BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11211

Length=824
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06636.1|  unnamed protein product                                154   2e-39   Coffea canephora [robusta coffee]
gb|KDO44653.1|  hypothetical protein CISIN_1g0124232mg                  143   3e-38   Citrus sinensis [apfelsine]
ref|XP_006341048.1|  PREDICTED: probable ADP-ribosylation factor ...    147   3e-37   Solanum tuberosum [potatoes]
ref|XP_009611524.1|  PREDICTED: probable ADP-ribosylation factor ...    147   6e-37   Nicotiana tomentosiformis
ref|NP_001275129.1|  uncharacterized protein LOC102577536               147   7e-37   Solanum tuberosum [potatoes]
ref|XP_009787987.1|  PREDICTED: probable ADP-ribosylation factor ...    144   3e-36   Nicotiana sylvestris
ref|XP_004246418.1|  PREDICTED: probable ADP-ribosylation factor ...    144   4e-36   Solanum lycopersicum
ref|XP_006480784.1|  PREDICTED: probable ADP-ribosylation factor ...    143   1e-35   Citrus sinensis [apfelsine]
ref|XP_010111497.1|  hypothetical protein L484_021322                   136   9e-34   
ref|XP_004302746.1|  PREDICTED: probable ADP-ribosylation factor ...    135   1e-32   Fragaria vesca subsp. vesca
ref|XP_011094839.1|  PREDICTED: probable ADP-ribosylation factor ...    133   4e-32   Sesamum indicum [beniseed]
ref|XP_010253251.1|  PREDICTED: probable ADP-ribosylation factor ...    133   5e-32   Nelumbo nucifera [Indian lotus]
gb|EYU41704.1|  hypothetical protein MIMGU_mgv1a005908mg                132   7e-32   Erythranthe guttata [common monkey flower]
ref|XP_008442564.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    131   1e-31   Cucumis melo [Oriental melon]
gb|KHG27901.1|  ADP-ribosylation factor GTPase-activating AGD7 -l...    130   3e-31   Gossypium arboreum [tree cotton]
ref|XP_011651902.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    130   6e-31   Cucumis sativus [cucumbers]
ref|XP_009804190.1|  PREDICTED: probable ADP-ribosylation factor ...    129   7e-31   Nicotiana sylvestris
gb|KJB16885.1|  hypothetical protein B456_002G255000                    129   9e-31   Gossypium raimondii
ref|XP_007027080.1|  ARF-GAP domain 7 isoform 1                         129   1e-30   
ref|XP_008241285.1|  PREDICTED: probable ADP-ribosylation factor ...    129   1e-30   
ref|XP_003542460.1|  PREDICTED: probable ADP-ribosylation factor ...    129   1e-30   Glycine max [soybeans]
ref|XP_007205139.1|  hypothetical protein PRUPE_ppa005179mg             129   1e-30   Prunus persica
gb|KHN05918.1|  ADP-ribosylation factor GTPase-activating protein...    126   1e-30   Glycine soja [wild soybean]
ref|XP_002527750.1|  arf gtpase-activating protein, putative            129   2e-30   Ricinus communis
ref|XP_007144453.1|  hypothetical protein PHAVU_007G157400g             126   8e-30   Phaseolus vulgaris [French bean]
ref|XP_010037851.1|  PREDICTED: probable ADP-ribosylation factor ...    124   7e-29   Eucalyptus grandis [rose gum]
ref|XP_009374672.1|  PREDICTED: probable ADP-ribosylation factor ...    123   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_008366719.1|  PREDICTED: probable ADP-ribosylation factor ...    123   2e-28   
gb|EYU26574.1|  hypothetical protein MIMGU_mgv11b004906mg               122   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_003537172.1|  PREDICTED: probable ADP-ribosylation factor ...    122   3e-28   Glycine max [soybeans]
ref|XP_004249530.1|  PREDICTED: probable ADP-ribosylation factor ...    121   6e-28   Solanum lycopersicum
ref|XP_010529843.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    121   6e-28   Tarenaya hassleriana [spider flower]
ref|XP_004495006.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    120   1e-27   Cicer arietinum [garbanzo]
ref|XP_008345448.1|  PREDICTED: probable ADP-ribosylation factor ...    120   2e-27   
ref|XP_009621199.1|  PREDICTED: probable ADP-ribosylation factor ...    120   2e-27   Nicotiana tomentosiformis
ref|XP_009338772.1|  PREDICTED: probable ADP-ribosylation factor ...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_011019883.1|  PREDICTED: probable ADP-ribosylation factor ...    119   2e-27   Populus euphratica
ref|XP_006339030.1|  PREDICTED: probable ADP-ribosylation factor ...    119   3e-27   Solanum tuberosum [potatoes]
ref|XP_008812043.1|  PREDICTED: probable ADP-ribosylation factor ...    114   5e-27   Phoenix dactylifera
ref|XP_012075017.1|  PREDICTED: probable ADP-ribosylation factor ...    114   7e-27   
ref|XP_010937673.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    118   8e-27   Elaeis guineensis
ref|XP_010253247.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    117   1e-26   
gb|KDP35606.1|  hypothetical protein JCGZ_09044                         114   1e-26   Jatropha curcas
ref|XP_002881515.1|  hypothetical protein ARALYDRAFT_482750             117   2e-26   
ref|NP_181291.1|  ADP-ribosylation factor GTPase-activating prote...    115   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554321.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    115   6e-26   Glycine max [soybeans]
ref|XP_002309050.1|  PDE1 SUPPRESSOR 1 family protein                   115   6e-26   Populus trichocarpa [western balsam poplar]
ref|XP_012092892.1|  PREDICTED: probable ADP-ribosylation factor ...    115   7e-26   Jatropha curcas
gb|KJB76702.1|  hypothetical protein B456_012G102200                    114   1e-25   Gossypium raimondii
ref|XP_006410942.1|  hypothetical protein EUTSA_v10016645mg             114   1e-25   Eutrema salsugineum [saltwater cress]
ref|XP_003521336.1|  PREDICTED: probable ADP-ribosylation factor ...    114   2e-25   Glycine max [soybeans]
dbj|BAE71192.1|  putative Asp1                                          114   2e-25   Trifolium pratense [peavine clover]
gb|KHG23489.1|  ADP-ribosylation factor GTPase-activating protein...    113   3e-25   Gossypium arboreum [tree cotton]
gb|KEH42388.1|  ADP-ribosylation factor GTPase-activating protein...    113   3e-25   Medicago truncatula
ref|XP_004253319.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    112   5e-25   
ref|XP_006403662.1|  hypothetical protein EUTSA_v10010333mg             112   6e-25   Eutrema salsugineum [saltwater cress]
ref|XP_010504141.1|  PREDICTED: probable ADP-ribosylation factor ...    111   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010427029.1|  PREDICTED: probable ADP-ribosylation factor ...    110   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010515873.1|  PREDICTED: probable ADP-ribosylation factor ...    110   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_011094837.1|  PREDICTED: probable ADP-ribosylation factor ...    108   1e-23   Sesamum indicum [beniseed]
ref|XP_006429044.1|  hypothetical protein CICLE_v10013094mg             103   2e-23   
ref|XP_009116065.1|  PREDICTED: probable ADP-ribosylation factor ...    108   2e-23   Brassica rapa
emb|CDX78196.1|  BnaA09g33910D                                          108   2e-23   
ref|XP_006294027.1|  hypothetical protein CARUB_v10023020mg             108   2e-23   
ref|XP_010505344.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    107   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006291063.1|  hypothetical protein CARUB_v10017178mg             107   3e-23   
ref|XP_007027081.1|  ARF-GAP domain 7 isoform 2                         107   3e-23   
ref|NP_190939.1|  putative ADP-ribosylation factor GTPase-activat...    107   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877936.1|  hypothetical protein ARALYDRAFT_485760             106   7e-23   
ref|XP_010517025.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    105   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009139382.1|  PREDICTED: probable ADP-ribosylation factor ...    104   4e-22   Brassica rapa
gb|KHG23490.1|  ADP-ribosylation factor GTPase-activating protein...    104   6e-22   Gossypium arboreum [tree cotton]
emb|CDX79739.1|  BnaC03g20750D                                          103   7e-22   
emb|CDX74953.1|  BnaA05g06990D                                          103   8e-22   
ref|XP_010907061.1|  PREDICTED: probable ADP-ribosylation factor ...    103   8e-22   
emb|CDX73533.1|  BnaC08g24700D                                          102   2e-21   
ref|XP_007162658.1|  hypothetical protein PHAVU_001G1694000g            102   2e-21   Phaseolus vulgaris [French bean]
ref|XP_010509321.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    102   2e-21   
ref|XP_009402324.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    102   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795047.1|  PREDICTED: probable ADP-ribosylation factor ...    102   4e-21   Phoenix dactylifera
emb|CDY30849.1|  BnaC04g27040D                                          101   5e-21   Brassica napus [oilseed rape]
ref|XP_006373937.1|  hypothetical protein POPTR_0016s11090g           96.3    1e-20   
ref|XP_009133186.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    100   2e-20   Brassica rapa
ref|XP_010920665.1|  PREDICTED: probable ADP-ribosylation factor ...  97.8    1e-19   Elaeis guineensis
emb|CDY69342.1|  BnaCnng63080D                                        96.3    3e-19   Brassica napus [oilseed rape]
ref|XP_009386541.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  96.3    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010678052.1|  PREDICTED: probable ADP-ribosylation factor ...  95.1    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009143481.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  93.2    5e-18   Brassica rapa
gb|AAG17006.1|AF184146_1  ARF GAP-like zinc finger-containing pro...  91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409527.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  90.5    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004493890.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  88.6    2e-16   Cicer arietinum [garbanzo]
ref|XP_009141672.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  87.0    5e-16   Brassica rapa
gb|ABD32193.1|  Arf GTPase activating protein                         85.9    1e-15   Medicago truncatula
ref|XP_003625498.1|  ADP-ribosylation factor GTPase-activating pr...  85.5    2e-15   
emb|CDY26647.1|  BnaA09g46300D                                        81.3    4e-15   Brassica napus [oilseed rape]
ref|XP_006651253.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...  83.6    9e-15   Oryza brachyantha
emb|CDX88291.1|  BnaC06g37350D                                        80.9    9e-15   
emb|CDY07784.1|  BnaA03g17270D                                        82.8    1e-14   Brassica napus [oilseed rape]
ref|XP_010922379.1|  PREDICTED: probable ADP-ribosylation factor ...  82.8    2e-14   Elaeis guineensis
gb|EPS67752.1|  hypothetical protein M569_07021                       82.4    2e-14   Genlisea aurea
ref|XP_009416249.1|  PREDICTED: probable ADP-ribosylation factor ...  82.0    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16083.1|  BnaC08g40400D                                        78.2    8e-14   Brassica napus [oilseed rape]
gb|AAO72580.1|  ADP ribosylation GTPase-like protein                  79.3    8e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049726.1|  Os03g0278400                                     79.3    2e-13   
gb|EAY89468.1|  hypothetical protein OsI_11000                        79.3    2e-13   Oryza sativa Indica Group [Indian rice]
gb|KHN09424.1|  Putative ADP-ribosylation factor GTPase-activatin...  75.1    4e-13   Glycine soja [wild soybean]
ref|XP_002465464.1|  hypothetical protein SORBIDRAFT_01g039320        78.6    4e-13   Sorghum bicolor [broomcorn]
emb|CBI30586.3|  unnamed protein product                              76.6    1e-12   Vitis vinifera
ref|NP_001150760.1|  DNA binding protein                              77.0    1e-12   Zea mays [maize]
ref|XP_002262606.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  76.3    2e-12   Vitis vinifera
ref|XP_008654261.1|  PREDICTED: probable ADP-ribosylation factor ...  76.3    3e-12   Zea mays [maize]
emb|CDY18435.1|  BnaA04g21520D                                        74.7    7e-12   Brassica napus [oilseed rape]
ref|XP_004984751.1|  PREDICTED: probable ADP-ribosylation factor ...  73.6    2e-11   Setaria italica
gb|EMT07652.1|  hypothetical protein F775_26990                       71.6    5e-11   
ref|XP_003558222.1|  PREDICTED: probable ADP-ribosylation factor ...  71.2    1e-10   Brachypodium distachyon [annual false brome]
gb|KHF98429.1|  ADP-ribosylation factor GTPase-activating AGD7 -l...  70.9    1e-10   Gossypium arboreum [tree cotton]
gb|EMS46940.1|  putative ADP-ribosylation factor GTPase-activatin...  70.5    2e-10   Triticum urartu
dbj|BAJ88349.1|  predicted protein                                    70.5    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006846038.1|  PREDICTED: probable ADP-ribosylation factor ...  70.1    3e-10   Amborella trichopoda
ref|XP_008780180.1|  PREDICTED: probable ADP-ribosylation factor ...  69.7    3e-10   Phoenix dactylifera
gb|KJB36743.1|  hypothetical protein B456_006G174500                  67.4    2e-09   Gossypium raimondii
gb|KJB36744.1|  hypothetical protein B456_006G174500                  67.0    3e-09   Gossypium raimondii
ref|XP_010940758.1|  PREDICTED: probable ADP-ribosylation factor ...  64.7    2e-08   Elaeis guineensis
ref|XP_002972763.1|  hypothetical protein SELMODRAFT_441959           63.9    3e-08   
ref|XP_002984338.1|  hypothetical protein SELMODRAFT_445864           63.9    3e-08   Selaginella moellendorffii
ref|XP_009381844.1|  PREDICTED: probable ADP-ribosylation factor ...  62.0    1e-07   
ref|XP_009409624.1|  PREDICTED: probable ADP-ribosylation factor ...  58.2    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001772457.1|  predicted protein                                57.4    5e-06   
ref|XP_010646583.1|  PREDICTED: probable ADP-ribosylation factor ...  56.6    9e-06   Vitis vinifera
emb|CBI23433.3|  unnamed protein product                              56.2    1e-05   Vitis vinifera
ref|XP_001761895.1|  predicted protein                                56.6    1e-05   
ref|XP_010267329.1|  PREDICTED: probable ADP-ribosylation factor ...  55.8    1e-05   Nelumbo nucifera [Indian lotus]
emb|CAN72855.1|  hypothetical protein VITISV_043217                   55.5    2e-05   Vitis vinifera



>emb|CDP06636.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 123/159 (77%), Gaps = 6/159 (4%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV AKT EIG +TWGIMKGV+ALASQKVEEY KE   +WKND WQR+ESE NGYY
Sbjct  310  NETVNVVAAKTTEIGHKTWGIMKGVMALASQKVEEYAKEGGVSWKNDGWQRSESETNGYY  369

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA----NNdswa  475
            Q+F  +      +    GQ SSGRQFNSV+SGSWD+WD+K N  +E+S      N DSWA
Sbjct  370  QEFGQD--SKGWNSPAAGQPSSGRQFNSVSSGSWDDWDSKDNRKEESSKGTASHNGDSWA  427

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWDD KDDGFD+FYQSA D+K VG+NGKSD KW++GGFL
Sbjct  428  GWDDNKDDGFDNFYQSASDSKAVGYNGKSDAKWTEGGFL  466



>gb|KDO44653.1| hypothetical protein CISIN_1g0124232mg, partial [Citrus sinensis]
 gb|KDO44654.1| hypothetical protein CISIN_1g0124232mg, partial [Citrus sinensis]
 gb|KDO44655.1| hypothetical protein CISIN_1g0124232mg, partial [Citrus sinensis]
Length=163

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 120/158 (76%), Gaps = 8/158 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIMKGV+A+ASQKVEEYTKE    W ND+WQRNESE NGYY
Sbjct  11   NETVNVVTAKTSEIGQRTWGIMKGVMAMASQKVEEYTKE---GWNNDNWQRNESESNGYY  67

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKG---NNTKETSPANNdswag  472
            Q+FNH +KG +S  GGG  S+     NS  S SWD+WD K    +  K T   NND+WAG
Sbjct  68   QEFNHGNKGQDSPAGGGQYSAG--HHNSYGSSSWDDWDQKDKKEDTPKGTGSGNNDAWAG  125

Query  471  wddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            WDDAKDDG+D+FYQSA D K +GHNGKSD  W+ GGFL
Sbjct  126  WDDAKDDGYDNFYQSASDKKALGHNGKSDATWTGGGFL  163



>ref|XP_006341048.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X1 [Solanum tuberosum]
 ref|XP_006341049.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X2 [Solanum tuberosum]
 ref|XP_006341050.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X3 [Solanum tuberosum]
 ref|XP_006341051.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X4 [Solanum tuberosum]
Length=467

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 117/162 (72%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ++WGIMKGVLA+ASQKVEEYTKE    WKNDSWQR ESE+NGYY
Sbjct  310  NETVNVVTAKTSEIGQKSWGIMKGVLAMASQKVEEYTKESPA-WKNDSWQRGESEKNGYY  368

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswa  475
            QDFN +          GG  SSGR  NSV+SGSWD+WD    +K N TK  +  NN +  
Sbjct  369  QDFNQD---SKGWNASGGAQSSGRNVNSVSSGSWDDWDNEDKSKVNPTKAAAAPNNKNDD  425

Query  474  gw--ddakddgfddFYQSAHDNKHVG-HNGKSDTKWSDGGFL  358
                DD +DDGFD+ YQSA +NKH   H GKSD+KW+DGGFL
Sbjct  426  WAGWDDGQDDGFDNHYQSASNNKHATVHAGKSDSKWTDGGFL  467



>ref|XP_009611524.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
 ref|XP_009611525.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
Length=464

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 121/159 (76%), Gaps = 8/159 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ+ WG+MKGVLA+ASQKVEEYTK D+  WKNDSWQR+E+E+NGYY
Sbjct  310  NETVNVVTAKTTEIGQKGWGLMKGVLAIASQKVEEYTK-DSPTWKNDSWQRSENEKNGYY  368

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswa  475
            QDFN +          GG  SSGR  NSV+SGSWD+WD    +K ++TK  + + ND WA
Sbjct  369  QDFNQD---SKGWNTSGGAQSSGRNVNSVSSGSWDDWDNEDKSKVSSTKGAASSKNDDWA  425

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWDD +DDGFD+ YQSA   KH  H GKSD+KW+DGGFL
Sbjct  426  GWDDGQDDGFDNHYQSASGTKHAIHGGKSDSKWTDGGFL  464



>ref|NP_001275129.1| uncharacterized protein LOC102577536 [Solanum tuberosum]
 gb|ABA46771.1| unknown [Solanum tuberosum]
Length=468

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 117/162 (72%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ++WGIMKGVLA+ASQKVEEYTKE    WKNDSWQR ES++NGYY
Sbjct  311  NETVNVVTAKTSEIGQKSWGIMKGVLAMASQKVEEYTKESPA-WKNDSWQRGESDKNGYY  369

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswa  475
            QDFN +          GG  SSGR  NSV+SGSWD+WD    +K N TK  +  NN +  
Sbjct  370  QDFNQD---SKGWNASGGAQSSGRNANSVSSGSWDDWDNEDKSKVNPTKAAAAPNNKNDD  426

Query  474  gw--ddakddgfddFYQSAHDNKHVG-HNGKSDTKWSDGGFL  358
                DD +DDGFD+ YQSA +NKH   H GKSD+KW+DGGFL
Sbjct  427  WAGWDDGQDDGFDNHYQSASNNKHAAVHAGKSDSKWTDGGFL  468



>ref|XP_009787987.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
 ref|XP_009787988.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
Length=464

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 121/159 (76%), Gaps = 8/159 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ+ WG+MKGVLA+ASQKVEEYTK D+  WKNDSW+R+E+E+NGYY
Sbjct  310  NETVNVVTAKTTEIGQKGWGLMKGVLAIASQKVEEYTK-DSPAWKNDSWERSENEKNGYY  368

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswa  475
            QDFN +          GG  SSGR  NSV+SGSWD+WD    +K ++TK  + + ND WA
Sbjct  369  QDFNQD---SKGWNTSGGAQSSGRNVNSVSSGSWDDWDNEDKSKVSSTKGAAASKNDDWA  425

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWDD +DDGFD+ YQSA   KH  H GKSD+KW+DGGFL
Sbjct  426  GWDDGQDDGFDNHYQSASGTKHAVHAGKSDSKWTDGGFL  464



>ref|XP_004246418.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Solanum lycopersicum]
Length=467

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 115/162 (71%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ++WGIMKGVLA+ASQKVEEYTKE    WKNDSWQR ESE+NGYY
Sbjct  310  NETVNVVTAKTSEIGQKSWGIMKGVLAMASQKVEEYTKESPA-WKNDSWQRGESEKNGYY  368

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswa  475
            QDFN +          GG  SSGR  NSV+SGSWD+WD    +K N  K  +  NN +  
Sbjct  369  QDFNQD---PKGWNASGGAQSSGRNVNSVSSGSWDDWDNEDKSKVNPPKAAAAPNNKNDD  425

Query  474  gw--ddakddgfddFYQSAHDNKHVG-HNGKSDTKWSDGGFL  358
                DD +DDGFD+ YQSA +N H   H GKSD+KW+DGGFL
Sbjct  426  WAGWDDGQDDGFDNHYQSASNNNHAAVHAGKSDSKWTDGGFL  467



>ref|XP_006480784.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like isoform X1 [Citrus sinensis]
 ref|XP_006480785.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like isoform X2 [Citrus sinensis]
Length=464

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 120/158 (76%), Gaps = 8/158 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIMKGV+A+ASQKVEEYTKE    W ND+WQRNESE NGYY
Sbjct  312  NETVNVVTAKTSEIGQRTWGIMKGVMAMASQKVEEYTKE---GWNNDNWQRNESESNGYY  368

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKG---NNTKETSPANNdswag  472
            Q+FNH +KG +S  GGG  S+     NS  S SWD+WD K    +  K T   NND+WAG
Sbjct  369  QEFNHGNKGQDSPAGGGQYSAG--HHNSYGSSSWDDWDQKDKKEDTPKGTGSGNNDAWAG  426

Query  471  wddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            WDDAKDDG+D+FYQSA D K +GHNGKSD  W+ GGFL
Sbjct  427  WDDAKDDGYDNFYQSASDKKALGHNGKSDATWTGGGFL  464



>ref|XP_010111497.1| hypothetical protein L484_021322 [Morus notabilis]
 gb|EXC31020.1| hypothetical protein L484_021322 [Morus notabilis]
Length=366

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 117/159 (74%), Gaps = 8/159 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ+TWGIMKGV+A+ASQKVEEYT+E   N K D+WQRN++E NGYY
Sbjct  212  NETVNVVTAKTTEIGQKTWGIMKGVMAIASQKVEEYTRE-GANLKADNWQRNDNENNGYY  270

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswa  475
            Q+F  N +  ++SGG    S     FNS NS SWD+WD K N    +TK  S  NND WA
Sbjct  271  QEFKQNKEWNSTSGGQSSSSG---HFNSFNSSSWDDWDQKDNRKEESTKGKSSHNNDGWA  327

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWDD KDDG+D FYQSA + K VGHNGKSD  W+ GGFL
Sbjct  328  GWDDPKDDGYDGFYQSASNTKPVGHNGKSDATWTGGGFL  366



>ref|XP_004302746.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Fragaria vesca subsp. vesca]
Length=461

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 118/159 (74%), Gaps = 9/159 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIMKGV+A+ASQKVEE +KE  GNWK D+WQR++SEQNGYY
Sbjct  306  NETVNVVTAKTSEIGQRTWGIMKGVMAMASQKVEELSKE--GNWKTDNWQRDDSEQNGYY  363

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdsw-  478
            QDFN   +   +S  G GQSSS    NS NS SWD+WDTK N    +TK T  +N+    
Sbjct  364  QDFNKQ-ETGWNSSSGRGQSSSSEHINSYNSNSWDDWDTKDNRKEVSTKGTGGSNSSDGW  422

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  361
            AGWDD KDDGFD  YQSA   K VGHNGKSD+ W+ GGF
Sbjct  423  AGWDDGKDDGFDSGYQSAP-TKGVGHNGKSDSTWTGGGF  460



>ref|XP_011094839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Sesamum indicum]
Length=471

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 106/161 (66%), Gaps = 9/161 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIMKGV+ALASQKVEE+TKE +G WKNDSWQ+ ES+ NGY 
Sbjct  314  NETVNVVTAKTSEIGQRTWGIMKGVMALASQKVEEFTKEGSG-WKNDSWQQKESDTNGYS  372

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswa----  475
            Q+F         +   G QSSSGRQFNSV+  SWD+WDTK +  +ET             
Sbjct  373  QEFGPE--SRGWNSSAGAQSSSGRQFNSVSHSSWDDWDTKDSRKEETPKGTTSQDEDGWA  430

Query  474  --gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
                    DDG+D+ Y S  D K  G+N KSD  W+DGGF+
Sbjct  431  GWDDAKDDDDGYDNSYDSKSDQKTKGYNEKSDANWTDGGFI  471



>ref|XP_010253251.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nelumbo nucifera]
Length=466

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 105/159 (66%), Gaps = 8/159 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ+TWGIMKGV+A+ASQKVEEYTKE    WK D+WQ+N+SE+NGYY
Sbjct  312  NETVNVVTAKTTEIGQKTWGIMKGVMAMASQKVEEYTKEGI-TWKADNWQQNDSERNGYY  370

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            Q+F             GG SSSGRQFNSV+SGSWD+WD+K N   E     +        
Sbjct  371  QEFRQE---SKGWNSSGGYSSSGRQFNSVSSGSWDDWDSKDNRKDEPRKGASSQNGDSWT  427

Query  462  akddgfddFYQSAHDNKHV----GHNGKSDTKWSDGGFL  358
              DD  DD Y+S +         G NGKSD +W++GGFL
Sbjct  428  GWDDAKDDSYESFYSGSSSKTLGGQNGKSDAQWTEGGFL  466



>gb|EYU41704.1| hypothetical protein MIMGU_mgv1a005908mg [Erythranthe guttata]
Length=465

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 116/159 (73%), Gaps = 12/159 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVT KT EIGQ+TWG+M+GV+ALASQKVEE+TKE        +W R ESE NGYY
Sbjct  315  NETVNVVTTKTSEIGQKTWGLMRGVMALASQKVEEFTKEG-----GSAWPRKESESNGYY  369

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKE----TSPANNdswa  475
            QDFNH+S   + +   G QSS+ +QF   +S SWD+W+TK +  +E    T P N DSWA
Sbjct  370  QDFNHDSSKGSINTSTGAQSSTDKQF---SSNSWDDWETKDSKKEEQSKGTKPHNGDSWA  426

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWDD KDDGFD FYQSA D+K   HNGKSD+ W+DGGFL
Sbjct  427  GWDDGKDDGFDSFYQSASDHKTKDHNGKSDSNWADGGFL  465



>ref|XP_008442564.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis melo]
 ref|XP_008442565.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis melo]
Length=466

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 111/166 (67%), Gaps = 12/166 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIM+GV+A+ASQKVEEY K D  NWKND WQRNE+E+NGYY
Sbjct  302  NETVNVVTAKTTEIGQRTWGIMRGVMAMASQKVEEYAK-DGMNWKNDGWQRNENEKNGYY  360

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            Q+F H++KG NSS G G  S SG   NS NS SWD+WDTK N  +ET+   + +    ++
Sbjct  361  QEFEHDNKGWNSSSGTGQSSGSGHHNNSYNSSSWDDWDTKDNRKEETTTKVSGTHNNNNN  420

Query  462  a----------kddgfddFYQSAHDNKHVGHNGKS-DTKWSDGGFL  358
                       + D   D Y  A D K VG NGK+    WS+GGFL
Sbjct  421  NSNDGWAGWDDQKDDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL  466



>gb|KHG27901.1| ADP-ribosylation factor GTPase-activating AGD7 -like protein 
[Gossypium arboreum]
Length=469

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDS-WQRNESEQNGY  646
            NETV VVTAKT EIGQ+TWGIMKGV+A+ASQKVEEYTK D  NWKND  WQRN+SE+NGY
Sbjct  313  NETVGVVTAKTSEIGQKTWGIMKGVMAIASQKVEEYTK-DGMNWKNDGNWQRNDSEKNGY  371

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNN----TKETSPANNdsw  478
            YQ+F   +KG NS+ GG   S     +NS NS SWD+WDTK N     TK T+  +ND W
Sbjct  372  YQEFKQENKGWNSTSGGQTSSGVN--YNSYNSNSWDDWDTKDNRKEHTTKVTASHSNDGW  429

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            AGWDD KDDG+D FY  A D   VG NGKSD  W+ GGFL
Sbjct  430  AGWDDPKDDGYDSFYNGASDKNAVGRNGKSDAAWTGGGFL  469



>ref|XP_011651902.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis sativus]
 ref|XP_004137765.2| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis sativus]
 gb|KGN58883.1| hypothetical protein Csa_3G734360 [Cucumis sativus]
Length=468

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 111/171 (65%), Gaps = 17/171 (10%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIM+GV+A+ASQKVEEY K D  NWKND WQRNE+E+NGYY
Sbjct  299  NETVNVVTAKTTEIGQRTWGIMRGVMAMASQKVEEYAK-DGMNWKNDGWQRNENEKNGYY  357

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            Q+F H++KG NSS G G  S SG   NS NS SWD+WDTK N  +ET+   + +    ++
Sbjct  358  QEFEHDNKGWNSSSGTGQSSGSGHHNNSYNSSSWDDWDTKDNRKEETTTKVSGTHNNNNN  417

Query  462  akddgfddF---------------YQSAHDNKHVGHNGKS-DTKWSDGGFL  358
              ++   +                Y  A D K VG NGK+    WS+GGFL
Sbjct  418  NNNNNNSNDGWAGWDDQKDDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL  468



>ref|XP_009804190.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
Length=454

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 108/159 (68%), Gaps = 10/159 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIGQ+ WGIMKGVLALASQKVEEY  E   N K++SWQR+E+ QNGYY
Sbjct  302  NETVNVVATKTTEIGQKGWGIMKGVLALASQKVEEYA-EGGSNGKDNSWQRSENGQNGYY  360

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETS----PANNdswa  475
            Q+FN            GG  SSGR  NSV+SGSWD+WD+K +N K+TS     ++ND   
Sbjct  361  QEFNK---ESKGLNSSGGAQSSGRHSNSVSSGSWDDWDSK-DNRKQTSTKGATSSNDDGW  416

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   D +QSA  NKH GH GKS++KW+DGGFL
Sbjct  417  AGWDDGKDDGYDNFQSASINKH-GHGGKSESKWTDGGFL  454



>gb|KJB16885.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
 gb|KJB16886.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
 gb|KJB16887.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
Length=469

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDS-WQRNESEQNGY  646
            NETV VVTAKT EIGQ+TWG+MKGV+A+ASQKVEEYTK D  NWKND  WQRN+SE+NGY
Sbjct  313  NETVGVVTAKTSEIGQKTWGMMKGVMAIASQKVEEYTK-DGMNWKNDGNWQRNDSEKNGY  371

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNN----TKETSPANNdsw  478
            YQ+F   +KG NS+ GG   S     +NS NS SWD+WDTK N     TK T+  +ND W
Sbjct  372  YQEFKQENKGWNSTSGGQTSSGV--NYNSYNSNSWDDWDTKDNRKEHTTKVTASHSNDGW  429

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            AGWDD KDDG+D FY  A D   VG NGKSD  W+ GGFL
Sbjct  430  AGWDDPKDDGYDSFYNGASDKNAVGRNGKSDAAWTGGGFL  469



>ref|XP_007027080.1| ARF-GAP domain 7 isoform 1 [Theobroma cacao]
 gb|EOY07582.1| ARF-GAP domain 7 isoform 1 [Theobroma cacao]
Length=467

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 121/159 (76%), Gaps = 7/159 (4%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTA+T EIGQRTWGIMKGV+A+ASQKVEEYTK D  NWKN++WQRN+SE+NGYY
Sbjct  312  NETVNVVTARTSEIGQRTWGIMKGVMAIASQKVEEYTK-DGMNWKNENWQRNDSEKNGYY  370

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswa  475
            Q+F   +KG NS+ GG   S      NS +S SWD+WD+K N    +TK T+  +ND WA
Sbjct  371  QEFKQENKGWNSTSGGQSSSGGSY--NSYSSSSWDDWDSKDNRKKDSTKVTASQSNDGWA  428

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWDDAKDDG+D FY  A D K VGHNGKSD  W+ GGFL
Sbjct  429  GWDDAKDDGYDHFYSGASDKKTVGHNGKSDATWTGGGFL  467



>ref|XP_008241285.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Prunus mume]
 ref|XP_008241292.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Prunus mume]
Length=473

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 107/158 (68%), Gaps = 8/158 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDS-WQRNESEQNGY  646
            NETVNVVTAKT EIG RTWGIMKGV+A+ASQKVEEYTK D   WK D+ WQRN+SEQNGY
Sbjct  319  NETVNVVTAKTTEIGHRTWGIMKGVMAMASQKVEEYTK-DGTTWKADNNWQRNDSEQNGY  377

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP---ANNdswa  475
            YQ+F   +K  +SSGGG   S +   FNS  S SWD+WD K N  +ET+    +N+    
Sbjct  378  YQEFKQENKQWDSSGGGQSSSGN---FNSHGSSSWDDWDQKDNRKQETTKGTGSNSSDGW  434

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  361
               D   D   D YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  435  AGWDDAKDDGFDHYQSASVSKAAGHNGKSDSSWTGGGF  472



>ref|XP_003542460.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=481

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 122/191 (64%), Gaps = 38/191 (20%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVT KT EIGQRTWGIMKGV+A+ASQK+EEYTK+D  NWKND+WQRNE+++NGYY
Sbjct  293  NETVNVVTQKTSEIGQRTWGIMKGVMAMASQKIEEYTKDDP-NWKNDNWQRNENDRNGYY  351

Query  642  QDFN--------------------------------HNskglnssgggggqsssGRQFNS  559
            QDFN                                HN         G   SS G  F++
Sbjct  352  QDFNQENKGWNSSIGREQSSSGQFKTQSSSSWDDWDHNDSRKEVPAKGSSHSSGG-LFST  410

Query  558  VNSGSWDNWDTKGNNTKE----TSPANNdswagwddakddgfddFYQSAHDNKHVGHNGK  391
             NS SWD+W+ + +  +E    ++P NN+ WAGWD+AKDDGFD++Y+ A + K VGHNGK
Sbjct  411  HNSSSWDDWEHRDSRKEEPAKGSAPHNNEDWAGWDNAKDDGFDNYYEGASNKKGVGHNGK  470

Query  390  SDTKWSDGGFL  358
            SD  W++GGFL
Sbjct  471  SDGTWTEGGFL  481



>ref|XP_007205139.1| hypothetical protein PRUPE_ppa005179mg [Prunus persica]
 gb|EMJ06338.1| hypothetical protein PRUPE_ppa005179mg [Prunus persica]
Length=473

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 107/158 (68%), Gaps = 8/158 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDS-WQRNESEQNGY  646
            NETVNVVTAKT EIG RTWGIMKGV+A+ASQKVEEYTK D   WK D+ WQRN+SEQNGY
Sbjct  319  NETVNVVTAKTTEIGHRTWGIMKGVMAMASQKVEEYTK-DGTAWKADNNWQRNDSEQNGY  377

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP---ANNdswa  475
            YQ+F   +K  NSSGGG   S +   FNS  S SWD+WD K N  +ET+    +N+    
Sbjct  378  YQEFKQENKQWNSSGGGQSSSGN---FNSYGSSSWDDWDQKDNRKQETTKGTGSNSSDGW  434

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  361
               D   D   D YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  435  AGWDDGKDDGFDHYQSASVSKAAGHNGKSDSTWTGGGF  472



>gb|KHN05918.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Glycine 
soja]
Length=301

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 118/190 (62%), Gaps = 36/190 (19%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVT KT EIGQRTWGIMKGV+A+ASQK+EEYTK+D  NWKND+WQRNE++ NGYY
Sbjct  113  NETVNVVTQKTSEIGQRTWGIMKGVMAMASQKIEEYTKDDP-NWKNDNWQRNENDTNGYY  171

Query  642  QDFNH-------------------------------NskglnssgggggqsssGRQFNSV  556
            QDFN                                +          G   SSG QF++ 
Sbjct  172  QDFNQEKKGWNSSTGREQSSSGEYKTQSSSSWDDWDHKDSRKEEPAKGSTHSSGGQFSTY  231

Query  555  NSGSWDNWDTKGNNTKE----TSPANNdswagwddakddgfddFYQSAHDNKHVGHNGKS  388
            NS SWD+W+ K +  +E    ++P NND WAGWD+AKDDGFD+ Y+ A + K VGH GKS
Sbjct  232  NSSSWDDWEHKDSRKEEPAKGSAPHNNDDWAGWDNAKDDGFDNIYEGASNKKGVGHKGKS  291

Query  387  DTKWSDGGFL  358
            D  W++ GFL
Sbjct  292  DGTWTEEGFL  301



>ref|XP_002527750.1| arf gtpase-activating protein, putative [Ricinus communis]
 gb|EEF34663.1| arf gtpase-activating protein, putative [Ricinus communis]
Length=457

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 104/160 (65%), Gaps = 12/160 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ+TWGIMKGV+A+ASQKVEEY KE         WQRNESE NGYY
Sbjct  305  NETVNVVTAKTTEIGQKTWGIMKGVMAIASQKVEEYAKEGG-------WQRNESESNGYY  357

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKG----NNTKETSPANNds-w  478
            Q+FN       +S   GGQSSS   +NS +S SWD+WD K     ++ K T   NND   
Sbjct  358  QEFNKQENKGWNSSSAGGQSSSSGHYNSYSSNSWDDWDQKDTRKEDSIKVTGSHNNDGWA  417

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   +   D+FYQSA D K VGHNGKSD  W+ GGFL
Sbjct  418  GWDDAKDEGFDDNFYQSAPDKKAVGHNGKSDATWTGGGFL  457



>ref|XP_007144453.1| hypothetical protein PHAVU_007G157400g [Phaseolus vulgaris]
 gb|ESW16447.1| hypothetical protein PHAVU_007G157400g [Phaseolus vulgaris]
Length=482

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 115/191 (60%), Gaps = 37/191 (19%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV VVT KT EIGQRTWGIMKGV+A+ASQK+EEYT++D  NWK D+WQRN+S++NGYY
Sbjct  293  NETVTVVTQKTSEIGQRTWGIMKGVMAMASQKIEEYTRDDP-NWKTDNWQRNDSDRNGYY  351

Query  642  QDFN--------------------------------HNskglnssgggggqsssGRQFNS  559
            QDFN                                H          G    SSG Q ++
Sbjct  352  QDFNQQNKGLNSSPGRDQSSSGQYKTHSSSSLDDWDHRDSRKEVPAKGTAPYSSGGQSST  411

Query  558  VNSGSWDNWD----TKGNNTKETSPANNdswagwddakddgfddFYQSAHDNKHVGHNGK  391
             NS SWD+W+     K    K  +P NND WAGWD+AKDDGFD FYQ A + K VGHNGK
Sbjct  412  YNSSSWDDWEHTDSRKQEPAKAAAPHNNDDWAGWDNAKDDGFDHFYQDASNKKGVGHNGK  471

Query  390  SDTKWSDGGFL  358
            SD  W++GGFL
Sbjct  472  SDGTWTEGGFL  482



>ref|XP_010037851.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Eucalyptus grandis]
 ref|XP_010037852.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Eucalyptus grandis]
 gb|KCW49632.1| hypothetical protein EUGRSUZ_K03154 [Eucalyptus grandis]
 gb|KCW49633.1| hypothetical protein EUGRSUZ_K03154 [Eucalyptus grandis]
Length=466

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVT KT EIGQRTWGIMKGV+A+ASQKVEEYTK D  +W N++WQRN++E+NGYY
Sbjct  311  NETVNVVTNKTTEIGQRTWGIMKGVMAIASQKVEEYTK-DGVSWNNENWQRNDNERNGYY  369

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET----SPANNdswa  475
            Q+F   +KG N+S GG   SS   Q  + +S SWD+WD K N  +ET    +  NND WA
Sbjct  370  QEFKQENKGWNASSGGQSSSSGNVQ--TFSSTSWDDWDHKDNKKEETTKGGTSGNNDGWA  427

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWDDAK+DG D++YQSA +    GHNGKSD  W++GGFL
Sbjct  428  GWDDAKEDGHDNWYQSAPNKGTAGHNGKSDATWTEGGFL  466



>ref|XP_009374672.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
 ref|XP_009374673.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
Length=471

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 116/159 (73%), Gaps = 9/159 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKND-SWQRNESEQNGY  646
            NETVNVVTAKT EIGQRTWGIMKGV+A+ASQKVEEYTK D  NWK + +WQRN+SEQNGY
Sbjct  316  NETVNVVTAKTSEIGQRTWGIMKGVMAMASQKVEEYTK-DGTNWKAENNWQRNDSEQNGY  374

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA----NNdsw  478
            YQ+F   +K  NSS  GG  SS     NS  S SWD+WD K    +ET+      +ND W
Sbjct  375  YQEFKQENKEWNSSSVGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGMGSNSNDGW  432

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  361
            AGWDD KDDG+D+ YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  433  AGWDDGKDDGYDNAYQSASISK-AGHNGKSDSAWTGGGF  470



>ref|XP_008366719.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
 ref|XP_008366720.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
Length=473

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 110/159 (69%), Gaps = 9/159 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKND-SWQRNESEQNGY  646
            NETVNVVTAKT EIGQRTWGIMKGV+A+ASQKVEEYTK D  NWK + +WQRN+SEQNGY
Sbjct  318  NETVNVVTAKTSEIGQRTWGIMKGVMAMASQKVEEYTK-DGTNWKAENNWQRNDSEQNGY  376

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw-  469
            YQ+F   +K  NSS  GG  SS     NS  S SWD+WD K    +ET+     +     
Sbjct  377  YQEFKQENKEWNSSSIGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGTGSNSNDGW  434

Query  468  ---ddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  361
               DD KDDG+D+ YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  435  AGWDDGKDDGYDNAYQSASISK-AGHNGKSDSAWTGGGF  472



>gb|EYU26574.1| hypothetical protein MIMGU_mgv11b004906mg [Erythranthe guttata]
Length=461

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 110/162 (68%), Gaps = 16/162 (10%)
 Frame = -3

Query  819  ETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQ  640
            ETV+VVTAKT EIGQ+TWG+MKGV+ALASQKVEE+TKE +G       QRNE++  GYYQ
Sbjct  308  ETVSVVTAKTSEIGQKTWGLMKGVMALASQKVEEFTKEGSGP------QRNENDSTGYYQ  361

Query  639  DFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETS---PANNdswagw  469
            +F H+      +   G QSSS RQFNSV+S +WD+WD K +  +++S   PA        
Sbjct  362  EFGHD--SKGWNSSTGAQSSSTRQFNSVSSSAWDDWDVKDSRKEDSSKGAPAPPSKGDES  419

Query  468  ----ddakddgfddFYQSAHDNKHVGHNGKS-DTKWSDGGFL  358
                DD KDDG+D FY SA D   VG+NGKS D+KW+ GGFL
Sbjct  420  WTGWDDGKDDGYDSFYHSAPDKNSVGYNGKSDDSKWTGGGFL  461



>ref|XP_003537172.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=479

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 118/190 (62%), Gaps = 37/190 (19%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVT KT EIGQRTWGIMKGV+A+ASQK+EEYTK+D  NWKND+WQRNE++ NGYY
Sbjct  292  NETVNVVTQKTSEIGQRTWGIMKGVMAMASQKIEEYTKDDP-NWKNDNWQRNENDTNGYY  350

Query  642  QDFNH-------------------------------NskglnssgggggqsssGRQFNSV  556
            QDFN                                +          G   SSG QF++ 
Sbjct  351  QDFNREKKGWNSSTGREQSSSGEYKTESSSSWDDWDHKDSRKEEPAKGSTHSSGGQFSTY  410

Query  555  NSGSWDNWDTKGNNTKE----TSPANNdswagwddakddgfddFYQSAHDNKHVGHNGKS  388
            NS SWD+W+ K +  +E    ++P NND WAGWD+AKDDGFD+ Y+ A + K VGH GKS
Sbjct  411  NSSSWDDWEHKDSRKEEPAKGSAPHNNDDWAGWDNAKDDGFDNIYEGA-NKKGVGHKGKS  469

Query  387  DTKWSDGGFL  358
            D  W++ GFL
Sbjct  470  DGTWTEEGFL  479



>ref|XP_004249530.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Solanum lycopersicum]
Length=459

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 107/158 (68%), Gaps = 8/158 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIGQ+ WGIMKGVLALASQKVEE+   +  N ++DSWQR+E+E+NG+Y
Sbjct  307  NETVNVVATKTTEIGQKGWGIMKGVLALASQKVEEFA--EGPNPRDDSWQRSENERNGHY  364

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGN---NTKETSPANNdswag  472
            ++   +S+        GG  SSGRQ N+V+S SWD+WD+K N   N    + ++ND    
Sbjct  365  KE---SSQASKGWNSSGGAQSSGRQANAVSSASWDDWDSKDNKKENPTGGATSSNDDGWA  421

Query  471  wddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
              D   D   D +Q A +NKHV H GKS++KW+DGGFL
Sbjct  422  GWDDGKDDGFDNFQRAPNNKHVAHGGKSESKWTDGGFL  459



>ref|XP_010529843.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Tarenaya hassleriana]
Length=464

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 102/161 (63%), Gaps = 14/161 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIGQRTWGIMKGV+A+ASQKVEE+TKE   ++K D +Q NE+E+N YY
Sbjct  312  SETVNVVATKTTEIGQRTWGIMKGVMAMASQKVEEFTKEGT-SFKADGFQPNETERNMYY  370

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNW------DTKGNNTKETSPANNds  481
            QDF H +K  NSS  G           S NS SWD+W      + K    K+ S +N++ 
Sbjct  371  QDFGHGNKAANSSSSGYYN-------KSNNSNSWDDWGESDNYNKKEAAQKKVSGSNDED  423

Query  480  wagwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
                 +  D   D FYQSA D K VGHNGKSDT W+ GGFL
Sbjct  424  GWAGWEDHDAKDDGFYQSAPDKKSVGHNGKSDTAWTGGGFL  464



>ref|XP_004495006.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like isoform X1 [Cicer arietinum]
Length=482

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 120/194 (62%), Gaps = 42/194 (22%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV VVT KT EIG RTWG+MKGV+ALASQKVEEYTKE N NWK DSWQRNE+++NGYY
Sbjct  292  NETVTVVTQKTSEIGHRTWGLMKGVMALASQKVEEYTKE-NSNWKADSWQRNENDRNGYY  350

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWD---------TKGNN--------  514
            QDFN  +KG +SS G    SS   QF + +S SWD+WD         TKG+         
Sbjct  351  QDFNQETKGGSSSTGREQSSSG--QFKTHSSNSWDDWDQKDSWKEEPTKGSTRYSSGVQV  408

Query  513  ---------------------TKETSPANNdsw-agwddakddgfddFYQSAHDNKHVGH  400
                                  K ++P NND+  AGWD+AKDDGFD+FY+ A + K  G 
Sbjct  409  GTHNPSSWDDWDHKDSRKEEPAKGSAPHNNDAGWAGWDNAKDDGFDNFYEGASNKKSAGR  468

Query  399  NGKSDTKWSDGGFL  358
            NGKSD  W+ GGFL
Sbjct  469  NGKSDDAWTGGGFL  482



>ref|XP_008345448.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
Length=471

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 106/158 (67%), Gaps = 7/158 (4%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EI QRTWGIMKGV+ALASQKVEEYTK+       ++WQRN+SEQNGYY
Sbjct  316  NETVNVVTAKTSEIXQRTWGIMKGVMALASQKVEEYTKDGTNGKAENNWQRNDSEQNGYY  375

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw--  469
            Q+F   +K  NSS  GG  SS     NS  S SWD+WD K    +ET+     +      
Sbjct  376  QEFKQENKEWNSSSVGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGTGSNSTDGWA  433

Query  468  --ddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  361
              DD KDDG+D+ YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  434  GWDDGKDDGYDNAYQSASISK-AGHNGKSDSAWTGGGF  470



>ref|XP_009621199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
Length=457

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 112/159 (70%), Gaps = 9/159 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIGQ+ WGIMKGVLALASQKVEEY  E   N K++SWQRNE+ QNGYY
Sbjct  304  NETVNVVATKTTEIGQKGWGIMKGVLALASQKVEEYA-EGGPNGKDNSWQRNENGQNGYY  362

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETS----PANNdswa  475
            Q+F+  SKG NSSGG           +SV+SGSWD+WD+K +N K+TS     ++ND   
Sbjct  363  QEFSKESKGWNSSGGAQSSGRHS---SSVSSGSWDDWDSK-DNRKQTSTKGATSSNDDGW  418

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   D +QSA +NKHVGH GKS++KW+DGGFL
Sbjct  419  AGWDDGKDDGYDNFQSASNNKHVGHGGKSESKWTDGGFL  457



>ref|XP_009338772.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
Length=471

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 102/157 (65%), Gaps = 5/157 (3%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIMKGV+ALASQKVEEYTK+       ++WQRN SEQNGYY
Sbjct  316  NETVNVVTAKTSEIGQRTWGIMKGVMALASQKVEEYTKDGTNGKAENNWQRNGSEQNGYY  375

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            Q+F   +K  NSS  GG  SS     NS  S SWD+WD K    +ET+     +      
Sbjct  376  QEFKQENKEWNSSSVGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGTGSNSNDGWA  433

Query  462  akddgfddFYQSAHDNKHV---GHNGKSDTKWSDGGF  361
              DDG DD Y +A+ +  +   GHNGKSD+ W+ GGF
Sbjct  434  GWDDGKDDGYDNAYRSASISKAGHNGKSDSAWTGGGF  470



>ref|XP_011019883.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Populus euphratica]
Length=468

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIMKGV+A+ASQKVEEYTKE       D+WQR++++ NGYY
Sbjct  314  NETVNVVTAKTTEIGQRTWGIMKGVMAIASQKVEEYTKEGR---NTDNWQRSDNQSNGYY  370

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET-----SPANNdsw  478
            Q+FN       +S  GG  SS     NS  S SWD+WD K N T+++     S +N+   
Sbjct  371  QEFNKQENKGWNSSSGGQYSSG--HHNSYGSSSWDDWDQKDNKTEDSIKSTASHSNDGWA  428

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   D+ YQS    K   HNGKSD  W+ GGFL
Sbjct  429  GWDDAKDDGYDDNIYQSVPSAKSASHNGKSDASWTGGGFL  468



>ref|XP_006339030.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Solanum tuberosum]
Length=459

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 107/158 (68%), Gaps = 8/158 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIGQ+ WGIMKGVLALASQKVEE+   +  N ++DSWQ++E+E+N +Y
Sbjct  307  NETVNVVATKTTEIGQKGWGIMKGVLALASQKVEEFA--EGPNPRDDSWQQSENERNSHY  364

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGN---NTKETSPANNdswag  472
            ++   +S+        GG  SSGRQ NSV+S SWD+WD+K N   N    + ++ND    
Sbjct  365  KE---SSQASKGWNSSGGAQSSGRQANSVSSASWDDWDSKDNRKENPTGGATSSNDDGWA  421

Query  471  wddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
              D   D   D +QSA +NKHV H GKS++KW+DGGFL
Sbjct  422  GWDDGKDDGFDNFQSAPNNKHVAHGGKSESKWTDGGFL  459



>ref|XP_008812043.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6, partial [Phoenix dactylifera]
Length=182

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 95/155 (61%), Gaps = 9/155 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VVT KT E+GQ+TWGIMKGV+A+ASQKV+EYTKE   NW  D WQR ESE+NG+Y
Sbjct  37   NETVSVVTMKTTEVGQKTWGIMKGVMAMASQKVDEYTKE-GINWNGDDWQRKESEKNGHY  95

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            QDF  +       G    + +S +++NSV+  SWD+WD K    +      N       D
Sbjct  96   QDFGQD------KGFNSSEGNSFKRYNSVS--SWDDWDEKEKKQEPEKGTQNSESWAGWD  147

Query  462  akddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D Y  +  NK V HNGKS + W++ GFL
Sbjct  148  DVKDDGYDNYSYSPSNKGVNHNGKSGSLWTESGFL  182



>ref|XP_012075017.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Jatropha curcas]
Length=213

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 106/160 (66%), Gaps = 8/160 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV AKT EIGQRTWGIM+GV+A+A+QKVEE +K+    WK D+WQ+NESE NGYY
Sbjct  57   NETVNVVAAKTTEIGQRTWGIMRGVMAMATQKVEELSKD---GWKADNWQQNESEGNGYY  113

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKG----NNTKET-SPANNdsw  478
            Q+FN       +S   GGQSSS   +NS +S SWD+WD K     ++TK T + +N+   
Sbjct  114  QEFNKQENKGWNSSSAGGQSSSSGNYNSYSSSSWDDWDQKDVRKEDSTKSTGTRSNDGWA  173

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   D+FYQ   D K VG NGKSD  W+ GGFL
Sbjct  174  GWDDGKDDGFDDNFYQREPDKKAVGPNGKSDDTWTGGGFL  213



>ref|XP_010937673.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Elaeis guineensis]
Length=464

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 94/155 (61%), Gaps = 9/155 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VVT KT E+GQ+TWGIMKGV+A+ASQKVEEYTKE   NWK D WQR ESEQNGYY
Sbjct  319  NETVSVVTMKTTEVGQKTWGIMKGVMAMASQKVEEYTKEGI-NWKGDDWQRKESEQNGYY  377

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            QDF  +       G    + +S + +NSV+  SWD+WD K    +      N       D
Sbjct  378  QDFGQD------KGWNSSEGNSFKHYNSVS--SWDDWDEKERKQEPGKGTQNSESWAGWD  429

Query  462  akddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D Y  +  NK V  NGKS + W++ GFL
Sbjct  430  DVKDDGYDNYNYSPSNKGVNQNGKSGSLWTESGFL  464



>ref|XP_010253247.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253248.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253249.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253250.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
Length=463

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = -3

Query  786  EIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQDFNHNskglns  607
            EIGQ+TWGIMKGV+A+ASQKVEEYTKE   NWK D+WQRN++E+NGYYQ+F      +  
Sbjct  320  EIGQKTWGIMKGVMAMASQKVEEYTKEGI-NWKADNWQRNDNEKNGYYQEFRQE--SMGW  376

Query  606  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET----SPANNdswagwddakddgfdd  439
            +  GGG SSSGRQFNSV+SGSWD+WD K +   E+    S  N DSWAGWDDAKDD +D+
Sbjct  377  NSSGGGYSSSGRQFNSVSSGSWDDWDNKDDRKDESRKGASSQNGDSWAGWDDAKDDDYDN  436

Query  438  FYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            FY  +   +  G NGKSDT+W+ GGFL
Sbjct  437  FYVGSSSKRLEGQNGKSDTRWTKGGFL  463



>gb|KDP35606.1| hypothetical protein JCGZ_09044 [Jatropha curcas]
Length=222

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 106/160 (66%), Gaps = 8/160 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV AKT EIGQRTWGIM+GV+A+A+QKVEE +K+    WK D+WQ+NESE NGYY
Sbjct  66   NETVNVVAAKTTEIGQRTWGIMRGVMAMATQKVEELSKD---GWKADNWQQNESEGNGYY  122

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKG----NNTKET-SPANNdsw  478
            Q+FN       +S   GGQSSS   +NS +S SWD+WD K     ++TK T + +N+   
Sbjct  123  QEFNKQENKGWNSSSAGGQSSSSGNYNSYSSSSWDDWDQKDVRKEDSTKSTGTRSNDGWA  182

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   D+FYQ   D K VG NGKSD  W+ GGFL
Sbjct  183  GWDDGKDDGFDDNFYQREPDKKAVGPNGKSDDTWTGGGFL  222



>ref|XP_002881515.1| hypothetical protein ARALYDRAFT_482750 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57774.1| hypothetical protein ARALYDRAFT_482750 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 103/162 (64%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N++E NGYY
Sbjct  299  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKTEGNGYY  354

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw--  469
            Q+    +K  NSS GG   SSSG   +  NS SWD+W  + N  KE +P  + S      
Sbjct  355  QNSGIGNKTANSSFGGSQSSSSGHNNSYRNSNSWDDWGEENNTKKEPAPKVSTSNDDDDG  414

Query  468  -----ddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
                 DD      D +YQSA D K VGHNGKSDT W+ GGFL
Sbjct  415  GWAGWDDNDAKDDDFYYQSASDKKSVGHNGKSDTAWTGGGFL  456



>ref|NP_181291.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 ref|NP_001031503.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 sp|O80925.1|AGD7_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein 
AGD7; Short=ARF GAP AGD7; AltName: Full=Protein ARF-GAP DOMAIN 
7; Short=AtAGD7; AltName: Full=Protein PDE1 SUPPRESSOR 
1 [Arabidopsis thaliana]
 gb|AAL32010.1|AF436828_1 At2g37550/F13M22.5 [Arabidopsis thaliana]
 gb|AAC23626.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 dbj|BAA75744.1| Asp1 [Arabidopsis thaliana]
 gb|AAK59488.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 gb|AAL34251.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 gb|AAM65362.1| At2g37550/F13M22.5 [Arabidopsis thaliana]
 gb|AEC09414.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 gb|AEC09415.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
Length=456

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 103/162 (64%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N++E NGYY
Sbjct  299  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKTEGNGYY  354

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw--  469
            Q+    +K  NSS GG   SSSG   +  NS SWD+W  + N+ KE +P  + S      
Sbjct  355  QNSGIGNKTANSSFGGSQSSSSGHNNSYRNSNSWDDWGEENNSKKEAAPKVSTSNDDDDG  414

Query  468  -----ddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
                 DD      D +YQ A D K VGHNGKSDT W+ GGFL
Sbjct  415  GWAGWDDNDAKDDDFYYQPASDKKSVGHNGKSDTAWTGGGFL  456



>ref|XP_003554321.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Glycine max]
Length=489

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 110/194 (57%), Gaps = 42/194 (22%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV+ KT EIGQRTWG+MKGV+ALASQKVEE+ + DN NW +D+WQRNES++NG+Y
Sbjct  299  NETVNVVSQKTTEIGQRTWGMMKGVMALASQKVEEFAR-DNPNWTSDNWQRNESDRNGFY  357

Query  642  QDFN---------------------------------HNskglnssgggggqsssGRQFN  562
            Q+FN                                 HN         G    SSG +F+
Sbjct  358  QEFNRENNGRNSSTREGQHSSGGQTNTFHSSSWDDWGHNDFRKEEPAKGSAPQSSGGKFD  417

Query  561  SVNSGSWDNWDTKGNNTKETSPANNdswagwdd------akddgfddFYQSAHDNKHVGH  400
            + NS SWD+WD +  +T++  PA   S    D       AKDDGFDD Y SA ++K V H
Sbjct  418  NYNSSSWDDWDQE--DTRKKEPAKGSSARSSDGWAGWDNAKDDGFDDIYGSASNSKGVTH  475

Query  399  NGKSDTKWSDGGFL  358
            N KS   W+ GGFL
Sbjct  476  NDKSGAAWTGGGFL  489



>ref|XP_002309050.1| PDE1 SUPPRESSOR 1 family protein [Populus trichocarpa]
 gb|EEE92573.1| PDE1 SUPPRESSOR 1 family protein [Populus trichocarpa]
Length=471

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQRTWGIMKGV+A+ASQKVEEYTKE       D+WQ+++++ NGYY
Sbjct  317  NETVNVVTAKTTEIGQRTWGIMKGVMAIASQKVEEYTKEGR---NTDNWQQSDNQSNGYY  373

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET-----SPANNdsw  478
            Q+FN       +S  GG  SS     NS  S SWD+WD K N  +++     S +N+D  
Sbjct  374  QEFNKQENKGWNSSSGGQSSSG--HHNSYGSSSWDDWDQKDNRKEDSIKSTASHSNDDWA  431

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   D+ Y SA   K   HNGKSD  W+ GGFL
Sbjct  432  GWDDAKDDGYDDNIYHSAPSTKSASHNGKSDASWTGGGFL  471



>ref|XP_012092892.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Jatropha curcas]
 gb|KDP20155.1| hypothetical protein JCGZ_00032 [Jatropha curcas]
Length=465

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 106/160 (66%), Gaps = 8/160 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV AKT EIGQRTWGIM+GV+A+A+QKVEE +K+    WK D+WQ+NESE NGYY
Sbjct  309  NETVNVVAAKTTEIGQRTWGIMRGVMAMATQKVEELSKD---GWKADNWQQNESESNGYY  365

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKG----NNTKET-SPANNdsw  478
            Q+FN       +S   GGQSSS   +NS +S SWD+WD K     ++TK T + +N+   
Sbjct  366  QEFNKQENKGWNSSSAGGQSSSSGNYNSYSSSSWDDWDQKDVRKEDSTKSTGTRSNDGWA  425

Query  477  agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   D+FYQ   D K VG NGKSD  W+ GGFL
Sbjct  426  GWDDGKDDGFDDNFYQREPDKKAVGPNGKSDDTWTGGGFL  465



>gb|KJB76702.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76703.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76704.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76705.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76706.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76707.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
Length=462

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 115/159 (72%), Gaps = 7/159 (4%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VVTAKT EIG RTWGI+KGV+ALASQKVEEY K D  NWKND+W +NESE+NG++
Sbjct  307  NETVSVVTAKTTEIGHRTWGIVKGVMALASQKVEEYAK-DGMNWKNDNWPQNESEKNGHH  365

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNN----TKETSPANNdswa  475
            Q  N  +KG NS+ GG   S      NS  S SWD+WDTK N     T+ T+  +ND+WA
Sbjct  366  QGSNQGNKGWNSTSGGQPSSGGNS--NSRTSSSWDDWDTKDNRKEGTTEVTTSHSNDAWA  423

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWD+AKDDG+D+FY    + + VG NGKSD  WS GGFL
Sbjct  424  GWDEAKDDGYDNFYNGTSNKRAVGDNGKSDVTWSGGGFL  462



>ref|XP_006410942.1| hypothetical protein EUTSA_v10016645mg [Eutrema salsugineum]
 gb|ESQ52395.1| hypothetical protein EUTSA_v10016645mg [Eutrema salsugineum]
Length=453

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 102/166 (61%), Gaps = 18/166 (11%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+  +W     Q+N++E NGYY
Sbjct  295  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEETSSWN----QQNKNEGNGYY  350

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTK-----ETSPANNds-  481
            Q+   N     S            Q N  NS SWD+W  + NNTK     + S +N+D  
Sbjct  351  QNKTANPSLGGSHSSSSSSGH---QNNYRNSNSWDDWGEENNNTKKEAAQKVSTSNDDDG  407

Query  480  -----wagwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
                     D   DDG+D +YQSA D K VGHNGKSDT W+ GGFL
Sbjct  408  GWAGWDDDNDTKDDDGYDGYYQSAGDKKSVGHNGKSDTAWTGGGFL  453



>ref|XP_003521336.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=486

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 110/195 (56%), Gaps = 43/195 (22%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV+ KT EIGQRTWGIMKGV+ALASQKVEE+ + DN NW +D+WQRNES++NG+Y
Sbjct  295  NETVNVVSQKTSEIGQRTWGIMKGVMALASQKVEEFAR-DNPNWMSDNWQRNESDRNGFY  353

Query  642  QDFN---------------------------------HNskglnssgggggqsssGRQF-  565
            Q+FN                                 HN      +  G    SSG +F 
Sbjct  354  QEFNRENNGRNSSTREGQHSSGGQTNTFHSSSWDDWGHNDSRKEETAKGSAPQSSGGKFD  413

Query  564  NSVNSGSWDNWDTKGNNTKETSPANNdswagwdd------akddgfddFYQSAHDNKHVG  403
            N+ NS SWD+WD +  +T++  PA   +    D       AKDDGFDD Y SA +NK   
Sbjct  414  NNYNSSSWDDWDQE--DTRKKEPAKGSAAHSSDGWTGWDNAKDDGFDDIYGSASNNKGGA  471

Query  402  HNGKSDTKWSDGGFL  358
            HN KS   W+ GGFL
Sbjct  472  HNDKSGAAWTGGGFL  486



>dbj|BAE71192.1| putative Asp1 [Trifolium pratense]
 dbj|BAE71286.1| putative Asp1 [Trifolium pratense]
Length=477

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 120/192 (63%), Gaps = 38/192 (20%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VVT KT EIGQRTWG+MKGV+ALASQKVEEYTKE N N   ++WQRNE+++NGYY
Sbjct  287  NETVSVVTQKTSEIGQRTWGLMKGVMALASQKVEEYTKE-NSNSTTNNWQRNENDRNGYY  345

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNS-----------------------------  550
            QDFN  +KG+NS+ G     S   + NS NS                             
Sbjct  346  QDFNQENKGINSTTGREQSLSGQFKTNSSNSWDDWDHKNSWKEGQTKGSTPYSSGGQSGT  405

Query  549  ---GSWDNWDTKGNNTKE----TSPANNdsw-agwddakddgfddFYQSAHDNKHVGHNG  394
                SWD+WD K +  +E    ++P NND+  AGWD+AKDDGFD+FY  A + K VGHNG
Sbjct  406  HNPSSWDDWDNKDSRKEEPAKGSAPHNNDAGWAGWDNAKDDGFDNFYDGASNKKTVGHNG  465

Query  393  KSDTKWSDGGFL  358
            KSD  W+ GGFL
Sbjct  466  KSDDAWTGGGFL  477



>gb|KHG23489.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Gossypium 
arboreum]
Length=462

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 114/159 (72%), Gaps = 7/159 (4%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VVTAKT EIG RTWGI+KGV+ALASQKVEEY K D  NWKND+W +NESE+NG++
Sbjct  307  NETVSVVTAKTTEIGHRTWGIVKGVMALASQKVEEYAK-DGMNWKNDNWPQNESEKNGHH  365

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNN----TKETSPANNdswa  475
            Q    N      +   GGQSSSG   NS  S SWD+WDTK N     T+ T+  +ND WA
Sbjct  366  Q--GSNQGNKGWNSTSGGQSSSGGNSNSCTSSSWDDWDTKDNRKEGTTEVTTSHSNDGWA  423

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            GWD+AKDDG+D+FY  A + + VG NGKSD  WS GGFL
Sbjct  424  GWDEAKDDGYDNFYNGASNKRAVGDNGKSDATWSGGGFL  462



>gb|KEH42388.1| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=481

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 116/193 (60%), Gaps = 39/193 (20%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV VVT KT EIGQRTWG+MKGV+ALASQKVEEYTKE N N   ++WQRNES++NGYY
Sbjct  290  NETVTVVTQKTSEIGQRTWGLMKGVMALASQKVEEYTKE-NSNSTTNNWQRNESDRNGYY  348

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNS-----------------------------  550
            QDFN  +KG NSS G    SS   +  S NS                             
Sbjct  349  QDFNQGNKGGNSSTGREQSSSGQYKTQSSNSWDDWGQKDSWKGEPANKGSTPYSSGGQSG  408

Query  549  ----GSWDNWDTKGNN----TKETSPANNdsw-agwddakddgfddFYQSAHDNKHVGHN  397
                 SWD+WD K +      K ++P NND   AGWD+AKDDGFD+FY+ A + K  GHN
Sbjct  409  THNPSSWDDWDHKDSRKEEPAKSSAPHNNDVGWAGWDNAKDDGFDNFYEGASNKKAAGHN  468

Query  396  GKSDTKWSDGGFL  358
            GKSD  W+ GGFL
Sbjct  469  GKSDDAWTGGGFL  481



>ref|XP_004253319.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Solanum lycopersicum]
Length=437

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 91/162 (56%), Gaps = 30/162 (19%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N++E NGY 
Sbjct  299  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKTEGNGYS  354

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw--  469
                HN+                      NS SWD+W  + N+ KE +P  + S      
Sbjct  355  SSSGHNNSYR-------------------NSNSWDDWGEENNSKKEAAPKVSTSNDDDDG  395

Query  468  -----ddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
                 DD      D +YQ A D K VGHNGKSDT W+ GGFL
Sbjct  396  GWAGWDDNDAKDDDFYYQPASDKKSVGHNGKSDTAWTGGGFL  437



>ref|XP_006403662.1| hypothetical protein EUTSA_v10010333mg [Eutrema salsugineum]
 gb|ESQ45115.1| hypothetical protein EUTSA_v10010333mg [Eutrema salsugineum]
Length=476

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 99/168 (59%), Gaps = 17/168 (10%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIGQRTWGIMKGV+A+A+QKVEEYTKE   +W     Q+NE+E NGYY
Sbjct  313  SETVNVVAHKTTEIGQRTWGIMKGVMAIATQKVEEYTKEGTTSWN----QQNENESNGYY  368

Query  642  QDF---NHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKE-----TSPANN  487
            Q+F   N  +      GG    SSSG   NS  S SWD+W    +  KE      S A+N
Sbjct  369  QNFGNGNKAANSSVGGGGRQESSSSGHDNNSHKSNSWDDWGEDESKKKEAVAPKASSASN  428

Query  486  dswagwddakddgfddF-----YQSAHDNKHVGHNGKSDTKWSDGGFL  358
            D          D  DD      YQSA D K VGHNGKSDT W+ GGFL
Sbjct  429  DDDGWTGWDDHDPKDDDGFDGYYQSAGDKKSVGHNGKSDTAWTGGGFL  476



>ref|XP_010504141.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=467

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIG RTWGIMKGV+A+A+QKV EYTKE   +W     Q++ESE NGYY
Sbjct  306  SETVNVVATKTTEIGHRTWGIMKGVMAMATQKVGEYTKEGTTSWN----QQSESESNGYY  361

Query  642  QDF-NHNskglnssgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswag  472
            Q+F N N     S GGG  QSSS  Q+ NS  S SWD+W + +   T+  +P  + +   
Sbjct  362  QNFGNGNKAANPSVGGGRSQSSSSGQYNNSQKSNSWDSWGENENRKTEAAAPKGSSASND  421

Query  471  wddakddgfddF--------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
             D        D         YQSA D K VGHNGKSDT W+ GGFL
Sbjct  422  DDGWTGWDDHDAKDDGFDGHYQSAGDQKSVGHNGKSDTAWTGGGFL  467



>ref|XP_010427029.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=468

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIG RTWGIMKGV+A+A+QKV EYTKE   +W     Q++ESE NGYY
Sbjct  307  SETVNVVANKTTEIGHRTWGIMKGVMAMATQKVGEYTKEGTTSWN----QQSESESNGYY  362

Query  642  QDF-NHNskglnssgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswag  472
            Q+F N N     S GGG  QSSS  Q+ NS  S SWD+W + +   T+  +P  + +   
Sbjct  363  QNFGNGNKAANPSVGGGRSQSSSSGQYNNSQKSNSWDSWGENENRKTEAAAPKGSSASND  422

Query  471  wddakddgfddF--------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
             D        D         YQSA D K VGHNGKSDT W+ GGFL
Sbjct  423  DDGWTGWDDHDAKDDGFDGHYQSAGDQKSVGHNGKSDTAWTGGGFL  468



>ref|XP_010515873.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=467

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 100/166 (60%), Gaps = 15/166 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIG RTWGIMKGV+A+A+QKV EYTKE   +W     Q++ESE NGYY
Sbjct  306  SETVNVVANKTTEIGHRTWGIMKGVMAMATQKVGEYTKEGTTSWN----QQSESESNGYY  361

Query  642  QDF-NHNskglnssgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswag  472
            Q+F N N     S GGG  QSSS  Q+ NS  S SWD+W + +   T+  +P  + +   
Sbjct  362  QNFGNGNKAANPSVGGGRSQSSSSGQYNNSQKSNSWDSWGENENKKTEAAAPKGSSASND  421

Query  471  wddakddgfddF--------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
             D        D         YQSA D K VGHNGKSDT W+ GGFL
Sbjct  422  DDGWTGWDDHDAKDDGFDGHYQSAGDQKSVGHNGKSDTAWTGGGFL  467



>ref|XP_011094837.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Sesamum indicum]
Length=468

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 107/160 (67%), Gaps = 7/160 (4%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIGQ+TWG+M+GV+ALA+QKVEEYTKE +G WKND+WQR ES  NGYY
Sbjct  311  NETVNVVTAKTSEIGQKTWGLMRGVMALATQKVEEYTKEGSG-WKNDNWQRKESNSNGYY  369

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw--  469
            Q+F        +S       SSGRQ  SV+S SWD+WDTK +  +E              
Sbjct  370  QEFGQE-SKGWNSAAASQPPSSGRQVASVSSSSWDDWDTKDSRKQEPPEGKTTQDVDSWA  428

Query  468  --ddakddgfddFYQSAHD-NKHVGHNGKSDTKWSDGGFL  358
              DDAKDDG+D+ Y SA D  K    NGKSD KW++GGFL
Sbjct  429  GWDDAKDDGYDNSYHSASDYRKTTSINGKSDAKWTEGGFL  468



>ref|XP_006429044.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
 ref|XP_006429045.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
 gb|ESR42284.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
 gb|ESR42285.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
Length=132

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 102/139 (73%), Gaps = 12/139 (9%)
 Frame = -3

Query  759  MKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQDFNHNskglnssgggggqss  580
            MKGV+A+ASQKVEEYTKE    W ND+WQRNESE NGYYQ+FNH +KG +S  GGG  S+
Sbjct  1    MKGVMAMASQKVEEYTKE---GWNNDNWQRNESESNGYYQEFNHGNKGQDSPAGGGQYSA  57

Query  579  sGRQFNSVNSGSWDNWDTKGNNTKETSP-----ANNdswagwddakddgfddFYQSAHDN  415
                 NS  S SWD+WD K  + KE +P      NND+WAGWDDAKDDG+D+FYQSA D 
Sbjct  58   G--HHNSYGSSSWDDWDQK--DKKEDTPKGTGSGNNDAWAGWDDAKDDGYDNFYQSASDK  113

Query  414  KHVGHNGKSDTKWSDGGFL  358
            K +GHNGKSD  W+ GGFL
Sbjct  114  KALGHNGKSDATWTGGGFL  132



>ref|XP_009116065.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brassica rapa]
Length=454

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 96/161 (60%), Gaps = 10/161 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSW-QRNESEQNGY  646
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKV EYTKE        SW QRNESE NGY
Sbjct  294  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVGEYTKEGT---TTTSWNQRNESESNGY  350

Query  645  YQDFNHNskglnssgggggqsssGRQFNSV--NSGSWDNWDTKGNNTKETSPANNdswag  472
            YQ+F + +K  N S  G G  SS   + +    S SWD+W    +  KE   +   S + 
Sbjct  351  YQNFGNGNKAANPSVEGKGSQSSSSGYYNNSHKSNSWDDWGENESKKKEAVASKGSSASN  410

Query  471  wddakddgfddF----YQSAHDNKHVGHNGKSDTKWSDGGF  361
             DD      D      YQSA D K  GHNGKSDT W+ GGF
Sbjct  411  DDDGWTGWDDPKDDVYYQSAGDKKSAGHNGKSDTAWTGGGF  451



>emb|CDX78196.1| BnaA09g33910D [Brassica napus]
Length=445

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 97/161 (60%), Gaps = 11/161 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSW-QRNESEQNGY  646
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKV EYTKE     K  SW QRNESE NGY
Sbjct  288  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVGEYTKEG----KTTSWNQRNESESNGY  343

Query  645  YQDFNHNskglnssgggggqsssGRQFNSV--NSGSWDNWDTKGNNTKETSPANNdswag  472
            YQ+F + +K  N S  G G  SS   + +    S SWD+W    +  KE   +   S + 
Sbjct  344  YQNFGNGNKAANPSVEGRGSQSSSSGYYNNSHKSNSWDDWGENESKKKEAVASKGSSASN  403

Query  471  wddakddgfddF----YQSAHDNKHVGHNGKSDTKWSDGGF  361
             DD      D      YQSA D K  GHNGKS+T W+ GGF
Sbjct  404  DDDGWTGWDDPKDDVYYQSAGDKKSAGHNGKSNTAWTGGGF  444



>ref|XP_006294027.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 ref|XP_006294028.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 gb|EOA26925.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 gb|EOA26926.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
Length=516

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 99/162 (61%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N++E NG+Y
Sbjct  359  SETVNVVANKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKNEGNGFY  414

Query  642  QDFNH-NskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwd  466
            Q+    N    +S GG    SSSG+  +  NS SWD+W  + +  KE +P  + S    D
Sbjct  415  QNSGFGNKTANSSFGGSQSSSSSGQNNSYRNSNSWDDWGEEKDTKKEAAPKVSTSNDDDD  474

Query  465  dakddgfddF------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
                   +D       YQSA   K VGHNGKSDT W+ GGFL
Sbjct  475  GWAGWDDNDAKDDDFYYQSAGAKKSVGHNGKSDTAWTGGGFL  516



>ref|XP_010505344.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Camelina sativa]
Length=459

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 100/161 (62%), Gaps = 10/161 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N++E NG Y
Sbjct  303  SETVNVVANKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKNEGNGLY  358

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            Q+    +K  NSS GG   SSSG+  +  NS SWD+W  + +  KE +P  + S    D 
Sbjct  359  QNSGFGNKTANSSFGGSQSSSSGQNNSYRNSNSWDDWGDEKDTKKEAAPKVSTSNDDDDG  418

Query  462  akddgfddF------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
                  +D       YQSA   K VGHNGKSD+ W+ GGFL
Sbjct  419  WAGWDDNDAKDDDFYYQSAGAKKSVGHNGKSDSAWTGGGFL  459



>ref|XP_006291063.1| hypothetical protein CARUB_v10017178mg [Capsella rubella]
 gb|EOA23961.1| hypothetical protein CARUB_v10017178mg [Capsella rubella]
Length=468

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 102/166 (61%), Gaps = 15/166 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIG RTWGIMKGV+A+A+QKVEEYTKE   +W     Q++E+E NGYY
Sbjct  307  SETVNVVANKTTEIGHRTWGIMKGVMAMATQKVEEYTKEGTTSWN----QQSENESNGYY  362

Query  642  QDF-NHNskglnssgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswag  472
            Q+F N N   ++S GGG  QSSS   + NS  S SWD+W + +   T+  +P  + +   
Sbjct  363  QNFGNGNKAAISSVGGGRSQSSSSGHYDNSQKSNSWDSWGENENRKTEAAAPKGSLASND  422

Query  471  wddakddgfddF--------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
             D        D         YQSA D K VGHNGKSD+ W+ GGFL
Sbjct  423  DDGWTGWDDHDAKDDGFDGHYQSAGDKKSVGHNGKSDSAWTGGGFL  468



>ref|XP_007027081.1| ARF-GAP domain 7 isoform 2 [Theobroma cacao]
 gb|EOY07583.1| ARF-GAP domain 7 isoform 2 [Theobroma cacao]
Length=397

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTA+T EIGQRTWGIMKGV+A+ASQKVEEYTK D  NWKN++WQRN+SE+NGYY
Sbjct  312  NETVNVVTARTSEIGQRTWGIMKGVMAIASQKVEEYTK-DGMNWKNENWQRNDSEKNGYY  370

Query  642  QDFNH  628
            Q+F  
Sbjct  371  QEFKQ  375



>ref|NP_190939.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 ref|NP_001030854.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 sp|Q9M354.1|AGD6_ARATH RecName: Full=Probable ADP-ribosylation factor GTPase-activating 
protein AGD6; Short=ARF GAP AGD6; AltName: Full=Protein 
ARF-GAP DOMAIN 6; Short=AtAGD6; AltName: Full=Protein ZIGA2 
[Arabidopsis thaliana]
 emb|CAB88333.1| putative protein [Arabidopsis thaliana]
 gb|ABO45696.1| At3g53710 [Arabidopsis thaliana]
 gb|AEE79130.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 gb|AEE79131.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
Length=459

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 97/167 (58%), Gaps = 16/167 (10%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIG RTWGIMKGV+A+A+QKVEE+TKE + +W     Q++E+E NGYY
Sbjct  297  SETVNVVANKTTEIGHRTWGIMKGVMAMATQKVEEFTKEGSTSWN----QQSENEGNGYY  352

Query  642  QDF---NHNskglnssgggggqsssGRQFNSVNSGSWDNW-DTKGNNTKETSPANNdswa  475
            Q+F   N  +      G     S+SG   NS NS SWD+W + +   T+  +P  + +  
Sbjct  353  QNFGNGNKAANSSVGGGRPQSSSTSGHYNNSQNSNSWDSWGENENKKTEAVAPKGSSASN  412

Query  474  gwddakddgfddF--------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
              D        D         YQSA D K  GHNGKSDT W+ GGFL
Sbjct  413  DDDGWTGWDDHDAKDDGFDGHYQSAGDKKSAGHNGKSDTAWTGGGFL  459



>ref|XP_002877936.1| hypothetical protein ARALYDRAFT_485760 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54195.1| hypothetical protein ARALYDRAFT_485760 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 101/166 (61%), Gaps = 15/166 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIG RTWGIMKGV+A+A+QKVEE+TKE   +W     Q++ESE NGYY
Sbjct  299  SETVNVVANKTTEIGHRTWGIMKGVMAMATQKVEEFTKEGTTSWN----QQSESEGNGYY  354

Query  642  QDF-NHNskglnssgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswag  472
            Q+F N N    +S GGG  QSSS   + NS NS SWD+W + +   T+  +P  + +   
Sbjct  355  QNFGNGNKAANSSVGGGRSQSSSSGHYNNSQNSNSWDSWGENENKKTEAAAPKGSSASND  414

Query  471  wddakddgfddF--------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
             D        D         YQSA D K VGHN KSD+ W+ GGFL
Sbjct  415  DDGWTGWDDHDAKDDGFDGHYQSAGDKKSVGHNEKSDSAWTGGGFL  460



>ref|XP_010517025.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Camelina sativa]
Length=460

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 99/162 (61%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N++E NG Y
Sbjct  303  SETVNVVANKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKNEGNGLY  358

Query  642  QDFNHNskglnssgggggqsssGRQFNSV-NSGSWDNWDTKGNNTKETSPANNdswagwd  466
            Q+    +K  NSS  GG QSSS    N   NS SWD+W  + +  KE +P  + S    D
Sbjct  359  QNSGFGNKTANSSSFGGSQSSSSGHNNGYRNSSSWDDWGEEKDTKKEAAPKVSTSNDDDD  418

Query  465  dakddgfddF------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
                   +D       YQSA   K VGHNGKSD+ W+ GGFL
Sbjct  419  GWAGWDDNDAKDDDFYYQSAGAKKSVGHNGKSDSAWTGGGFL  460



>ref|XP_009139382.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brassica rapa]
 emb|CDX76193.1| BnaA04g04570D [Brassica napus]
Length=451

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 98/160 (61%), Gaps = 10/160 (6%)
 Frame = -3

Query  819  ETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQ  640
            ETVNVV  KT EIG RTWGIMKGV+A+A+QKV EYTKE   +W     Q NESE NGYYQ
Sbjct  296  ETVNVVATKTTEIGHRTWGIMKGVMAIATQKVGEYTKEGTTSWN----QHNESESNGYYQ  351

Query  639  DFNH-NskglnssgggggqsssGRQF-NSVNSGSWDNWDTKGNNTKETSPANNdswagwd  466
            ++   N +   S+GGGG Q  S   + NS  S SWD+W       K  + A   S A  D
Sbjct  352  NYGSGNKEANPSAGGGGSQLPSTGHYNNSQKSNSWDDWGENETPKKNEAVAPKGSSASND  411

Query  465  dak----ddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            D      DDGFD  YQSA D K VGHNGK DT W+ GGFL
Sbjct  412  DGGWTGWDDGFDGHYQSADDKKSVGHNGKPDTAWTGGGFL  451



>gb|KHG23490.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Gossypium 
arboreum]
Length=510

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 110/154 (71%), Gaps = 7/154 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VVTAKT EIG RTWGI+KGV+ALASQKVEEY K D  NWKND+W +NESE+NG++
Sbjct  307  NETVSVVTAKTTEIGHRTWGIVKGVMALASQKVEEYAK-DGMNWKNDNWPQNESEKNGHH  365

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNN----TKETSPANNdswa  475
            Q    N      +   GGQSSSG   NS  S SWD+WDTK N     T+ T+  +ND WA
Sbjct  366  Q--GSNQGNKGWNSTSGGQSSSGGNSNSCTSSSWDDWDTKDNRKEGTTEVTTSHSNDGWA  423

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWS  373
            GWD+AKDDG+D+FY  A + + VG NGKSD  WS
Sbjct  424  GWDEAKDDGYDNFYNGASNKRAVGDNGKSDATWS  457



>emb|CDX79739.1| BnaC03g20750D [Brassica napus]
Length=453

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 104/165 (63%), Gaps = 19/165 (12%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N +E NGYY
Sbjct  298  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNTNEGNGYY  353

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswa----  475
            Q+     K + +S  GG QSSS  Q NS NS SWD+W  + N  KE +P    S +    
Sbjct  354  QN-----KAVTNSSLGGSQSSSSYQNNSRNSSSWDDWGEENNTKKEAAPQTKVSTSDDDG  408

Query  474  -----gwddakddgfddFYQSAH-DNKHVGHNGKSDTKWSDGGFL  358
                   D   DD  D +YQ+A  D K VGHNGKSDT W+ GGFL
Sbjct  409  WAGWGDNDGKDDDDDDGYYQTAAGDKKSVGHNGKSDTAWTGGGFL  453



>emb|CDX74953.1| BnaA05g06990D [Brassica napus]
Length=452

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 94/166 (57%), Gaps = 15/166 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIGQRTWGIM+GV+A+ASQKVEE+TKE+   W     Q+N+SE NGY 
Sbjct  291  SETVNVVATKTTEIGQRTWGIMRGVMAIASQKVEEFTKEETSTWN----QQNKSEGNGYT  346

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNW-DTKGNNTKETSPANNdswagwd  466
                  S+    +      SS G   +  NS SWD+W + KG   KE +P  + S    D
Sbjct  347  NSSLGGSQSSYQNNYLSQSSSGGHHNSYGNSNSWDDWGEEKGTTKKEAAPKVSTSKDDDD  406

Query  465  dakddgfddF---------YQS-AHDNKHVGHNGKSDTKWSDGGFL  358
            D      DD          YQS A D K VGHNGK DT W+ GGFL
Sbjct  407  DGWAGWDDDNDAKDDDDGYYQSGAGDKKSVGHNGKPDTAWTGGGFL  452



>ref|XP_010907061.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=459

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 86/157 (55%), Gaps = 12/157 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIGQRTWGIMKGV+A+ASQKVEEYTKE  G W  D WQRNE+E+NGYY
Sbjct  313  NETVNVVATKTTEIGQRTWGIMKGVMAMASQKVEEYTKEGMG-WNGDDWQRNENERNGYY  371

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            ++F            G          +S   GSWD+WD K    +    A +    G   
Sbjct  372  KEFGEEKAWQGWDSPGA---------HSSGRGSWDDWDAKDKKEEHGKGAQDRHGWGGWH  422

Query  462  akddgfddFYQSAHDNKHVGHNGKSD--TKWSDGGFL  358
               D   + Y  +   K    N KS+  + W++GGFL
Sbjct  423  DVKDDCYENYHHSSSKKATNQNLKSNSTSTWTEGGFL  459



>emb|CDX73533.1| BnaC08g24700D [Brassica napus]
Length=446

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 97/157 (62%), Gaps = 8/157 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSW-QRNESEQNGY  646
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKV EYTKE     +  +W QRNESE NGY
Sbjct  294  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVGEYTKEG----RTTTWSQRNESESNGY  349

Query  645  YQDFNHNskglnssgggggqsssGRQFNSV--NSGSWDNWDTKGNNTKETSPANNdswag  472
            YQ+F + +K  N S  G G  SS   + +    S SWD    K     + S A+N    G
Sbjct  350  YQNFGNGNKAANPSVEGRGSQSSSSGYYNNSQRSNSWDESKKKEAVASKGSSASN-DDDG  408

Query  471  wddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  361
            W    D   D +YQSA D K  GHNGKSDT W+ GGF
Sbjct  409  WTGWNDPKDDVYYQSAGDKKSAGHNGKSDTAWTGGGF  445



>ref|XP_007162658.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 ref|XP_007162659.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 gb|ESW34652.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 gb|ESW34653.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
Length=485

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 106/189 (56%), Gaps = 35/189 (19%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV+ KT EIG RTWGIM+GV+A+A+QKVEEYT+ DN N  +D+W+RNE+++NG+Y
Sbjct  298  NETVNVVSQKTSEIGHRTWGIMRGVMAMATQKVEEYTR-DNPNGTSDNWKRNETDKNGFY  356

Query  642  QDFN------------------------------HNskglnssgggggqsssGRQFNSVN  553
            Q+FN                              H          G    SSG + ++ N
Sbjct  357  QEFNQENKGWNSSGREGQHSTGRQTNSSSWDDWDHEDSRKEEPAKGSSHQSSGGRSDTNN  416

Query  552  SGSWDNWDTKGNNTKETSPANNdswagw----ddakddgfddFYQSAHDNKHVGHNGKSD  385
            S SWD+WD +    KE +  +    +      D+ KD+GFDDFY +A +NK  GHN K+ 
Sbjct  417  SSSWDDWDHEDTRKKEAAKGSAAHSSDGWAGWDNNKDEGFDDFYGNASNNKAAGHNDKAG  476

Query  384  TKWSDGGFL  358
              W+ GGFL
Sbjct  477  VAWTGGGFL  485



>ref|XP_010509321.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Camelina sativa]
Length=456

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 98/162 (60%), Gaps = 11/162 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N++E NG Y
Sbjct  299  SETVNVVANKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKNEGNGLY  354

Query  642  QDFNH-NskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwd  466
            Q+    N    +SS GG   SSS +  N  NS SWD+W  + +  KE +P  + S    D
Sbjct  355  QNSGFGNKTANSSSFGGSQSSSSVQNNNYRNSNSWDDWGDEKDTKKEAAPKVSTSNDDDD  414

Query  465  dakddgfddF------YQSAHDNKHVGHNGKSDTKWSDGGFL  358
                   +D       YQSA   K VG+NGKSD+ W+ GGFL
Sbjct  415  GWAGWDDNDAKDDDFYYQSAGAKKSVGNNGKSDSAWTGGGFL  456



>ref|XP_009402324.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=459

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 92/159 (58%), Gaps = 14/159 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VV  K+ EIGQRTWGIMKGV+A+ASQKVEEY+ E   +WK D W + ES +NGYY
Sbjct  311  NETVSVVATKSTEIGQRTWGIMKGVMAMASQKVEEYSNEGI-SWKVDDWSQKESVKNGYY  369

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw--  469
            Q+F  +     +      Q +  + +NSV+S SWDNWD K    +   P      +    
Sbjct  370  QEFGQD-----NKNWNSPQENPNKHYNSVSS-SWDNWDEK---ERREEPRKGTQSSESWA  420

Query  468  --ddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
              DD KDD     Y  +  N     NGKS + W+DGGFL
Sbjct  421  GWDDMKDDDGYANYHYSSSNNAANQNGKSGSSWTDGGFL  459



>ref|XP_008795047.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Phoenix dactylifera]
Length=466

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 94/161 (58%), Gaps = 19/161 (12%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NET++VV  KT E+GQ+TWGIMKGV+A+ASQKVEEYTK D  NWK D WQR E E+NGYY
Sbjct  319  NETMSVVATKTTEVGQKTWGIMKGVMAMASQKVEEYTK-DGMNWKGDGWQRQEGERNGYY  377

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWD------TKGNNTKETSPANNds  481
            QDF        ++G    + +S +  NSV+  SWD WD       +G  T + S +    
Sbjct  378  QDFGQE-----NNGWNSSEGNSLKHHNSVS--SWDGWDEEEKKEQRGKGTTQDSAS----  426

Query  480  wagwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
                 D   D   D Y  +  +K    NGKS + W++GGFL
Sbjct  427  -WAGWDDVKDDGYDNYSYSASSKGGNQNGKSGSLWTEGGFL  466



>emb|CDY30849.1| BnaC04g27040D [Brassica napus]
Length=448

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 98/160 (61%), Gaps = 10/160 (6%)
 Frame = -3

Query  819  ETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQ  640
            ETVNVV  KT EIG RTWGIMKGV+A+A+QKV EYTKE   NW     Q NESE NGY Q
Sbjct  293  ETVNVVATKTTEIGHRTWGIMKGVMAIATQKVGEYTKEGTTNWN----QHNESEGNGYSQ  348

Query  639  DFNH-NskglnssgggggqsssGRQF-NSVNSGSWDNWDTKGNNTKETSPANNdswagwd  466
            ++   N     SSGGGG QSSS   + NS  S SWD+W       K  + A   S A  D
Sbjct  349  NYGSGNKPANPSSGGGGSQSSSTGHYNNSQKSNSWDDWGENETPKKNEAVAPKGSSASND  408

Query  465  dak----ddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
            D      DDGFD  YQSA D K VGHNGK DT W+ GGFL
Sbjct  409  DGGWTGWDDGFDGHYQSADDKKSVGHNGKPDTAWTGGGFL  448



>ref|XP_006373937.1| hypothetical protein POPTR_0016s11090g [Populus trichocarpa]
 gb|ERP51734.1| hypothetical protein POPTR_0016s11090g [Populus trichocarpa]
Length=157

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVVTAKT EIG RTWGIMKGV+A+ASQKVEEYTK+    W  D+WQ+N S+ NGYY
Sbjct  2    NETVNVVTAKTTEIGHRTWGIMKGVMAMASQKVEEYTKD---GWNTDNWQQNNSQSNGYY  58

Query  642  QDFN  631
            Q+FN
Sbjct  59   QEFN  62



>ref|XP_009133186.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133187.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133188.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133190.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
Length=477

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 103/186 (55%), Gaps = 35/186 (19%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT E GQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N +E NGYY
Sbjct  296  SETVNVVASKTTETGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNTNEGNGYY  351

Query  642  QDFNHNskglnssgggggqsssGRQF----------------------NSVNSGSWDNWD  529
            Q+    +  L  S       ++ R                        +  NS SWD+W 
Sbjct  352  QNKAATNSSLGGSQSSSSYQNNKRSSWDDWGEENNTKKETASQSGYHNSHGNSSSWDDWG  411

Query  528  TKGNNTK-ETSPANNd-------swagwddakddgfddFYQSAH-DNKHVGHNGKSDTKW  376
             + NNTK ET+P  +        +  G +D KDD  D +YQSA  D K VGHNGKSDT W
Sbjct  412  EEKNNTKKETAPKVSTSNDDDGWAGWGDNDGKDDDDDGYYQSAAGDKKSVGHNGKSDTAW  471

Query  375  SDGGFL  358
            + GGFL
Sbjct  472  TGGGFL  477



>ref|XP_010920665.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=465

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 89/155 (57%), Gaps = 8/155 (5%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NET++VV  KT E+GQ+TWGIMKGV+A+ASQKVEEYTK D  N K+D  QR E E+NGYY
Sbjct  319  NETMSVVATKTTEVGQKTWGIMKGVMAMASQKVEEYTK-DGMNCKDDDLQRQEGERNGYY  377

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            Q+F        + G    + +S + +N+ +  SWDNWD +    +              D
Sbjct  378  QNFGQE-----NKGWNSSEGNSLKHYNAAS--SWDNWDEEEKKEQPGKGTQGSESWAGWD  430

Query  462  akddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D Y  +  +K    NGKS + W++GGFL
Sbjct  431  DVKDDGYDNYSYSPSSKGANRNGKSSSLWTEGGFL  465



>emb|CDY69342.1| BnaCnng63080D [Brassica napus]
Length=438

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 90/162 (56%), Gaps = 13/162 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N+SE NGY 
Sbjct  283  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNKSEGNGYT  338

Query  642  QDFNHNskglnssgggggqsssGRQFNSV-NSGSWDNWDTKGNNTKETSPANNdswagwd  466
                  S+  ++       S      N   NS SWD+W  + + TK+ +  + D      
Sbjct  339  NSSLGGSQSSSTPKVSQSSSGG--HLNGYGNSNSWDDWGEEKSTTKKEAKDDGDGDDDGW  396

Query  465  dakddgfddF-----YQS-AHDNKHVGHNGKSDTKWSDGGFL  358
               DD          YQS A   K VGHNGK DT W+ GGFL
Sbjct  397  AGWDDNDAKDDDDGYYQSGAGVKKSVGHNGKPDTAWTGGGFL  438



>ref|XP_009386541.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=449

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 89/156 (57%), Gaps = 16/156 (10%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NET++VV  KT EIG +TWGIMKGV+A+ASQKVE YTKE   +W  D W R ESE++ YY
Sbjct  307  NETMSVVATKTTEIGHKTWGIMKGVMAMASQKVEVYTKEGI-SWNVDDWPRKESEKSSYY  365

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            Q+F  +       G    Q  S +Q+NS++  SWD+WD K    +   P           
Sbjct  366  QEFGQD-----KRGWSSRQEDSNKQYNSIS--SWDDWDKK---ERREEPGKGTQRGESWA  415

Query  462  akddgfddFYQSAHD--NKHVGHNGKSDTKWSDGGF  361
              DD  D    + HD  NK V  NGKS + W+DGGF
Sbjct  416  GWDDVRD---DAGHDNLNKGVNQNGKSGSLWTDGGF  448



>ref|XP_010678052.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Beta vulgaris subsp. vulgaris]
Length=471

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV+AKT EIGQ+TWGIM+GV+A+A+QKVEE+TKE   +WK D+  + E+E+NGYY
Sbjct  315  NETVNVVSAKTSEIGQKTWGIMRGVMAIATQKVEEFTKEPGVSWKTDNPHQTENERNGYY  374

Query  642  QDF  634
            QDF
Sbjct  375  QDF  377



>ref|XP_009143481.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Brassica rapa]
 ref|XP_009143482.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Brassica rapa]
Length=476

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 97/192 (51%), Gaps = 41/192 (21%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIM+GV+A+ASQKVEE+TKE+   W     Q+N+SE NGY 
Sbjct  289  SETVNVVASKTTEIGQRTWGIMRGVMAIASQKVEEFTKEEASTWN----QQNKSEGNGYT  344

Query  642  QDF-------------------------NHNskglnssgggggqsssGRQFNSV-NSGSW  541
                                          NS     +     QSSSG   NS  NS SW
Sbjct  345  NSSLGGSQSSSSYQNNYCSNSNSWDNWGEENSTTKKEAAPKVSQSSSGGHHNSYGNSNSW  404

Query  540  DNW-DTKGNNTKETSPANNdswagwddakddgfddF---------YQS-AHDNKHVGHNG  394
            D+W + K    KE +P  + S    DD      DD          YQS A D K VGHNG
Sbjct  405  DDWGEEKSTTKKEAAPKVSTSKDDDDDGWAGWDDDNDAKDDDDGYYQSGAGDKKSVGHNG  464

Query  393  KSDTKWSDGGFL  358
            K DT W+ GGFL
Sbjct  465  KPDTAWTGGGFL  476



>gb|AAG17006.1|AF184146_1 ARF GAP-like zinc finger-containing protein ZIGA2, partial [Arabidopsis 
thaliana]
Length=458

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 89/158 (56%), Gaps = 16/158 (10%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV  K  EIG RTWGIMKGV+A+A+QKVEE+TKE + +W     Q++E+E NGYY
Sbjct  297  SETVNVVANKITEIGHRTWGIMKGVMAMATQKVEEFTKEGSTSWN----QQSENEGNGYY  352

Query  642  QDF---NHNskglnssgggggqsssGRQFNSVNSGSWDNW-DTKGNNTKETSPANNdswa  475
            Q+F   N  +      G     S+SG   NS NS SWD+W + +   T+  +P  + +  
Sbjct  353  QNFGNGNKAANSSVGGGRPQSSSTSGHYNNSQNSNSWDSWGENENKKTEAVAPKGSSASN  412

Query  474  gwddakddgfddF--------YQSAHDNKHVGHNGKSD  385
              D        D         YQSA D K  GHNGKSD
Sbjct  413  DDDGWTGWDDHDAKDDGFDGHYQSAGDKKSAGHNGKSD  450



>ref|XP_009409527.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=509

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 8/100 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIGQ+TWGIM+GV+A+ASQKVEEY KE   NW  D W   ESE+NG Y
Sbjct  313  NETVNVVATKTTEIGQKTWGIMRGVMAMASQKVEEYAKEGI-NWNEDDWSWKESEKNGPY  371

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTK  523
            Q F  N     +      + SS R  NSV+  SWD+WD K
Sbjct  372  QKFGQN-----NKDWNSFEESSERHQNSVS--SWDDWDEK  404



>ref|XP_004493890.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Cicer arietinum]
Length=433

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV +VT KT EIGQRTWGIMKGV+ALASQKVEEYT++   N  +D+WQ+N+++++   
Sbjct  287  NETVTIVTQKTSEIGQRTWGIMKGVMALASQKVEEYTRDYPPNGNSDNWQQNQNDRH---  343

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  493
             DFN  +KG NSS   G  SSSG Q N+  S SWD+WD+K  +T++  PA
Sbjct  344  -DFNQENKGWNSSTREGQPSSSG-QTNTYQSSSWDDWDSK--DTRKEVPA  389



>ref|XP_009141672.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
Length=450

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 96/180 (53%), Gaps = 27/180 (15%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWK-------NDSWQ---  673
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W        +DS     
Sbjct  273  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQQNNNGFSDSKAGTN  332

Query  672  RNESEQNGY-----YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNW-DTKGNNT  511
             + S QN Y     + D+   S     +     QS     + + NS  WD+W + K +  
Sbjct  333  SSSSYQNNYRNSSSWDDWGEESNTKKEAAPKVSQSVHHNGYGNANS--WDDWGEEKSSTK  390

Query  510  KETSPANNdswa--------gwddakddgfddFYQ-SAHDNKHVGHNGKSDTKWSDGGFL  358
            KE +P  + S            D+   D  D +YQ +A D K VGHNGK DT W+ GGFL
Sbjct  391  KEAAPKVSTSKDDDGGWAGWDDDNDDKDDDDGYYQNTAEDKKSVGHNGKPDTAWTGGGFL  450



>gb|ABD32193.1| Arf GTPase activating protein [Medicago truncatula]
 gb|ACJ85591.1| unknown [Medicago truncatula]
 gb|AFK49050.1| unknown [Medicago truncatula]
 gb|AES81716.2| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=443

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 10/112 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE-DNGNWKNDSWQRNESEQNGY  646
            NETVN+VT KT EIGQRTWGIMKGV+ALASQKVEE+TK+  +GN  +D+W RNE++++  
Sbjct  295  NETVNIVTQKTSEIGQRTWGIMKGVMALASQKVEEFTKDYPDGN--SDNWPRNENDRH--  350

Query  645  YQDFNH-NskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  493
              DFN  N    +S+    GQ SSG Q N+ +S SWD+WD +  +T++  PA
Sbjct  351  --DFNQENKGWNSSTSTREGQPSSGGQTNTYHSNSWDDWDNQ--DTRKEVPA  398



>ref|XP_003625498.1| ADP-ribosylation factor GTPase-activating protein [Medicago truncatula]
Length=474

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 10/112 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE-DNGNWKNDSWQRNESEQNGY  646
            NETVN+VT KT EIGQRTWGIMKGV+ALASQKVEE+TK+  +GN  +D+W RNE++++  
Sbjct  295  NETVNIVTQKTSEIGQRTWGIMKGVMALASQKVEEFTKDYPDGN--SDNWPRNENDRH--  350

Query  645  YQDFNH-NskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  493
              DFN  N    +S+    GQ SSG Q N+ +S SWD+WD +  +T++  PA
Sbjct  351  --DFNQENKGWNSSTSTREGQPSSGGQTNTYHSNSWDDWDNQ--DTRKEVPA  398



>emb|CDY26647.1| BnaA09g46300D [Brassica napus]
Length=181

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 4/62 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQ VEE+TKE+   W     Q+N +E NGYY
Sbjct  77   SETVNVVASKTTEIGQRTWGIMKGVMAIASQMVEEFTKEEASTWN----QQNTNEGNGYY  132

Query  642  QD  637
            Q+
Sbjct  133  QN  134



>ref|XP_006651253.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD6-like, partial [Oryza brachyantha]
Length=447

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 82/155 (53%), Gaps = 9/155 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIG RTWGIMKGV+ALA+QKVEEYTKE    W +D WQR E     Y 
Sbjct  300  NETVNVVANKTAEIGSRTWGIMKGVMALATQKVEEYTKEGGSGWGDD-WQRREQGSEPYS  358

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdd  463
            + F H + G   +    G S       + NS SWD+WD +G   + T    +       D
Sbjct  359  R-FEHETNGNGWNSSHNGSS------KNYNSNSWDDWDEQGKKDEPTKERQSSDSWAGWD  411

Query  462  akddgfddFYQSAHDNKHVGHNGKS-DTKWSDGGF  361
               D   D Y  +  NK    NG S  + W++GGF
Sbjct  412  DGKDDSFDSYNHSTPNKGSNQNGTSGGSYWTEGGF  446



>emb|CDX88291.1| BnaC06g37350D [Brassica napus]
Length=223

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 19/109 (17%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+  NW       N+  ++G+Y
Sbjct  56   SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASNW-------NQQNKSGFY  108

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  496
             D                 SSS  Q N  NS S D+W  + N+ KE +P
Sbjct  109  DD------------KAATNSSSSYQSNYRNSSSCDDWGEESNSKKEAAP  145



>emb|CDY07784.1| BnaA03g17270D [Brassica napus]
Length=433

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W     Q+N +E NGYY
Sbjct  296  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWN----QQNTNEGNGYY  351

Query  642  Q  640
            Q
Sbjct  352  Q  352



>ref|XP_010922379.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=452

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 61/100 (61%), Gaps = 10/100 (10%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIGQRTWGIMK V+A+A+QKVEEY KE  G    D  Q NE+E+NGYY
Sbjct  308  NETVNVVATKTTEIGQRTWGIMKEVMAMATQKVEEYAKEGMGR-NGDDQQPNENERNGYY  366

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTK  523
            ++F       +    G          +S   GSWD+W+ K
Sbjct  367  KEFGQEKFWQDWDSPGA---------HSSGRGSWDDWNVK  397



>gb|EPS67752.1| hypothetical protein M569_07021, partial [Genlisea aurea]
Length=443

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 61/102 (60%), Gaps = 23/102 (23%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKND--SWQRNESEQNG  649
            NETVNVV AKT EIG +TWG+M+GV+A+ASQKVEEY +E +G WKND  S  RNE++ NG
Sbjct  305  NETVNVVAAKTSEIGHKTWGLMRGVMAMASQKVEEYARESSG-WKNDGSSRIRNETDHNG  363

Query  648  YYQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTK  523
            +                    S+         SGSWD WDTK
Sbjct  364  H--------------------SNRSATVADPGSGSWDGWDTK  385



>ref|XP_009416249.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=460

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 87/147 (59%), Gaps = 14/147 (10%)
 Frame = -3

Query  786  EIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQDFNHNskglns  607
            EIGQ+TWGIMKGV+A+ASQKVEEYTKE   NWK D     ESE+N +YQ F+ +     +
Sbjct  324  EIGQKTWGIMKGVMAMASQKVEEYTKEGI-NWKTDDSSWKESEKNSFYQKFSQD-----N  377

Query  606  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswag----wddakddgfdd  439
            +G    Q +S + +NSV  GSWD+WD K   TKE       +        DD KDD  +D
Sbjct  378  NGWNSSQENSNKNYNSV--GSWDDWDEK--ETKEQPRKGTQNGESWAGWDDDVKDDDGND  433

Query  438  FYQSAHDNKHVGHNGKSDTKWSDGGFL  358
             Y     NK    NGKS + W+DGGFL
Sbjct  434  NYNYTWSNKVGNQNGKSGSSWTDGGFL  460



>emb|CDY16083.1| BnaC08g40400D [Brassica napus]
Length=236

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 4/62 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            +ETVNVV +KT EI QRTWGIMKGV+A+ASQ VEE+TKE+   W     Q+N +E NGYY
Sbjct  132  SETVNVVASKTTEIRQRTWGIMKGVMAIASQMVEEFTKEEASTWN----QQNTNEGNGYY  187

Query  642  QD  637
            Q+
Sbjct  188  QN  189



>gb|AAO72580.1| ADP ribosylation GTPase-like protein [Oryza sativa Japonica Group]
Length=308

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIG RTWGIMKGV+ALASQKVEEY KE    W +D WQR E     Y+
Sbjct  160  NETVNVVANKTAEIGSRTWGIMKGVMALASQKVEEYAKEGGNGWGDD-WQRREQGSEPYH  218

Query  642  Q  640
            +
Sbjct  219  R  219



>ref|NP_001049726.1| Os03g0278400 [Oryza sativa Japonica Group]
 gb|ABF95284.1| ARF GAP-like zinc finger-containing protein ZIGA2, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11640.1| Os03g0278400 [Oryza sativa Japonica Group]
 gb|EAZ26458.1| hypothetical protein OsJ_10347 [Oryza sativa Japonica Group]
 dbj|BAG91743.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIG RTWGIMKGV+ALASQKVEEY KE    W +D WQR E     Y+
Sbjct  305  NETVNVVANKTAEIGSRTWGIMKGVMALASQKVEEYAKEGGNGWGDD-WQRREQGSEPYH  363

Query  642  Q  640
            +
Sbjct  364  R  364



>gb|EAY89468.1| hypothetical protein OsI_11000 [Oryza sativa Indica Group]
Length=454

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETVNVV  KT EIG RTWGIMKGV+ALASQKVEEY KE    W +D WQR E     Y+
Sbjct  306  NETVNVVANKTAEIGSRTWGIMKGVMALASQKVEEYAKEGGNGWGDD-WQRREQGSEPYH  364

Query  642  Q  640
            +
Sbjct  365  R  365



>gb|KHN09424.1| Putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Glycine soja]
Length=171

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 91/174 (52%), Gaps = 43/174 (25%)
 Frame = -3

Query  759  MKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQDFN-----------------  631
            MKGV+ALASQKVEE+ + DN NW +D+WQRNES++NG+YQ+FN                 
Sbjct  1    MKGVMALASQKVEEFAR-DNPNWMSDNWQRNESDRNGFYQEFNRENNGRNSSTREGQHSS  59

Query  630  ----------------HNskglnssgggggqsssGRQF-NSVNSGSWDNWDTKGNNTKET  502
                            HN      +  G    SSG +F N+ NS SWD+WD +  +T++ 
Sbjct  60   GGQTNTFHSSSWDDWGHNDSRKEETAKGSAPQSSGGKFDNNYNSSSWDDWDQE--DTRKK  117

Query  501  SPANNdswagwdd------akddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
             PA   +    D       AKDDGFDD Y SA +NK   HN KS   W+ GGFL
Sbjct  118  EPAKGSAAHSSDGWAGWDNAKDDGFDDIYGSASNNKGGAHNDKSGAAWTGGGFL  171



>ref|XP_002465464.1| hypothetical protein SORBIDRAFT_01g039320 [Sorghum bicolor]
 gb|EER92462.1| hypothetical protein SORBIDRAFT_01g039320 [Sorghum bicolor]
Length=457

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNG-Y  646
            NETV+VV  KT EIG RTWGIM+GV+ALASQKVEEY KE   +   D WQR  SEQN   
Sbjct  306  NETVSVVANKTAEIGSRTWGIMRGVMALASQKVEEYAKEGGMSGWGDDWQR--SEQNSEP  363

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  496
            YQ F H + G + +      S       + NS SWD+WD +G   +   P
Sbjct  364  YQRFEHETNGNSWNSSQNSSS------KNNNSSSWDDWDDQGKKDEPAKP  407



>emb|CBI30586.3| unnamed protein product [Vitis vinifera]
Length=390

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  786  EIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQDFNH  628
            EIG +TWGIMKGV+A+ASQKVEEY K D   W +D WQRN++E+NG+YQ+F  
Sbjct  247  EIGHKTWGIMKGVMAMASQKVEEYAK-DGMKWNSDGWQRNDNEKNGFYQEFGQ  298



>ref|NP_001150760.1| DNA binding protein [Zea mays]
 gb|ACG40254.1| DNA binding protein [Zea mays]
Length=453

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNG-Y  646
            NETV+VV  KT EIG +TWGIM+GV+A+ASQKVEEY KE   +   + WQR  SEQNG  
Sbjct  302  NETVSVVANKTAEIGSKTWGIMRGVMAMASQKVEEYAKEGGMSGWGEDWQR--SEQNGEP  359

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  496
            YQ F H      ++      SS      + NS SWD+WD +G   +   P
Sbjct  360  YQRFEH------ATNSNSWNSSQNSSSKNNNSSSWDDWDDQGKKGEPAKP  403



>ref|XP_002262606.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Vitis vinifera]
Length=465

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  786  EIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQDFNH  628
            EIG +TWGIMKGV+A+ASQKVEEY K D   W +D WQRN++E+NG+YQ+F  
Sbjct  322  EIGHKTWGIMKGVMAMASQKVEEYAK-DGMKWNSDGWQRNDNEKNGFYQEFGQ  373



>ref|XP_008654261.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Zea mays]
 tpg|DAA44701.1| TPA: putative ARF GTPase-activating domain family protein [Zea 
mays]
Length=454

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 10/110 (9%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDN-GNWKNDSWQRNESEQNGY  646
            NETV+VV  KT EIG RTWGIM+GV+ALASQKVEEY KE   G W  D WQ +E +++  
Sbjct  304  NETVSVVANKTAEIGSRTWGIMRGVMALASQKVEEYAKEGGVGGWGED-WQHSE-QKSEP  361

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  496
            YQ F H + G + +             +  NS SWD+WD  G   +   P
Sbjct  362  YQRFEHETNGNSWNSSQNSS-------SKNNSSSWDDWDDPGKKDEPAKP  404



>emb|CDY18435.1| BnaA04g21520D [Brassica napus]
Length=422

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNW  691
            +ETVNVV +KT EIGQRTWGIMKGV+A+ASQKVEE+TKE+   W
Sbjct  273  SETVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTW  316



>ref|XP_004984751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Setaria italica]
Length=455

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 61/109 (56%), Gaps = 7/109 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            NETV+VV  KT EIG +TWGIM+GV+ALASQKVEEY KE       D WQR E + N  Y
Sbjct  307  NETVSVVANKTAEIGSKTWGIMRGVMALASQKVEEYAKEGGVGGWGDDWQRGE-QNNEPY  365

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  496
            Q F H +     S      S       + NS SWD+WD +G   +   P
Sbjct  366  QRFEHETNSNGWSSSQNSSS------KNYNSNSWDDWDDQGKKDEPAKP  408



>gb|EMT07652.1| hypothetical protein F775_26990 [Aegilops tauschii]
Length=328

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE  706
            NETVNVVT KT EIG RTWGIMKGV+ALA+QKVEEY KE
Sbjct  171  NETVNVVTNKTAEIGSRTWGIMKGVMALATQKVEEYAKE  209



>ref|XP_003558222.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brachypodium distachyon]
Length=464

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE-DNGNWKNDSWQRNESEQNGY  646
            NETVNVV+ KT EIG RTWGIMKGV+ALA+QKVEEY KE   G    D WQR E   N  
Sbjct  311  NETVNVVSNKTVEIGSRTWGIMKGVMALATQKVEEYAKEGGVGGGWGDDWQRGEQNNNEP  370

Query  645  YQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  493
            Y    H + G + +    G S +       NS SWD+WD +G   +   P+
Sbjct  371  YCRSEHEANGNSWNSPQDGSSKNH------NSNSWDDWDDQGKKDEPVKPS  415



>gb|KHF98429.1| ADP-ribosylation factor GTPase-activating AGD7 -like protein 
[Gossypium arboreum]
Length=461

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 64/104 (62%), Gaps = 8/104 (8%)
 Frame = -3

Query  819  ETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYYQ  640
            +TV+VVT KT + G +TWG+MKG + LA+QKV  +TK D    K+++WQRN    NGYYQ
Sbjct  308  QTVHVVTTKTSKFGHKTWGVMKGAVTLATQKVGRFTK-DAMTQKSNNWQRN----NGYYQ  362

Query  639  DFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTK  508
            +F       ++S G    + +    +S +S  WDN  TK NNTK
Sbjct  363  EFKQEKGCNSTSRGESFSNGNH---SSYSSSYWDNCGTKDNNTK  403



>gb|EMS46940.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Triticum urartu]
Length=482

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE  706
            NETVNVVT KT EIG RTWGIMKGV+ALA+QKVEEY KE
Sbjct  324  NETVNVVTNKTAEIGSRTWGIMKGVMALATQKVEEYAKE  362



>dbj|BAJ88349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE  706
            NETVNVVT KT EIG RTWGIMKGV+ALA+QKVEEY KE
Sbjct  312  NETVNVVTNKTAEIGSRTWGIMKGVMALATQKVEEYAKE  350



>ref|XP_006846038.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Amborella trichopoda]
 ref|XP_011624052.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Amborella trichopoda]
 gb|ERN07713.1| hypothetical protein AMTR_s00012p00025360 [Amborella trichopoda]
Length=455

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 80/159 (50%), Gaps = 10/159 (6%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRN--ESEQN-  652
            NETV+VV +KT EIGQ+TWG+M+GV+A+ASQKVEEYTKE    + ++    N    E N 
Sbjct  303  NETVSVVASKTTEIGQKTWGLMRGVMAIASQKVEEYTKEGITKFSDNHQNHNGYSGEGNG  362

Query  651  GYYQDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTK-ETSPANNdswa  475
            GYY  F+  +   +      G         S +S SWD+W  K +  K +          
Sbjct  363  GYYHAFSEENSKGSDHNQKNGYD------RSESSYSWDDWGRKEDKVKDDKGAQGGGDGW  416

Query  474  gwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  358
               D   D   + +  A        +GKS++ W+ GGFL
Sbjct  417  AGWDDVKDEDHNDFFEASTKGSSDKHGKSESSWTGGGFL  455



>ref|XP_008780180.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Phoenix dactylifera]
Length=413

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQ-RNESEQNGY  646
            NETVNV+  KT E+GQRTWGIMKG++ +ASQKVEEY   D   WK +  Q R E + +G 
Sbjct  304  NETVNVIAQKTTELGQRTWGIMKGIMTMASQKVEEYAG-DGAGWKMEGLQPRREIDSDGS  362

Query  645  YQDFNH  628
                 H
Sbjct  363  AGTPRH  368



>gb|KJB36743.1| hypothetical protein B456_006G174500 [Gossypium raimondii]
Length=449

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            ++TV+VVT KT + G +TWG+MKG + LA+QKV  +TK D    K+++WQRN    NGYY
Sbjct  307  HQTVHVVTTKTSKFGHKTWGVMKGAVTLATQKVGRFTK-DAMTQKSNNWQRN----NGYY  361

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTK  508
            Q+F       ++  G    + +    +S +S  WDN   K NN K
Sbjct  362  QEFKQEKGCNSTCRGESFSNGN---HSSYSSSYWDNCGAKDNNRK  403



>gb|KJB36744.1| hypothetical protein B456_006G174500 [Gossypium raimondii]
Length=445

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQRNESEQNGYY  643
            ++TV+VVT KT + G +TWG+MKG + LA+QKV  +TK D    K+++WQRN    NGYY
Sbjct  303  HQTVHVVTTKTSKFGHKTWGVMKGAVTLATQKVGRFTK-DAMTQKSNNWQRN----NGYY  357

Query  642  QDFNHNskglnssgggggqsssGRQFNSVNSGSWDNWDTKGNNTK  508
            Q+F       ++  G    + +    +S +S  WDN   K NN K
Sbjct  358  QEFKQEKGCNSTCRGESFSNGN---HSSYSSSYWDNCGAKDNNRK  399



>ref|XP_010940758.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=407

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKEDNGNWKNDSWQ  673
            NETVNV+  KT ++GQRTWGIMKG++ +AS KVEEYT  D   WK +  +
Sbjct  298  NETVNVIAQKTTKLGQRTWGIMKGIMTMASHKVEEYTG-DGAGWKMEGLE  346



>ref|XP_002972763.1| hypothetical protein SELMODRAFT_441959 [Selaginella moellendorffii]
 gb|EFJ25984.1| hypothetical protein SELMODRAFT_441959 [Selaginella moellendorffii]
Length=457

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKED  703
            NETV+VV+AKT EIG +TWG+MKGV+A+AS+ VE YTKE+
Sbjct  292  NETVSVVSAKTTEIGHKTWGLMKGVMAMASKTVENYTKEE  331



>ref|XP_002984338.1| hypothetical protein SELMODRAFT_445864 [Selaginella moellendorffii]
 gb|EFJ14388.1| hypothetical protein SELMODRAFT_445864 [Selaginella moellendorffii]
Length=456

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKED  703
            NETV+VV+AKT EIG +TWG+MKGV+A+AS+ VE YTKE+
Sbjct  292  NETVSVVSAKTTEIGHKTWGLMKGVMAMASKTVENYTKEE  331



>ref|XP_009381844.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=421

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE  706
            N TVN V  +T EIG RTWGIMKGV+A+A+QKVEE+ KE
Sbjct  300  NGTVNTVATRTTEIGHRTWGIMKGVMAMATQKVEEFAKE  338



>ref|XP_009409624.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=423

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVE  721
            NETVN VTA+T EIG RTWGIM+GV+A+AS K+E
Sbjct  308  NETVNTVTARTSEIGHRTWGIMRGVMAMASLKME  341



>ref|XP_001772457.1| predicted protein [Physcomitrella patens]
 gb|EDQ62739.1| predicted protein [Physcomitrella patens]
Length=567

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE  706
            NETV+VV AK  E+G + WG M+GV+A+ASQ+VE YTK+
Sbjct  405  NETVSVVAAKGTEVGHKAWGFMRGVMAMASQQVEAYTKD  443



>ref|XP_010646583.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Vitis vinifera]
Length=432

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYT----KEDNGNWKNDSWQRNESE  658
            +E V+VV +KT E+GQRTWGI+K V+ALA+ KVEEYT    +  +G   NDS+ ++  E
Sbjct  289  DEKVSVVASKTTELGQRTWGIVKDVMALATLKVEEYTGDGVESKSGQENNDSFGQSPGE  347



>emb|CBI23433.3| unnamed protein product [Vitis vinifera]
Length=396

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYT----KEDNGNWKNDSWQRNESE  658
            +E V+VV +KT E+GQRTWGI+K V+ALA+ KVEEYT    +  +G   NDS+ ++  E
Sbjct  253  DEKVSVVASKTTELGQRTWGIVKDVMALATLKVEEYTGDGVESKSGQENNDSFGQSPGE  311



>ref|XP_001761895.1| predicted protein [Physcomitrella patens]
 gb|EDQ73336.1| predicted protein [Physcomitrella patens]
Length=462

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKED  703
            NETV VV AK  ++GQ  WG M+GV+A+ASQ+VE YTK++
Sbjct  306  NETVAVVAAKGTKVGQMAWGFMRGVMAMASQQVETYTKDE  345



>ref|XP_010267329.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nelumbo nucifera]
Length=419

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE  706
            ++TVNVV ++T E+G RTWGI++ V+A+A+ KVEEYTK+
Sbjct  306  DDTVNVVASRTTELGHRTWGIVRDVMAMATLKVEEYTKD  344



>emb|CAN72855.1| hypothetical protein VITISV_043217 [Vitis vinifera]
Length=432

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  822  NETVNVVTAKTPEIGQRTWGIMKGVLALASQKVEEYTKE  706
            +E V  V +KT E+GQRTWGI+K V+ALA+ KVEEYT++
Sbjct  289  DEKVGAVASKTTELGQRTWGIVKDVMALATLKVEEYTRD  327



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752198629708