS GGPGKGMY+RLYL VLN+Y  V +
Sbjct  374  HIAVAFETPGGWNG-GDLVTYSVLQTLMGGGGAFSTGGPGKGMYTRLYLNVLNKYDWVES  432

Query  779  FSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSA  600
              AF++ +  TGLFG+    + + +S AV +  ++   +     V  ++L RAK + KS+
Sbjct  433  AMAFNTQYTDTGLFGLYMLANPNKASSAVKVIAEQFAGMT---RVTAEELQRAKNSIKSS  489

Query  599  ILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASY  420
            I MNLE+R +  EDIGRQ+L  G       F +AI+ V   DI  +A+K+ S P T+ +Y
Sbjct  490  IYMNLENRGIVMEDIGRQLLMSGRVISPAEFCRAIDNVKEADIRRVAEKMFSKPPTVVAY  549

Query  419  GDVLYLPSYDTV  384
            GD+  +P Y+ +
Sbjct  550  GDICSVPHYEEI  561



>ref|XP_003062937.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52876.1| predicted protein [Micromonas pusilla CCMP1545]
Length=474

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 124/193 (64%), Gaps = 1/193 (1%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            TH  LAFE  GGW   K A  +TV   LMGGGGSFSAGGPGKGMYSRLY RVLN++    
Sbjct  278  THVVLAFECAGGWKDHKSATAMTVFNTLMGGGGSFSAGGPGKGMYSRLYTRVLNKHHWAQ  337

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
              +AF S+F+  G+ G+     +  +S+   +  +E+ A+AS G V +++L+RAK AT S
Sbjct  338  NCTAFHSVFDDVGVVGVSGVADAGKASEMAAVMAREMLAVAS-GGVTEEELERAKAATIS  396

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            +ILMNLES+ + +ED+GRQILTY ERKP   F+  I  ++ KD+   A+  I S  T+  
Sbjct  397  SILMNLESKAIVAEDVGRQILTYSERKPPGEFIAQIRALTVKDMTEFAKGAIKSAPTLCQ  456

Query  422  YGDVLYLPSYDTV  384
             GD+   P YD V
Sbjct  457  AGDLSSAPRYDKV  469



>gb|KHN30017.1| Mitochondrial-processing peptidase subunit alpha [Glycine soja]
Length=425

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            V H A+AFE+PGGW KEK+A+ LT+LQMLMGGGGSFSAGGPGKGM+SRL+LRVLNE+ Q+
Sbjct  303  VAHVAIAFEVPGGWKKEKEAIALTILQMLMGGGGSFSAGGPGKGMHSRLFLRVLNEHQQI  362

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEV  645
            H+FSAF+S+FN+TGLFGI A+T SDF +KAVD+A +E  AIASPG+V
Sbjct  363  HSFSAFNSLFNNTGLFGIYASTGSDFVAKAVDLAARESIAIASPGQV  409



>ref|XP_005779248.1| mitochondrial processing peptidase [Emiliania huxleyi CCMP1516]
 gb|EOD26819.1| mitochondrial processing peptidase [Emiliania huxleyi CCMP1516]
Length=359

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 126/194 (65%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            +THF+LAF    GW K  + + L VL  +MGGG SFSAGGPGKGMY+RL+  +LN++  V
Sbjct  165  MTHFSLAFH-GCGW-KADELVPLCVLNTMMGGGTSFSAGGPGKGMYTRLFTNILNQHAFV  222

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
             A S F+S +N TG+FGI   T+ +   + V +   +   + S  ++  ++L RAK   K
Sbjct  223  TAASVFNSFYNDTGIFGIYGATTPEAMGQLVAVICDQANKMGS--DISAEELGRAKNQLK  280

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S++LMNLESR +  EDIGRQ+LTYG   P    +  I++V+A D+A++ +K+ SSP ++A
Sbjct  281  SSLLMNLESRPILLEDIGRQLLTYGAHTPPLELVDRIDKVTAADLANVTKKITSSPPSVA  340

Query  425  SYGDVLYLPSYDTV  384
             YGD   +P YD +
Sbjct  341  VYGDTTSVPRYDLI  354



>ref|XP_001970552.1| GG10696 [Drosophila erecta]
 gb|EDV59611.1| GG10696 [Drosophila erecta]
Length=556

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 128/189 (68%), Gaps = 4/189 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++KD + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  347  LAHVVLGFE--GCSHQDKDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  404

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  TGLF +  +      +  V++  +E+  +A+  E  +++L R+K   +
Sbjct  405  YSATAYNHAYADTGLFCVHGSAPPQHMNDMVEVLTREMMGMAA--EPGREELMRSKIQLQ  462

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G+RK  +HF+K IE V+A DI  +AQ+L+SSP ++A
Sbjct  463  SMLLMNLESRPVVFEDVGRQVLVTGQRKRPQHFIKEIESVTAADIQRVAQRLLSSPPSVA  522

Query  425  SYGDVLYLP  399
            + GD+  LP
Sbjct  523  ARGDIHNLP  531



>gb|EFN77279.1| Mitochondrial-processing peptidase subunit alpha, partial [Harpegnathos 
saltator]
Length=500

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 128/194 (66%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            ++H  +  E  G  H + D + + VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +
Sbjct  289  LSHVVIGLE--GCSHHDSDFVAMCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWL  346

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  TGLF I A+ ++    + V++ V+E+ A+A+   V   +L RAK+  +
Sbjct  347  YSATAYNHAYADTGLFCIHASCTAPHMKEMVEVIVQEMVAMAN--GVTDTELARAKKQLQ  404

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLE R VA EDIGRQ+L  G RK  E+F++AIEE+S  DI  + ++L+ SP  MA
Sbjct  405  SMLLMNLEQRPVAFEDIGRQVLATGSRKRSEYFIQAIEEISKDDINRVTRRLLKSPPCMA  464

Query  425  SYGDVLYLPSYDTV  384
            + GDV  +PS   V
Sbjct  465  ARGDVKAVPSLSNV  478



>ref|XP_002016657.1| GL10384 [Drosophila persimilis]
 gb|EDW32547.1| GL10384 [Drosophila persimilis]
Length=555

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 129/194 (66%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++ D + L VL ++MGGGGSFS+GGPGKGMYSRLY +VLN Y  +
Sbjct  346  LAHVVLGFE--GCAHQDPDFVPLCVLNIMMGGGGSFSSGGPGKGMYSRLYTKVLNRYHWM  403

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  +GLF I  +      +  V++ ++EL ++A+  E  +++L R+K   +
Sbjct  404  YSATAYNHAYTDSGLFCIHGSAPPQHLNDMVEVIIRELLSMAA--EPGREELMRSKIQLQ  461

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G RK  EHF+K IE+VSA DI  +A +L+SSP ++A
Sbjct  462  SMLLMNLESRPVVFEDVGRQVLVSGHRKRPEHFIKEIEKVSAADIQRVATRLLSSPPSLA  521

Query  425  SYGDVLYLPSYDTV  384
            + GD+  LP    V
Sbjct  522  ARGDISGLPEMSHV  535



>ref|XP_001361470.1| GA21285 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL26048.1| GA21285 [Drosophila pseudoobscura pseudoobscura]
Length=555

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 129/194 (66%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++ D + L VL ++MGGGGSFS+GGPGKGMYSRLY +VLN Y  +
Sbjct  346  LAHVVLGFE--GCAHQDPDFVPLCVLNIMMGGGGSFSSGGPGKGMYSRLYTKVLNRYHWM  403

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  +GLF I  +      +  V++ ++EL ++A+  E  +++L R+K   +
Sbjct  404  YSATAYNHAYTDSGLFCIHGSAPPQHLNDMVEVIIRELLSMAA--EPGREELMRSKIQLQ  461

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G RK  EHF+K IE+VSA DI  +A +L+SSP ++A
Sbjct  462  SMLLMNLESRPVVFEDVGRQVLVSGHRKRPEHFIKEIEKVSAADIQRVATRLLSSPPSLA  521

Query  425  SYGDVLYLPSYDTV  384
            + GD+  LP    V
Sbjct  522  ARGDISGLPEMSHV  535



>ref|XP_011150400.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X1 [Harpegnathos saltator]
 ref|XP_011150401.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X1 [Harpegnathos saltator]
 ref|XP_011150402.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X1 [Harpegnathos saltator]
 ref|XP_011150403.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X1 [Harpegnathos saltator]
Length=550

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 128/194 (66%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            ++H  +  E  G  H + D + + VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +
Sbjct  337  LSHVVIGLE--GCSHHDSDFVAMCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWL  394

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  TGLF I A+ ++    + V++ V+E+ A+A+   V   +L RAK+  +
Sbjct  395  YSATAYNHAYADTGLFCIHASCTAPHMKEMVEVIVQEMVAMAN--GVTDTELARAKKQLQ  452

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLE R VA EDIGRQ+L  G RK  E+F++AIEE+S  DI  + ++L+ SP  MA
Sbjct  453  SMLLMNLEQRPVAFEDIGRQVLATGSRKRSEYFIQAIEEISKDDINRVTRRLLKSPPCMA  512

Query  425  SYGDVLYLPSYDTV  384
            + GDV  +PS   V
Sbjct  513  ARGDVKAVPSLSNV  526



>ref|XP_011150404.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X2 [Harpegnathos saltator]
Length=548

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 128/194 (66%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            ++H  +  E  G  H + D + + VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +
Sbjct  337  LSHVVIGLE--GCSHHDSDFVAMCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWL  394

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  TGLF I A+ ++    + V++ V+E+ A+A+   V   +L RAK+  +
Sbjct  395  YSATAYNHAYADTGLFCIHASCTAPHMKEMVEVIVQEMVAMAN--GVTDTELARAKKQLQ  452

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLE R VA EDIGRQ+L  G RK  E+F++AIEE+S  DI  + ++L+ SP  MA
Sbjct  453  SMLLMNLEQRPVAFEDIGRQVLATGSRKRSEYFIQAIEEISKDDINRVTRRLLKSPPCMA  512

Query  425  SYGDVLYLPSYDTV  384
            + GDV  +PS   V
Sbjct  513  ARGDVKAVPSLSNV  526



>ref|NP_610333.1| CG8728 [Drosophila melanogaster]
 gb|AAF59168.1| CG8728 [Drosophila melanogaster]
 gb|AAL13552.1| GH09295p [Drosophila melanogaster]
 gb|AAL90274.2| LD05680p [Drosophila melanogaster]
 gb|ACL85095.1| CG8728-PA, partial [synthetic construct]
 gb|ACL89964.1| CG8728-PA [synthetic construct]
Length=556

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 127/189 (67%), Gaps = 4/189 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++KD + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  347  LAHVILGFE--GCSHQDKDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  404

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +   GLF +  +      +  V++  +E+  +A+  E  +++L R+K   +
Sbjct  405  YSATAYNHAYGDCGLFCVHGSAPPQHMNDMVEVLTREMMGMAA--EPGREELMRSKIQLQ  462

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G+RK  +HF+K IE V+A DI  +AQ+L+SSP ++A
Sbjct  463  SMLLMNLESRPVVFEDVGRQVLVTGQRKRPQHFIKEIESVTAADIQRVAQRLLSSPPSVA  522

Query  425  SYGDVLYLP  399
            + GD+  LP
Sbjct  523  ARGDIHNLP  531



>ref|XP_002032829.1| GM20744 [Drosophila sechellia]
 gb|EDW46842.1| GM20744 [Drosophila sechellia]
Length=556

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 127/189 (67%), Gaps = 4/189 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++KD + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  347  LAHVILGFE--GCSHQDKDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  404

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +   GLF +  +      +  V++  +E+  +A+  E  +++L R+K   +
Sbjct  405  YSATAYNHAYGDCGLFCVHGSAPPQHMNDMVEVLTREMMGMAA--EPGREELMRSKIQLQ  462

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G+RK  +HF+K IE V+A DI  +AQ+L+SSP ++A
Sbjct  463  SMLLMNLESRPVVFEDVGRQVLATGQRKRPQHFIKEIESVTAADIQRVAQRLLSSPPSVA  522

Query  425  SYGDVLYLP  399
            + GD+  LP
Sbjct  523  ARGDIHNLP  531



>ref|XP_001960990.1| GF11230 [Drosophila ananassae]
 gb|EDV37812.1| GF11230 [Drosophila ananassae]
Length=555

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 128/189 (68%), Gaps = 4/189 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++KD + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  346  LAHVVLGFE--GCSHQDKDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  403

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  TG+F I  +      ++ V++  +E+ A+A+  E  +++L R+K   +
Sbjct  404  YSATAYNHAYADTGVFCIHGSAPPQHMNEMVEVITREMVAMAA--EPGREELMRSKIQLQ  461

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G RK  EHF++ IE V+A DI  +AQ+L+SS  ++A
Sbjct  462  SMLLMNLESRPVVFEDVGRQVLVTGHRKRPEHFIREIESVTAADIQRVAQRLLSSAPSVA  521

Query  425  SYGDVLYLP  399
            + GD+  LP
Sbjct  522  ARGDIQNLP  530



>ref|XP_010915359.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X2 [Elaeis guineensis]
Length=157

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 101/149 (68%), Gaps = 30/149 (20%)
 Frame = -2

Query  884  MLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSSDFS  705
            MLMGG GSFS GG GKGM+S LYLRVLNE+PQ+   S+FS+I+N TGLFGI A T SDF 
Sbjct  1    MLMGGIGSFSTGGLGKGMHSHLYLRVLNEFPQIQLSSSFSNIYNHTGLFGIYA-TGSDFV  59

Query  704  SKAVDIAVKELTAIASPGE-----------------------------VDQQQLDRAKQA  612
            SKAVD+A +EL A+A+PGE                             VDQ QLD  K++
Sbjct  60   SKAVDLAGRELLAVATPGERLLFLCFLLDYFSIGFRFCEFFDSFLFFTVDQVQLDHDKES  119

Query  611  TKSAILMNLESRMVASEDIGRQILTYGER  525
            TKSA+LMNLES +VAS+DIG QILT+GER
Sbjct  120  TKSAVLMNLESWVVASKDIGWQILTHGER  148



>ref|XP_002089546.1| GE23498 [Drosophila yakuba]
 gb|EDW89258.1| GE23498 [Drosophila yakuba]
Length=556

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 128/189 (68%), Gaps = 4/189 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++KD + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  347  LAHVVLGFE--GCSHQDKDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  404

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  +GLF +  +      +  V++  +E+  +A+  E  +++L R+K   +
Sbjct  405  YSATAYNHAYADSGLFCVHGSAPPQHMNDMVEVLTREMMGMAA--EPGREELMRSKIQLQ  462

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G+RK  +HF++ IE V+A DI  +AQ+L+SSP ++A
Sbjct  463  SMLLMNLESRPVVFEDVGRQVLVTGQRKRPQHFIQEIESVTAADIQRVAQRLLSSPPSVA  522

Query  425  SYGDVLYLP  399
            + GD+  LP
Sbjct  523  ARGDIHNLP  531



>ref|XP_010915360.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X3 [Elaeis guineensis]
Length=155

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 87/132 (66%), Gaps = 30/132 (23%)
 Frame = -2

Query  833  MYSRLYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASP  654
            M+S LYLRVLNE+PQ+   S+FS+I+N TGLFGI A T SDF SKAVD+A +EL A+A+P
Sbjct  18   MHSHLYLRVLNEFPQIQLSSSFSNIYNHTGLFGIYA-TGSDFVSKAVDLAGRELLAVATP  76

Query  653  GE-----------------------------VDQQQLDRAKQATKSAILMNLESRMVASE  561
            GE                             VDQ QLD  K++TKSA+LMNLES +VAS+
Sbjct  77   GERLLFLCFLLDYFSIGFRFCEFFDSFLFFTVDQVQLDHDKESTKSAVLMNLESWVVASK  136

Query  560  DIGRQILTYGER  525
            DIG QILT+GER
Sbjct  137  DIGWQILTHGER  148



>ref|XP_002080508.1| GD10210 [Drosophila simulans]
 gb|EDX06093.1| GD10210 [Drosophila simulans]
Length=556

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 126/189 (67%), Gaps = 4/189 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++KD + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  347  LAHVILGFE--GCSHQDKDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  404

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +   GLF +  +      +  V++  +E+  +A+  E  +++L R+K   +
Sbjct  405  YSATAYNHAYGDCGLFCVHGSAPPQHMNDMVEVLTREMMGMAA--EPGREELMRSKIQLQ  462

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G+RK  +HF+K IE V+  DI  +AQ+L+SSP ++A
Sbjct  463  SMLLMNLESRPVVFEDVGRQVLATGQRKRPQHFIKEIESVTTADIQRVAQRLLSSPPSVA  522

Query  425  SYGDVLYLP  399
            + GD+  LP
Sbjct  523  ARGDIHNLP  531



>ref|XP_010915358.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X1 [Elaeis guineensis]
Length=161

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 87/132 (66%), Gaps = 30/132 (23%)
 Frame = -2

Query  833  MYSRLYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASP  654
            M+S LYLRVLNE+PQ+   S+FS+I+N TGLFGI A T SDF SKAVD+A +EL A+A+P
Sbjct  18   MHSHLYLRVLNEFPQIQLSSSFSNIYNHTGLFGIYA-TGSDFVSKAVDLAGRELLAVATP  76

Query  653  GE-----------------------------VDQQQLDRAKQATKSAILMNLESRMVASE  561
            GE                             VDQ QLD  K++TKSA+LMNLES +VAS+
Sbjct  77   GERLLFLCFLLDYFSIGFRFCEFFDSFLFFTVDQVQLDHDKESTKSAVLMNLESWVVASK  136

Query  560  DIGRQILTYGER  525
            DIG QILT+GER
Sbjct  137  DIGWQILTHGER  148



>ref|XP_010915361.1| PREDICTED: mitochondrial-processing peptidase subunit alpha isoform 
X4 [Elaeis guineensis]
Length=154

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 101/151 (67%), Gaps = 30/151 (20%)
 Frame = -2

Query  884  MLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSAFSSIFNSTGLFGIQATTSSDFS  705
            MLMGG GSFS GG GKGM+S LYLRVLNE+PQ+   S+FS+I+N TGLFGI A T SDF 
Sbjct  1    MLMGGIGSFSTGGLGKGMHSHLYLRVLNEFPQIQLSSSFSNIYNHTGLFGIYA-TGSDFV  59

Query  704  SKAVDIAVKELTAIASPGE-----------------------------VDQQQLDRAKQA  612
            SKAVD+A +EL A+A+PGE                             VDQ QLD  K++
Sbjct  60   SKAVDLAGRELLAVATPGERLLFLCFLLDYFSIGFRFCEFFDSFLFFTVDQVQLDHDKES  119

Query  611  TKSAILMNLESRMVASEDIGRQILTYGERKP  519
            TKSA+LMNLES +VAS+DIG QILT+GE  P
Sbjct  120  TKSAVLMNLESWVVASKDIGWQILTHGESCP  150



>ref|XP_002063555.1| GK21348 [Drosophila willistoni]
 gb|EDW74541.1| GK21348 [Drosophila willistoni]
Length=559

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++ D + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  350  LAHVVLGFE--GTSHQDNDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  407

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  TGLF I  +       + V++  +EL ++A   E   ++L R+K   +
Sbjct  408  YSATAYNHAYTDTGLFCIHGSAPPQHMQEMVEVLARELISMAD--EPGSEELMRSKIQLQ  465

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G RK  EHF++ IE+V A DI  +AQ+L++SP ++A
Sbjct  466  SMLLMNLESRPVVFEDVGRQVLVSGHRKRPEHFIQEIEKVKAADIQRVAQRLLASPPSVA  525

Query  425  SYGDVLYLP  399
            + GD+  LP
Sbjct  526  ARGDIHNLP  534



>gb|ERL94085.1| hypothetical protein D910_11367 [Dendroctonus ponderosae]
Length=508

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 128/194 (66%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            ++H  +  E  G  H++ D + + VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +
Sbjct  298  LSHIMIGLE--GCSHQDSDFIAMCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWM  355

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +N TGLF I A+   ++    V++ VKEL  +AS   +  Q+L RAK   +
Sbjct  356  YSATAYNHAYNDTGLFCIHASAPPNYVRDMVEVIVKELVNMAS--SIGDQELRRAKTQLQ  413

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  EDIGRQ+L    RK  E+F+K IE+++  DI  +A++L+ S  ++A
Sbjct  414  SMLLMNLESRPVMFEDIGRQVLATAHRKRPEYFIKEIEKITKDDIVQVAKRLLMSQPSVA  473

Query  425  SYGDVLYLPSYDTV  384
            + GD+  +PS + +
Sbjct  474  ARGDLRKMPSLEYI  487



>gb|ENN72399.1| hypothetical protein YQE_11033, partial [Dendroctonus ponderosae]
Length=539

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 128/194 (66%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            ++H  +  E  G  H++ D + + VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +
Sbjct  329  LSHIMIGLE--GCSHQDSDFIAMCVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWM  386

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +N TGLF I A+   ++    V++ VKEL  +AS   +  Q+L RAK   +
Sbjct  387  YSATAYNHAYNDTGLFCIHASAPPNYVRDMVEVIVKELVNMAS--SIGDQELRRAKTQLQ  444

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  EDIGRQ+L    RK  E+F+K IE+++  DI  +A++L+ S  ++A
Sbjct  445  SMLLMNLESRPVMFEDIGRQVLATAHRKRPEYFIKEIEKITKDDIVQVAKRLLMSQPSVA  504

Query  425  SYGDVLYLPSYDTV  384
            + GD+  +PS + +
Sbjct  505  ARGDLRKMPSLEYI  518



>ref|XP_011506331.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Ceratosolen 
solmsi marchali]
Length=541

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            ++HF +  E  G  H++ D +T+ VL M+MGGGGSFSAGGPGKGMYSRLY+ VLN Y  +
Sbjct  330  LSHFVIGLE--GCSHQDPDFVTMCVLNMMMGGGGSFSAGGPGKGMYSRLYINVLNRYHWL  387

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  TGLF I A+ +     +  ++ + E+ A++  G++   +L RAK+  +
Sbjct  388  YSATAYNHAYIDTGLFCIHASATPSHVREMAEVIIHEMVAMS--GKLSSDELARAKKQLQ  445

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLE R V  EDIGRQ+L  G RK  E++++AIE  +  D+  +A++L+ SP ++A
Sbjct  446  SMLLMNLEQRPVVFEDIGRQVLATGSRKRPEYYIQAIENTTIDDVVRVARRLLKSPPSVA  505

Query  425  SYGDVLYLPS  396
            + G+V ++PS
Sbjct  506  ARGEVRHVPS  515



>ref|XP_002430518.1| mitochondrial-processing peptidase alpha subunit, mitochondrial 
precursor, putative [Pediculus humanus corporis]
 gb|EEB17780.1| mitochondrial-processing peptidase alpha subunit, mitochondrial 
precursor, putative [Pediculus humanus corporis]
Length=556

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 125/194 (64%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  HK+ + + + VL M+MGGGGSFSAGGPGKGMY+RLY  VLN +  +
Sbjct  339  LAHIVLGFE--GCSHKDPEFIAVCVLNMIMGGGGSFSAGGPGKGMYTRLYTNVLNRFHWM  396

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            +  +A++ ++  TGLF + A+    +    V + V+E+  +   GE+   +L RAK   +
Sbjct  397  YNATAYNHVYGDTGLFCVHASAPPQYVRDMVQVIVQEMLNMT--GEICPIELKRAKTQLQ  454

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  EDI RQ+L    RKP E+F+ AIE+++  D+  IA+KL+S+  ++A
Sbjct  455  SMLLMNLESRAVIFEDIARQVLATNHRKPPEYFIDAIEKITEDDVRKIARKLVSTKPSVA  514

Query  425  SYGDVLYLPSYDTV  384
            + GD+  LPS+  +
Sbjct  515  ARGDIRKLPSFSDI  528



>gb|AFK45902.1| unknown [Lotus japonicus]
Length=77

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  593  MNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGD  414
            MNLESRMV SEDIGRQ+LTYGERKPV+ FLKA+++V+ KDI SI+QKL+SSPLTMASYGD
Sbjct  1    MNLESRMVVSEDIGRQVLTYGERKPVDDFLKAVDQVTLKDITSISQKLLSSPLTMASYGD  60

Query  413  VLYLPSYDTV  384
            VLY+PSY++V
Sbjct  61   VLYVPSYESV  70



>ref|XP_002132351.1| GA25238 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY69753.1| GA25238 [Drosophila pseudoobscura pseudoobscura]
Length=820

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 123/196 (63%), Gaps = 6/196 (3%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpg--kGMYSRLYLRVLNEYP  792
            + H  L FE  G  H++ D + L VL ++MG GGSFS G  G  KGM SRLY +VLN Y 
Sbjct  339  LAHVVLGFE--GCAHQDPDYVPLCVLNIMMGCGGSFSRGSGGHGKGMNSRLYTKVLNRYD  396

Query  791  QVHAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQA  612
             VH+ +A +  +  +GLF I  +      +  V++ V+EL ++A+  E  ++ L R+K  
Sbjct  397  WVHSATAHNHAYTDSGLFCIHGSAPPQHMNDMVEVIVRELLSMAA--EPGREDLMRSKIQ  454

Query  611  TKSAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLT  432
             +S +LMNLESR V  ED+GRQ+L  G RK  EHF++ IE+VSA DI  +A +L+SSP +
Sbjct  455  LQSMLLMNLESRAVVFEDVGRQVLASGHRKRPEHFIEEIEKVSAADIQRVATRLLSSPPS  514

Query  431  MASYGDVLYLPSYDTV  384
            +A+ GD+  LP  D V
Sbjct  515  LAARGDITGLPEMDHV  530



>emb|CCA25279.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=617

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 3/190 (2%)
 Frame = -2

Query  953  ALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFS  774
            ALAF + GGWH E D + + VL  L+GGG SFSAGGPGKGMYSRLY  VLN +  V +  
Sbjct  420  ALAFPI-GGWHNE-DLVPVCVLHTLLGGGDSFSAGGPGKGMYSRLYTSVLNRFHWVESAF  477

Query  773  AFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKSAIL  594
            AFSSI N  GL GI    +   +S  V +   +L  IA    VD  +L RAK   KS++L
Sbjct  478  AFSSIHNDVGLMGIYGAATPSHTSNLVAVLCNQLLHIAQV-VVDPLELSRAKNQLKSSVL  536

Query  593  MNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGD  414
            MNLESRM+  EDIGRQ+LTYG R+  +     I++V+A+D+  + ++ +    +M  YGD
Sbjct  537  MNLESRMILYEDIGRQLLTYGYRESPQRVCAKIDKVTAEDLQRVMREAMRERPSMVYYGD  596

Query  413  VLYLPSYDTV  384
            +   P+YD V
Sbjct  597  LKLFPTYDQV  606



>ref|XP_317371.3| AGAP008086-PA [Anopheles gambiae str. PEST]
 gb|EAA12324.3| AGAP008086-PA [Anopheles gambiae str. PEST]
Length=510

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = -2

Query  938  LPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSAFSSI  759
            L G  H++KD +   VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +++ +A++  
Sbjct  308  LKGCSHQDKDFIAACVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMYSATAYNHA  367

Query  758  FNSTGLFGIQATTSSDFSSKAVDIAVKELTAIAS-PGEVDQQQLDRAKQATKSAILMNLE  582
            +  TGLF I AT         V++  +EL  + S PG+   Q+L RAK   +S +LMNLE
Sbjct  368  YGDTGLFCIHATAPPTHVRSLVEVITRELFTMQSRPGD---QELRRAKTQLQSMLLMNLE  424

Query  581  SRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDVLYL  402
            +R V  EDIGRQ+L  GER+  EHF++ IE+++A+D+ ++A+K++SS   +A+ G++  +
Sbjct  425  ARPVVFEDIGRQVLATGERRRPEHFIQEIEKITAEDVQNVARKMLSSAPALAARGEIKGI  484

Query  401  P  399
            P
Sbjct  485  P  485



>ref|XP_009028455.1| hypothetical protein HELRODRAFT_186101 [Helobdella robusta]
 gb|ESN93385.1| hypothetical protein HELRODRAFT_186101 [Helobdella robusta]
Length=548

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 127/194 (65%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + HF +  E     HK +D +   VL MLMGGGGSFSAGGPGKGMY+RLYL VLN +  +
Sbjct  338  LAHFVVGLE--SCSHKHEDFVATCVLNMLMGGGGSFSAGGPGKGMYTRLYLNVLNRHHWI  395

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            H  +AF+  +N +GLF I A++      +  D+ ++EL  + +  ++   +L+RAK   +
Sbjct  396  HNATAFNHAYNDSGLFCIHASSHPSSLKELTDVILREL--VNTQNDISPDELNRAKTQLQ  453

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLE+R V  ED+GRQ+L+ G+R P E++   I++++  D+  +A+K+++S  ++A
Sbjct  454  SMLLMNLEARPVVFEDVGRQVLSNGKRMPSEYYCDLIQKITEADVQRVARKMLTSRPSVA  513

Query  425  SYGDVLYLPSYDTV  384
            + G++  LP YD +
Sbjct  514  ALGNLNELPKYDDI  527



>ref|XP_005177966.1| PREDICTED: mitochondrial-processing peptidase subunit alpha [Musca 
domestica]
Length=556

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 125/195 (64%), Gaps = 6/195 (3%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  +  E  G  H++ D + L VL ++MGGGGSFSAGGPGKGMYSRLY  VLN Y  +
Sbjct  348  LAHVVIGLE--GCSHQDPDFVALCVLNIMMGGGGSFSAGGPGKGMYSRLYTNVLNRYHWM  405

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIAS-PGEVDQQQLDRAKQAT  609
            ++ +A++  +  TGLF I A+          ++  +EL  + S PG   +++L R+K   
Sbjct  406  YSATAYNHAYADTGLFCIHASAPPTNVRDMTEVVTRELVHMTSNPG---REELSRSKIQL  462

Query  608  KSAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTM  429
            +S +LMNLESR V  ED+GRQ+L  G RK  EHF+  I++++A DI  +A++L+SSP++M
Sbjct  463  QSMLLMNLESRPVVFEDVGRQVLATGHRKRPEHFINEIDKITAADIQRVAKRLLSSPVSM  522

Query  428  ASYGDVLYLPSYDTV  384
            A+ GD+  LP    V
Sbjct  523  AARGDISGLPDIKEV  537



>ref|XP_008862995.1| hypothetical protein H310_01616 [Aphanomyces invadans]
 gb|ETW09190.1| hypothetical protein H310_01616 [Aphanomyces invadans]
Length=535

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 121/193 (63%), Gaps = 3/193 (2%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            ++ +LAF   GGWH   D + + VLQ L+GGG SFSAGGPGKGMYSRLY  VLN Y  V 
Sbjct  331  SYASLAFPT-GGWH-HADLVPVCVLQTLLGGGDSFSAGGPGKGMYSRLYTHVLNRYYWVE  388

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +  AFSS+ N TGL GI      + + + V + V +L +IA  G VD  +L RAK   KS
Sbjct  389  SAQAFSSLHNDTGLLGIYGACMPEATGQLVGLLVNQLLSIALHG-VDATELSRAKNQLKS  447

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            ++LMNLESRM+  EDIGRQ+LTYGER+  +     ++ V+A D+  + ++ +    ++  
Sbjct  448  SVLMNLESRMILYEDIGRQLLTYGERESPDVICAKVDAVTAADLQRVVREAMEHKPSLVY  507

Query  422  YGDVLYLPSYDTV  384
             G +   PSYD V
Sbjct  508  MGKLTDFPSYDNV  520



>ref|XP_004535752.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X2 [Ceratitis capitata]
Length=547

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 124/194 (64%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  +  E  G  H++ D + L VL ++MGGGGSFSAGGPGKGMYSRLY  VLN Y  +
Sbjct  339  LAHVVIGLE--GCSHQDPDFVALCVLNIMMGGGGSFSAGGPGKGMYSRLYTNVLNRYHWM  396

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  +GLF I A+   +     V++  +EL  +AS  E  + +L R+K   +
Sbjct  397  YSATAYNHAYADSGLFCIHASAPPNNVRDMVEVITRELVNMAS--EPSKDELSRSKIQLQ  454

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G RK  EHF++ IE+++  DI  +A +L+S+P +MA
Sbjct  455  SMLLMNLESRPVVFEDVGRQVLATGHRKRPEHFIREIEKINEGDIQRVAGRLLSTPPSMA  514

Query  425  SYGDVLYLPSYDTV  384
            + GD+  LP    V
Sbjct  515  ARGDIGKLPEMKEV  528



>ref|XP_004535751.1| PREDICTED: mitochondrial-processing peptidase subunit alpha-like 
isoform X1 [Ceratitis capitata]
Length=550

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 124/194 (64%), Gaps = 4/194 (2%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  +  E  G  H++ D + L VL ++MGGGGSFSAGGPGKGMYSRLY  VLN Y  +
Sbjct  342  LAHVVIGLE--GCSHQDPDFVALCVLNIMMGGGGSFSAGGPGKGMYSRLYTNVLNRYHWM  399

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATK  606
            ++ +A++  +  +GLF I A+   +     V++  +EL  +AS  E  + +L R+K   +
Sbjct  400  YSATAYNHAYADSGLFCIHASAPPNNVRDMVEVITRELVNMAS--EPSKDELSRSKIQLQ  457

Query  605  SAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMA  426
            S +LMNLESR V  ED+GRQ+L  G RK  EHF++ IE+++  DI  +A +L+S+P +MA
Sbjct  458  SMLLMNLESRPVVFEDVGRQVLATGHRKRPEHFIREIEKINEGDIQRVAGRLLSTPPSMA  517

Query  425  SYGDVLYLPSYDTV  384
            + GD+  LP    V
Sbjct  518  ARGDIGKLPEMKEV  531



>ref|XP_009820980.1| hypothetical protein H257_00138 [Aphanomyces astaci]
 gb|ETV88580.1| hypothetical protein H257_00138 [Aphanomyces astaci]
Length=533

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 121/193 (63%), Gaps = 3/193 (2%)
 Frame = -2

Query  962  THFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVH  783
            ++ +LAF   GGWH E D + + VLQ L+GGG SFSAGGPGKGMYSRLY  VLN Y  V 
Sbjct  329  SYASLAFPT-GGWHHE-DLVPVCVLQTLLGGGDSFSAGGPGKGMYSRLYTHVLNRYYWVE  386

Query  782  AFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIASPGEVDQQQLDRAKQATKS  603
            +  AFSS+ N  GL GI      + + + V + V +L +IA  G VD  +L RAK   KS
Sbjct  387  SAQAFSSLHNDAGLVGIYGACMPEATGQLVGLLVNQLLSIALHG-VDSTELSRAKNQLKS  445

Query  602  AILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMAS  423
            ++LMNLESRM+  EDIGRQ+LTYG R+  E     ++ V+A D+  + ++ ++   ++  
Sbjct  446  SVLMNLESRMILYEDIGRQLLTYGIRESPESICDKVDAVTAADVQRVVREAMAHKPSLVY  505

Query  422  YGDVLYLPSYDTV  384
             G +   PSYD V
Sbjct  506  MGKLSDFPSYDNV  518



>ref|XP_001986331.1| GH20583 [Drosophila grimshawi]
 gb|EDW01198.1| GH20583 [Drosophila grimshawi]
Length=555

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 124/190 (65%), Gaps = 6/190 (3%)
 Frame = -2

Query  965  VTHFALAFELPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQV  786
            + H  L FE  G  H++ D + L VL ++MGGGGSFSAGGPGKGMYSRLY +VLN Y  +
Sbjct  347  LAHVVLGFE--GCSHQDPDFVPLCVLNIMMGGGGSFSAGGPGKGMYSRLYTKVLNRYHWM  404

Query  785  HAFSAFSSIFNSTGLFGIQATTSSDFSSKAVDIAVKELTAIA-SPGEVDQQQLDRAKQAT  609
            ++ +A++  +  TGLF I  +         V++  +EL  +A  PG    ++L R+K   
Sbjct  405  YSATAYNHAYVDTGLFCIHGSAPPQHMRDMVEVLTRELMNMAFEPG---TEELMRSKIQL  461

Query  608  KSAILMNLESRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTM  429
            +S +LMNLESR V  ED+GRQ+L  G RK  EHF++ IE+V+A DI  +AQ+L+SS  ++
Sbjct  462  QSMLLMNLESRPVVFEDVGRQVLVTGNRKRPEHFIREIEKVTAADIQRVAQRLLSSVPSV  521

Query  428  ASYGDVLYLP  399
            A+ GD+  LP
Sbjct  522  AARGDIQNLP  531



>gb|ETN59954.1| mitochondrial processing peptidase alpha subunit [Anopheles darlingi]
Length=548

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = -2

Query  938  LPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSAFSSI  759
            L G  H++KD +   VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +++ +A++  
Sbjct  346  LQGCSHQDKDFIAACVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMYSATAYNHA  405

Query  758  FNSTGLFGIQATTSSDFSSKAVDIAVKELTAIAS-PGEVDQQQLDRAKQATKSAILMNLE  582
            +  TGLF I AT         V++  +EL  + S PG+   Q+L RAK   +S +LMNLE
Sbjct  406  YADTGLFCIHATAPPSHVRNLVEVITRELFTMQSRPGD---QELRRAKTQLQSMLLMNLE  462

Query  581  SRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDVLYL  402
            +R V  EDIGRQ+L  GER+  EHF++ IE+++A+D+ ++A+K++SS   +A+ G++  +
Sbjct  463  ARPVVFEDIGRQVLATGERRRPEHFIQEIEKITAEDVQNVARKMLSSAPALAARGEIKGI  522

Query  401  P  399
            P
Sbjct  523  P  523



>gb|KFB39416.1| hypothetical protein ZHAS_00006962 [Anopheles sinensis]
Length=544

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = -2

Query  938  LPGGWHKEKDAMTLTVLQMLMggggsfsaggpgkGMYSRLYLRVLNEYPQVHAFSAFSSI  759
            L G  H++KD +   VL M+MGGGGSFSAGGPGKGMY+RLY  VLN Y  +++ +A++  
Sbjct  342  LRGCSHQDKDFIAACVLNMMMGGGGSFSAGGPGKGMYTRLYTNVLNRYHWMYSATAYNHA  401

Query  758  FNSTGLFGIQATTSSDFSSKAVDIAVKELTAIAS-PGEVDQQQLDRAKQATKSAILMNLE  582
            +  TGLF I AT         V++  +EL  + S PG+   Q+L RAK   +S +LMNLE
Sbjct  402  YADTGLFCIHATAPPTHVRNLVEVITRELFTMQSRPGD---QELRRAKTQLQSMLLMNLE  458

Query  581  SRMVASEDIGRQILTYGERKPVEHFLKAIEEVSAKDIASIAQKLISSPLTMASYGDVLYL  402
            +R V  EDIGRQ+L  GER+  EHF++ IE+++A+D+ ++A+K++SS   +A+ G++  +
Sbjct  459  ARPVVFEDIGRQVLATGERRRPEHFIQEIEKITAEDVQNVARKMLSSAPALAARGEIKGI  518

Query  401  P  399
            P
Sbjct  519  P  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2364259253926