BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11172

Length=995
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAA70947.1|  putative inward rectifying potassium channel           301   5e-95   Solanum tuberosum [potatoes]
ref|XP_011087731.1|  PREDICTED: potassium channel AKT2/3                308   2e-93   Sesamum indicum [beniseed]
ref|XP_004230485.1|  PREDICTED: potassium channel AKT2/3-like           306   5e-93   Solanum lycopersicum
ref|XP_009791067.1|  PREDICTED: potassium channel AKT2/3-like           306   7e-93   Nicotiana sylvestris
dbj|BAA84085.1|  potassium channel                                      305   1e-92   Nicotiana paniculata
ref|XP_009614130.1|  PREDICTED: potassium channel AKT2/3-like           304   3e-92   Nicotiana tomentosiformis
ref|XP_006349369.1|  PREDICTED: potassium channel AKT2/3-like           302   2e-91   Solanum tuberosum [potatoes]
gb|ABF85695.1|  potassium channel                                       301   2e-91   Nicotiana rustica [wild tobacco]
dbj|BAD81033.1|  potassium channel NKT2                                 301   3e-91   Nicotiana tabacum [American tobacco]
ref|XP_009795716.1|  PREDICTED: potassium channel AKT2/3-like           302   3e-91   Nicotiana sylvestris
ref|XP_009616703.1|  PREDICTED: potassium channel AKT2/3-like           300   2e-90   Nicotiana tomentosiformis
emb|CDO97567.1|  unnamed protein product                                294   3e-88   Coffea canephora [robusta coffee]
ref|NP_001275259.1|  potassium channel AKT2/3-like                      282   5e-84   Solanum tuberosum [potatoes]
ref|XP_010327298.1|  PREDICTED: potassium channel AKT2/3-like           282   9e-84   Solanum lycopersicum
ref|XP_006385212.1|  potassium channel family protein                   271   1e-79   
ref|XP_007042251.1|  Potassium transport 2/3 isoform 2                  262   1e-78   
emb|CAC05489.1|  potassium channel 2                                    266   3e-78   Populus tremula x Populus tremuloides
gb|EYU26523.1|  hypothetical protein MIMGU_mgv1a001765mg                264   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_002529533.1|  Potassium channel AKT2/3, putative                 263   1e-76   
ref|XP_007225285.1|  hypothetical protein PRUPE_ppa001379mg             262   1e-76   Prunus persica
ref|NP_001291251.1|  potassium channel AKT2/3                           261   3e-76   Populus euphratica
ref|XP_006431831.1|  hypothetical protein CICLE_v10000273mg             258   4e-76   
ref|XP_008218775.1|  PREDICTED: potassium channel AKT2/3                261   5e-76   Prunus mume [ume]
ref|XP_007042250.1|  Potassium transport 2/3 isoform 1                  260   9e-76   
ref|XP_009355247.1|  PREDICTED: potassium channel AKT2/3 isoform X2     260   1e-75   Pyrus x bretschneideri [bai li]
gb|KHG14137.1|  Potassium channel AKT2/3 -like protein                  256   1e-75   Gossypium arboreum [tree cotton]
ref|XP_009355246.1|  PREDICTED: potassium channel AKT2/3 isoform X1     259   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_002268924.1|  PREDICTED: potassium channel AKT2/3                259   2e-75   Vitis vinifera
ref|XP_010101161.1|  Potassium channel                                  259   3e-75   Morus notabilis
gb|KJB79210.1|  hypothetical protein B456_013G038200                    258   6e-75   Gossypium raimondii
ref|XP_006431832.1|  hypothetical protein CICLE_v10000273mg             257   1e-74   Citrus clementina [clementine]
gb|AEY75251.1|  potassium channel                                       256   4e-74   Malus hupehensis
ref|XP_008378877.1|  PREDICTED: potassium channel AKT2/3 isoform X3     254   1e-73   
ref|XP_006471022.1|  PREDICTED: potassium channel AKT2/3-like           254   2e-73   Citrus sinensis [apfelsine]
ref|XP_004299918.1|  PREDICTED: potassium channel AKT2/3                253   4e-73   Fragaria vesca subsp. vesca
ref|XP_010245054.1|  PREDICTED: potassium channel AKT2/3-like iso...    246   1e-71   Nelumbo nucifera [Indian lotus]
gb|AEO14874.1|  rsmv3 protein                                           244   2e-71   Glycine max [soybeans]
ref|XP_006585490.1|  PREDICTED: potassium channel AKT2/3 isoform X3     245   2e-71   Glycine max [soybeans]
ref|XP_004485488.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    248   2e-71   
ref|XP_012071314.1|  PREDICTED: potassium channel AKT2/3                248   2e-71   Jatropha curcas
ref|XP_003593018.1|  Potassium channel                                  247   5e-71   Medicago truncatula
ref|XP_010245052.1|  PREDICTED: potassium channel AKT2/3-like iso...    246   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_010245053.1|  PREDICTED: potassium channel AKT2/3-like iso...    246   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006585489.1|  PREDICTED: potassium channel AKT2/3 isoform X2     245   2e-70   
ref|XP_003532990.1|  PREDICTED: potassium channel AKT2/3 isoform X1     245   2e-70   Glycine max [soybeans]
gb|KHN11238.1|  Potassium channel AKT2/3                                245   2e-70   Glycine soja [wild soybean]
ref|XP_006592673.1|  PREDICTED: potassium channel AKT2/3-like iso...    242   3e-70   Glycine max [soybeans]
ref|XP_003540163.1|  PREDICTED: potassium channel AKT2/3-like iso...    241   7e-69   Glycine max [soybeans]
ref|XP_010065457.1|  PREDICTED: potassium channel AKT2/3                240   2e-68   Eucalyptus grandis [rose gum]
gb|KJB32473.1|  hypothetical protein B456_005G242200                    239   3e-68   Gossypium raimondii
gb|AAD16278.1|  pulvinus inward-rectifying channel for potassium ...    239   5e-68   Samanea saman [cow-tamarind]
emb|CAA71598.1|  potassium channel                                      237   1e-67   Vicia faba [broad bean]
ref|XP_007148520.1|  hypothetical protein PHAVU_006G215700g             234   3e-66   Phaseolus vulgaris [French bean]
emb|CBI23771.3|  unnamed protein product                                226   1e-63   Vitis vinifera
ref|XP_008783360.1|  PREDICTED: potassium channel AKT2                  218   2e-60   
ref|XP_002441141.1|  hypothetical protein SORBIDRAFT_09g021160          215   1e-59   Sorghum bicolor [broomcorn]
ref|XP_010277671.1|  PREDICTED: potassium channel AKT2/3-like           214   3e-59   Nelumbo nucifera [Indian lotus]
gb|AAD39492.1|AF145272_1  pulvinus inward-rectifying channel SPICK2     213   1e-58   Samanea saman [cow-tamarind]
ref|XP_010910952.1|  PREDICTED: potassium channel AKT2-like isofo...    209   5e-58   
ref|XP_008378876.1|  PREDICTED: potassium channel AKT2/3 isoform X2     210   7e-58   
ref|XP_008378875.1|  PREDICTED: potassium channel AKT2/3 isoform X1     210   8e-58   
ref|XP_010910948.1|  PREDICTED: potassium channel AKT2-like isofo...    209   2e-57   Elaeis guineensis
ref|XP_010539356.1|  PREDICTED: potassium channel AKT2/3 isoform X3     205   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_010539338.1|  PREDICTED: potassium channel AKT2/3 isoform X1     205   4e-56   Tarenaya hassleriana [spider flower]
ref|XP_010539347.1|  PREDICTED: potassium channel AKT2/3 isoform X2     205   5e-56   Tarenaya hassleriana [spider flower]
gb|KDO50099.1|  hypothetical protein CISIN_1g038432mg                   202   6e-56   Citrus sinensis [apfelsine]
gb|AAA96153.1|  AKT3                                                    204   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567651.1|  potassium channel AKT2/3                              204   8e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28793.1|  hypothetical protein AALP_AA7G048900                    203   2e-55   Arabis alpina [alpine rockcress]
ref|XP_010439358.1|  PREDICTED: potassium channel AKT2/3                203   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010448923.1|  PREDICTED: potassium channel AKT2/3-like           203   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002441143.1|  hypothetical protein SORBIDRAFT_09g021190          202   4e-55   
ref|XP_006283121.1|  hypothetical protein CARUB_v10004143mg             202   5e-55   
gb|ACF78497.1|  unknown                                                 198   1e-54   Zea mays [maize]
ref|XP_004961989.1|  PREDICTED: potassium channel AKT2-like isofo...    201   2e-54   Setaria italica
ref|XP_004961990.1|  PREDICTED: potassium channel AKT2-like isofo...    201   2e-54   
ref|XP_010434070.1|  PREDICTED: potassium channel AKT2/3-like           199   9e-54   
ref|XP_008655421.1|  PREDICTED: potassium channel protein ZMK2 is...    197   1e-53   Zea mays [maize]
gb|AAV59417.1|  putative potassium channel protein                      196   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055614.1|  Os05g0428700                                       196   1e-53   
ref|NP_001105120.1|  potassium channel protein ZMK2                     198   2e-53   
ref|XP_008647796.1|  PREDICTED: potassium channel AKT2/3 isoform X1     197   2e-53   
gb|AFW81865.1|  potassium channel2                                      197   3e-53   
ref|XP_002441145.1|  hypothetical protein SORBIDRAFT_09g021210          197   3e-53   Sorghum bicolor [broomcorn]
ref|XP_008655420.1|  PREDICTED: potassium channel protein ZMK2 is...    197   3e-53   
ref|NP_001147796.1|  potassium channel AKT2/3                           197   4e-53   Zea mays [maize]
ref|XP_006654434.1|  PREDICTED: potassium channel AKT2-like             197   5e-53   Oryza brachyantha
ref|XP_006413681.1|  hypothetical protein EUTSA_v10024449mg             195   2e-52   Eutrema salsugineum [saltwater cress]
gb|EAY98139.1|  hypothetical protein OsI_20054                          195   2e-52   Oryza sativa Indica Group [Indian rice]
sp|Q75HP9.1|AKT2_ORYSJ  RecName: Full=Potassium channel AKT2            195   2e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CDX82921.1|  BnaC01g13710D                                          193   8e-52   
ref|XP_002867783.1|  hypothetical protein ARALYDRAFT_492645             192   1e-51   
gb|ABE99811.1|  inwardly rectifying potassium channel AKT2              192   2e-51   Hordeum vulgare [barley]
dbj|BAJ96949.1|  predicted protein                                      192   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86681.1|  predicted protein                                      192   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009135705.1|  PREDICTED: potassium channel AKT2/3                191   3e-51   Brassica rapa
emb|CDX79135.1|  BnaA01g12020D                                          191   3e-51   
ref|XP_009405920.1|  PREDICTED: potassium channel AKT2                  187   9e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930758.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    187   1e-49   
gb|ERN20685.1|  hypothetical protein AMTR_s00070p00197870               185   6e-49   Amborella trichopoda
ref|XP_006859218.2|  PREDICTED: potassium channel AKT2/3                185   7e-49   Amborella trichopoda
ref|XP_009403705.1|  PREDICTED: potassium channel AKT2-like isofo...    180   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403704.1|  PREDICTED: potassium channel AKT2-like isofo...    180   3e-47   
ref|XP_009403703.1|  PREDICTED: potassium channel AKT2-like isofo...    180   5e-47   
ref|XP_009403698.1|  PREDICTED: potassium channel AKT2-like isofo...    180   6e-47   
ref|XP_008781668.1|  PREDICTED: potassium channel AKT2-like             171   4e-44   
ref|XP_010681787.1|  PREDICTED: potassium channel AKT2/3 isoform X4     166   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681786.1|  PREDICTED: potassium channel AKT2/3 isoform X3     166   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681785.1|  PREDICTED: potassium channel AKT2/3 isoform X2     166   2e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681784.1|  PREDICTED: potassium channel AKT2/3 isoform X1     166   3e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010529461.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    164   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_007148521.1|  hypothetical protein PHAVU_006G215800g             145   4e-38   Phaseolus vulgaris [French bean]
ref|XP_003568398.1|  PREDICTED: potassium channel AKT2                  154   5e-38   Brachypodium distachyon [annual false brome]
ref|XP_010681788.1|  PREDICTED: potassium channel AKT2/3 isoform X5     106   4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004146262.1|  PREDICTED: potassium channel AKT2/3                105   1e-21   Cucumis sativus [cucumbers]
ref|XP_008456068.1|  PREDICTED: potassium channel AKT2/3                105   1e-21   Cucumis melo [Oriental melon]
gb|EMT08371.1|  hypothetical protein F775_52637                       98.6    5e-19   
ref|XP_009378951.1|  PREDICTED: potassium channel SKOR-like isofo...  88.2    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_009378953.1|  PREDICTED: potassium channel SKOR-like isofo...  87.8    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_004501299.1|  PREDICTED: potassium channel AKT1-like           86.7    3e-15   Cicer arietinum [garbanzo]
ref|XP_008343076.1|  PREDICTED: potassium channel SKOR-like isofo...  86.3    3e-15   
ref|XP_009378952.1|  PREDICTED: potassium channel SKOR-like isofo...  86.3    4e-15   Pyrus x bretschneideri [bai li]
ref|XP_011038255.1|  PREDICTED: potassium channel SKOR-like isofo...  85.9    5e-15   Populus euphratica
ref|XP_006372521.1|  Potassium channel SKOR family protein            85.9    5e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011038254.1|  PREDICTED: potassium channel SKOR-like isofo...  85.9    6e-15   Populus euphratica
ref|XP_010249975.1|  PREDICTED: potassium channel AKT1-like           85.1    8e-15   Nelumbo nucifera [Indian lotus]
ref|XP_009370080.1|  PREDICTED: potassium channel SKOR isoform X3     84.7    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_009370078.1|  PREDICTED: potassium channel SKOR isoform X1     84.7    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_002305894.2|  Potassium channel SKOR family protein            83.6    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008381509.1|  PREDICTED: potassium channel SKOR                83.2    4e-14   
ref|XP_008343077.1|  PREDICTED: potassium channel SKOR-like isofo...  83.2    4e-14   
ref|XP_011043907.1|  PREDICTED: potassium channel SKOR                83.2    4e-14   Populus euphratica
ref|XP_006352480.1|  PREDICTED: potassium channel SKOR-like           83.2    4e-14   Solanum tuberosum [potatoes]
ref|XP_008343075.1|  PREDICTED: potassium channel SKOR-like isofo...  83.2    4e-14   
emb|CDP04802.1|  unnamed protein product                              82.8    5e-14   Coffea canephora [robusta coffee]
gb|KHN08108.1|  Potassium channel AKT1                                81.3    5e-14   Glycine soja [wild soybean]
ref|XP_006579054.1|  PREDICTED: potassium channel AKT1-like           82.4    7e-14   Glycine max [soybeans]
ref|XP_010925255.1|  PREDICTED: potassium channel AKT1-like isofo...  82.0    8e-14   Elaeis guineensis
ref|XP_009802068.1|  PREDICTED: potassium channel SKOR-like           82.0    9e-14   Nicotiana sylvestris
ref|XP_010925257.1|  PREDICTED: potassium channel AKT1-like isofo...  81.6    1e-13   Elaeis guineensis
ref|XP_009626879.1|  PREDICTED: potassium channel SKOR                81.3    1e-13   Nicotiana tomentosiformis
ref|XP_010450509.1|  PREDICTED: potassium channel GORK-like isofo...  80.1    3e-13   
ref|XP_010440864.1|  PREDICTED: potassium channel GORK isoform X2     79.3    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010450508.1|  PREDICTED: potassium channel GORK-like isofo...  79.7    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010440863.1|  PREDICTED: potassium channel GORK isoform X1     79.3    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_003560852.1|  PREDICTED: potassium channel KOR1                79.3    7e-13   Brachypodium distachyon [annual false brome]
ref|XP_010905454.1|  PREDICTED: potassium channel KOR1                78.6    1e-12   
ref|XP_004240037.1|  PREDICTED: potassium channel SKOR-like           78.6    1e-12   Solanum lycopersicum
ref|XP_008787403.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  78.6    1e-12   
ref|XP_007217689.1|  hypothetical protein PRUPE_ppa001431mg           78.2    2e-12   Prunus persica
ref|XP_008244385.1|  PREDICTED: potassium channel SKOR-like           77.8    2e-12   
ref|XP_003526425.1|  PREDICTED: potassium channel AKT1-like           77.8    2e-12   Glycine max [soybeans]
gb|KHN32491.1|  Potassium channel AKT1                                77.8    2e-12   Glycine soja [wild soybean]
ref|XP_003545498.1|  PREDICTED: potassium channel AKT1-like           77.8    3e-12   Glycine max [soybeans]
gb|KHN07100.1|  Potassium channel AKT1                                77.8    3e-12   Glycine soja [wild soybean]
ref|XP_010435585.1|  PREDICTED: potassium channel GORK-like isofo...  77.4    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010919840.1|  PREDICTED: potassium channel KAT3-like           77.4    3e-12   
gb|KDO49853.1|  hypothetical protein CISIN_1g0101682mg                76.6    3e-12   Citrus sinensis [apfelsine]
ref|XP_010435584.1|  PREDICTED: potassium channel GORK-like isofo...  77.4    3e-12   
ref|XP_010435582.1|  PREDICTED: potassium channel GORK-like isofo...  77.4    3e-12   
gb|AAL25648.1|AF197332_1  inward-rectifying K+ channel                77.4    3e-12   Eucalyptus camaldulensis
ref|XP_010435583.1|  PREDICTED: potassium channel GORK-like isofo...  77.4    3e-12   
ref|XP_012086443.1|  PREDICTED: potassium channel SKOR-like isofo...  77.4    3e-12   Jatropha curcas
gb|KDO49854.1|  hypothetical protein CISIN_1g0101682mg                76.6    4e-12   Citrus sinensis [apfelsine]
ref|XP_004250206.1|  PREDICTED: potassium channel SKOR-like           77.0    4e-12   Solanum lycopersicum
gb|EMS48430.1|  Potassium channel SKOR                                77.0    4e-12   Triticum urartu
gb|AAK83636.1|  AT5g37500/mpa22_p_30                                  75.5    4e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAL25649.1|AF197333_1  inward-rectifying K+ channel                77.0    5e-12   Eucalyptus camaldulensis
ref|XP_010432708.1|  PREDICTED: probable potassium channel AKT5       76.6    6e-12   Camelina sativa [gold-of-pleasure]
emb|CAN64951.1|  hypothetical protein VITISV_022830                   76.3    6e-12   Vitis vinifera
ref|XP_002529373.1|  Potassium channel AKT1, putative                 76.3    8e-12   Ricinus communis
ref|XP_004289583.1|  PREDICTED: potassium channel SKOR isoform X2     76.3    8e-12   Fragaria vesca subsp. vesca
ref|XP_011469478.1|  PREDICTED: potassium channel SKOR isoform X1     76.3    8e-12   Fragaria vesca subsp. vesca
ref|XP_007023146.1|  STELAR K+ outward rectifier isoform 2            75.9    9e-12   
ref|XP_007023145.1|  STELAR K+ outward rectifier isoform 1            75.9    1e-11   
gb|EMT23906.1|  hypothetical protein F775_52673                       75.9    1e-11   
gb|AIB06354.1|  potassium channel                                     75.9    1e-11   Saccharum hybrid cultivar [sugarcane]
gb|KDO53362.1|  hypothetical protein CISIN_1g003425mg                 75.5    1e-11   Citrus sinensis [apfelsine]
gb|KDO53361.1|  hypothetical protein CISIN_1g003425mg                 75.5    1e-11   Citrus sinensis [apfelsine]
gb|KCW79761.1|  hypothetical protein EUGRSUZ_C011052                  73.9    1e-11   Eucalyptus grandis [rose gum]
ref|XP_008795354.1|  PREDICTED: potassium channel KOR1                75.5    2e-11   Phoenix dactylifera
ref|XP_003616247.1|  Potassium channel SKOR                           75.5    2e-11   
gb|EMS61998.1|  Potassium channel AKT1                                75.1    2e-11   Triticum urartu
gb|KFK33311.1|  hypothetical protein AALP_AA6G358500                  75.1    2e-11   Arabis alpina [alpine rockcress]
gb|AES99205.2|  potassium outward rectifying channel protein          75.1    2e-11   Medicago truncatula
ref|XP_004140369.2|  PREDICTED: potassium channel SKOR                74.7    2e-11   Cucumis sativus [cucumbers]
ref|XP_006421368.1|  hypothetical protein CICLE_v10004332mg           74.7    2e-11   Citrus clementina [clementine]
ref|XP_009147315.1|  PREDICTED: potassium channel SKOR isoform X2     74.7    2e-11   Brassica rapa
ref|NP_198566.2|  potassium channel GORK                              74.7    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364280.1|  PREDICTED: potassium channel AKT1-like           74.7    3e-11   Solanum tuberosum [potatoes]
gb|KHN06658.1|  Potassium channel AKT1                                74.3    3e-11   Glycine soja [wild soybean]
ref|XP_007161234.1|  hypothetical protein PHAVU_001G053200g           74.3    3e-11   Phaseolus vulgaris [French bean]
emb|CAC17380.1|  guard cell outward rectifying K+ channel             74.3    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010047779.1|  PREDICTED: potassium channel AKT1-like isofo...  74.3    3e-11   Eucalyptus grandis [rose gum]
ref|XP_006286320.1|  hypothetical protein CARUB_v100041251mg          73.9    5e-11   
ref|XP_004490839.1|  PREDICTED: potassium channel SKOR-like           73.9    5e-11   Cicer arietinum [garbanzo]
gb|EEE55080.1|  hypothetical protein OsJ_02815                        73.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KDP32353.1|  hypothetical protein JCGZ_13278                       73.2    7e-11   Jatropha curcas
gb|AAN78090.2|  putative AKT1-like potassium channel                  73.2    7e-11   Hordeum vulgare [barley]
gb|AAP21250.1|  At2g26650                                             73.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180233.1|  potassium channel AKT1                              73.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010325113.1|  PREDICTED: potassium channel AKT1-like           73.2    9e-11   Solanum lycopersicum
ref|XP_010049960.1|  PREDICTED: potassium channel AKT1                73.2    9e-11   Eucalyptus grandis [rose gum]
ref|XP_006360380.1|  PREDICTED: potassium channel SKOR-like           73.2    9e-11   Solanum tuberosum [potatoes]
ref|XP_008460504.1|  PREDICTED: potassium channel SKOR                73.2    9e-11   Cucumis melo [Oriental melon]
gb|KCW82789.1|  hypothetical protein EUGRSUZ_C04163                   73.2    9e-11   Eucalyptus grandis [rose gum]
dbj|BAE99592.1|  K+ transporter                                       72.8    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008659052.1|  PREDICTED: potassium channel KOR1-like isofo...  72.8    9e-11   
ref|XP_010108959.1|  Potassium channel SKOR                           72.8    1e-10   Morus notabilis
ref|XP_008659051.1|  PREDICTED: potassium channel KOR1-like isofo...  72.8    1e-10   Zea mays [maize]
ref|XP_010670702.1|  PREDICTED: potassium channel AKT1-like           72.8    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG09220.1|  hypothetical protein F383_13482                       72.0    1e-10   Gossypium arboreum [tree cotton]
emb|CBI33453.3|  unnamed protein product                              72.4    1e-10   Vitis vinifera
ref|XP_012078936.1|  PREDICTED: potassium channel AKT1-like           72.8    1e-10   Jatropha curcas
ref|XP_009609577.1|  PREDICTED: potassium channel SKOR-like           72.4    1e-10   Nicotiana tomentosiformis
ref|XP_010660282.1|  PREDICTED: shaker-like potassium channel iso...  72.4    2e-10   Vitis vinifera
gb|ABE99810.1|  inwardly rectifying potassium channel AKT1            72.4    2e-10   Hordeum vulgare [barley]
gb|AFO70199.1|  potassium channel SKOR                                72.0    2e-10   Alternanthera philoxeroides
ref|XP_008394035.1|  PREDICTED: potassium channel AKT1-like isofo...  72.0    2e-10   Malus domestica [apple tree]
ref|XP_006427880.1|  hypothetical protein CICLE_v10024904mg           72.0    2e-10   Citrus clementina [clementine]
gb|AAF81249.1|AF267753_1  putative potassium channel protein Mkt1p    72.0    2e-10   Mesembryanthemum crystallinum
dbj|BAD94501.1|  potassium channel - protein                          71.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464999.1|  PREDICTED: potassium channel AKT1 isoform X2     72.0    2e-10   
gb|AFW83425.1|  potassium channel                                     72.0    2e-10   
ref|XP_011656178.1|  PREDICTED: potassium channel AKT1 isoform X2     72.0    2e-10   Cucumis sativus [cucumbers]
ref|XP_006494523.1|  PREDICTED: potassium channel SKOR-like           71.2    2e-10   
ref|XP_008394036.1|  PREDICTED: potassium channel AKT1-like isofo...  72.0    2e-10   
ref|XP_002533481.1|  Potassium channel SKOR, putative                 71.6    2e-10   
gb|AFW83426.1|  hypothetical protein ZEAMMB73_660957                  72.0    2e-10   
ref|XP_003549784.1|  PREDICTED: potassium channel AKT1-like           72.0    2e-10   
ref|XP_007013335.1|  K+ transporter 1                                 71.6    2e-10   
ref|XP_009147314.1|  PREDICTED: potassium channel SKOR isoform X1     71.6    2e-10   Brassica rapa
ref|XP_002282398.2|  PREDICTED: potassium channel SKOR                71.6    3e-10   Vitis vinifera
gb|KHN15126.1|  Potassium channel AKT1                                71.6    3e-10   Glycine soja [wild soybean]
gb|AIY55349.1|  potassium channel AKT1-like protein                   71.6    3e-10   Glycine max [soybeans]
ref|XP_010047932.1|  PREDICTED: potassium channel AKT1-like isofo...  71.6    3e-10   Eucalyptus grandis [rose gum]
ref|XP_004149890.1|  PREDICTED: potassium channel AKT1 isoform X1     71.6    3e-10   Cucumis sativus [cucumbers]
ref|XP_008464998.1|  PREDICTED: potassium channel AKT1 isoform X1     71.2    3e-10   Cucumis melo [Oriental melon]
gb|KJB53297.1|  hypothetical protein B456_009G114200                  71.2    3e-10   Gossypium raimondii
emb|CDY28715.1|  BnaCnng06010D                                        71.2    3e-10   Brassica napus [oilseed rape]
ref|XP_009134714.1|  PREDICTED: potassium channel SKOR                71.2    4e-10   Brassica rapa
gb|KJB53298.1|  hypothetical protein B456_009G114200                  71.2    4e-10   Gossypium raimondii
emb|CDY51528.1|  BnaA05g33280D                                        71.2    4e-10   Brassica napus [oilseed rape]
ref|XP_010670705.1|  PREDICTED: potassium channel AKT1 isoform X1     70.9    5e-10   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD81036.1|  potassium channel TORK1                              70.9    5e-10   Nicotiana tabacum [American tobacco]
ref|XP_009762658.1|  PREDICTED: potassium channel SKOR-like           70.9    5e-10   Nicotiana sylvestris
ref|XP_010670706.1|  PREDICTED: potassium channel AKT1 isoform X2     70.9    5e-10   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX71184.1|  BnaC07g04630D                                        70.5    6e-10   
gb|AAF36832.1|AF207745_1  AKT1-like potassium channel                 70.5    6e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006450501.1|  hypothetical protein CICLE_v10007406mg           70.5    6e-10   Citrus clementina [clementine]
ref|XP_004969311.1|  PREDICTED: potassium channel AKT1-like           70.5    7e-10   Setaria italica
ref|XP_006656846.1|  PREDICTED: potassium channel KOR1-like           70.1    8e-10   
tpg|DAA58342.1|  TPA: potassium channel 1                             70.1    8e-10   
ref|NP_001105480.1|  potassium channel5                               70.1    9e-10   Zea mays [maize]
ref|XP_009102318.1|  PREDICTED: potassium channel GORK isoform X2     70.1    9e-10   
ref|XP_010525078.1|  PREDICTED: potassium channel SKOR-like           70.1    9e-10   Tarenaya hassleriana [spider flower]
ref|XP_009102317.1|  PREDICTED: potassium channel GORK isoform X1     70.1    9e-10   Brassica rapa
emb|CAN69248.1|  hypothetical protein VITISV_012637                   70.1    9e-10   Vitis vinifera
emb|CAI77627.1|  potassium uptake channel                             70.1    1e-09   Zea mays [maize]
emb|CDY32059.1|  BnaA07g03930D                                        69.7    1e-09   Brassica napus [oilseed rape]
ref|XP_008675279.1|  PREDICTED: potassium channel AKT1-like           69.7    1e-09   Zea mays [maize]
ref|XP_010417806.1|  PREDICTED: potassium channel AKT1                69.7    1e-09   Camelina sativa [gold-of-pleasure]
gb|KHG16749.1|  Potassium channel AKT1 -like protein                  69.7    1e-09   Gossypium arboreum [tree cotton]
ref|NP_194976.1|  putative potassium channel AKT5                     69.7    1e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KEH39823.1|  inwardly rectifying potassium channel subunit         69.7    1e-09   Medicago truncatula
ref|XP_002458234.1|  hypothetical protein SORBIDRAFT_03g029520        69.7    1e-09   Sorghum bicolor [broomcorn]
ref|XP_006483310.1|  PREDICTED: potassium channel AKT6-like           69.7    1e-09   Citrus sinensis [apfelsine]
emb|CAB64728.1|  putative potassium channel                           69.7    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279184.2|  PREDICTED: potassium channel SKOR-like           69.3    1e-09   Vitis vinifera
gb|KHN39478.1|  Potassium channel SKOR                                69.3    2e-09   Glycine soja [wild soybean]
emb|CBI15607.3|  unnamed protein product                              69.3    2e-09   Vitis vinifera
ref|XP_003544361.1|  PREDICTED: potassium channel SKOR-like           69.3    2e-09   Glycine max [soybeans]
ref|XP_010069440.1|  PREDICTED: potassium channel SKOR-like isofo...  69.3    2e-09   Eucalyptus grandis [rose gum]
ref|XP_009621376.1|  PREDICTED: potassium channel AKT1-like           69.3    2e-09   Nicotiana tomentosiformis
dbj|BAD81034.1|  potassium channel NKT1                               69.3    2e-09   Nicotiana tabacum [American tobacco]
ref|XP_007141931.1|  hypothetical protein PHAVU_008G238100g           69.3    2e-09   Phaseolus vulgaris [French bean]
ref|XP_008812840.1|  PREDICTED: potassium channel KAT3-like           68.9    2e-09   
emb|CDX74231.1|  BnaA03g28160D                                        68.9    2e-09   
ref|XP_010064842.1|  PREDICTED: potassium channel SKOR-like           68.6    3e-09   
ref|XP_009417677.1|  PREDICTED: potassium channel KOR1-like           68.6    3e-09   
ref|XP_010069438.1|  PREDICTED: potassium channel SKOR-like isofo...  68.6    3e-09   
gb|EAZ00370.1|  hypothetical protein OsI_22386                        68.2    3e-09   
sp|Q653P0.1|KOR1_ORYSJ  RecName: Full=Potassium channel KOR1; Alt...  68.2    3e-09   
ref|XP_010693307.1|  PREDICTED: potassium channel SKOR                68.2    4e-09   
gb|AFW76881.1|  hypothetical protein ZEAMMB73_199716                  67.8    4e-09   
gb|KCW44524.1|  hypothetical protein EUGRSUZ_L019712                  67.4    5e-09   
ref|XP_008392136.1|  PREDICTED: potassium channel AKT1                67.8    5e-09   
dbj|BAJ34505.1|  unnamed protein product                              67.8    5e-09   
gb|EEE65456.1|  hypothetical protein OsJ_20828                        67.8    5e-09   
ref|XP_010474523.1|  PREDICTED: potassium channel AKT1-like           67.4    6e-09   
ref|XP_006405871.1|  hypothetical protein EUTSA_v10027642mg           67.4    6e-09   
ref|XP_004965138.1|  PREDICTED: potassium channel KOR1-like isofo...  67.4    7e-09   
ref|XP_008649281.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  67.4    7e-09   
ref|XP_006293431.1|  hypothetical protein CARUB_v10025578mg           67.4    7e-09   
ref|XP_004965140.1|  PREDICTED: potassium channel KOR1-like isofo...  67.4    7e-09   
emb|CDP01657.1|  unnamed protein product                              67.4    7e-09   
gb|AAW82753.1|  potassium outward rectifying channel                  67.0    8e-09   
ref|XP_003560854.1|  PREDICTED: potassium channel KOR1-like           66.6    1e-08   
ref|XP_010041226.1|  PREDICTED: potassium channel SKOR-like isofo...  66.6    1e-08   
ref|XP_010041229.1|  PREDICTED: potassium channel SKOR-like isofo...  66.6    1e-08   
ref|XP_011652491.1|  PREDICTED: potassium channel AKT1-like           66.6    1e-08   
ref|XP_010670208.1|  PREDICTED: potassium channel SKOR-like isofo...  66.6    1e-08   
gb|KJB64818.1|  hypothetical protein B456_010G066400                  66.6    1e-08   
ref|XP_010670209.1|  PREDICTED: potassium channel SKOR-like isofo...  66.2    1e-08   
emb|CDX92017.1|  BnaC03g33190D                                        66.2    1e-08   
emb|CDY35373.1|  BnaA04g14740D                                        66.2    2e-08   
gb|KFK41169.1|  hypothetical protein AALP_AA2G094700                  66.2    2e-08   
gb|AGT17430.1|  potassium channel                                     65.5    2e-08   
ref|XP_010463711.1|  PREDICTED: potassium channel SKOR-like           65.9    2e-08   
ref|XP_010062297.1|  PREDICTED: potassium channel SKOR-like           65.9    2e-08   
ref|XP_010553885.1|  PREDICTED: potassium channel GORK                65.9    2e-08   
emb|CDY55714.1|  BnaC04g37620D                                        65.9    2e-08   
ref|XP_006841929.2|  PREDICTED: potassium channel AKT1                65.5    3e-08   
ref|XP_010533190.1|  PREDICTED: potassium channel AKT1                65.5    3e-08   
ref|XP_009414085.1|  PREDICTED: potassium channel KOR1-like           65.5    3e-08   
ref|XP_010447376.1|  PREDICTED: probable potassium channel AKT5       65.5    3e-08   
gb|ERN03604.1|  hypothetical protein AMTR_s00042p00201380             65.5    3e-08   
ref|XP_006296988.1|  hypothetical protein CARUB_v10012982mg           65.5    3e-08   
ref|XP_010546590.1|  PREDICTED: potassium channel AKT6                65.5    3e-08   
ref|XP_010549861.1|  PREDICTED: potassium channel SKOR isoform X1     65.1    3e-08   
ref|XP_010549862.1|  PREDICTED: potassium channel SKOR isoform X2     65.1    4e-08   
ref|XP_010278171.1|  PREDICTED: potassium channel SKOR-like           65.1    4e-08   
ref|XP_009140622.1|  PREDICTED: potassium channel AKT1                65.1    4e-08   
ref|XP_006646148.1|  PREDICTED: potassium channel AKT1-like           65.1    4e-08   
ref|XP_010485613.1|  PREDICTED: potassium channel SKOR                65.1    4e-08   
ref|XP_006421090.1|  hypothetical protein CICLE_v10004424mg           64.3    7e-08   
ref|XP_003518370.1|  PREDICTED: potassium channel SKOR-like isofo...  64.3    7e-08   
gb|ABR17684.1|  unknown                                               63.9    8e-08   
ref|XP_011019759.1|  PREDICTED: potassium channel AKT1 isoform X2     63.9    8e-08   
ref|XP_006575479.1|  PREDICTED: potassium channel SKOR-like isofo...  63.9    9e-08   
ref|XP_008466383.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  63.5    1e-07   
ref|XP_011081924.1|  PREDICTED: potassium channel AKT1-like           63.5    1e-07   
ref|XP_010670704.1|  PREDICTED: potassium channel AKT1-like           63.5    1e-07   
ref|NP_001268087.1|  shaker-like potassium channel                    63.5    1e-07   
ref|NP_001275347.1|  potassium channel AKT1-like                      63.2    1e-07   
ref|XP_008783946.1|  PREDICTED: potassium channel KAT3 isoform X4     63.2    1e-07   
ref|XP_002438159.1|  hypothetical protein SORBIDRAFT_10g008960        63.2    2e-07   
ref|XP_008783945.1|  PREDICTED: potassium channel KAT3 isoform X3     63.2    2e-07   
ref|XP_008783944.1|  PREDICTED: potassium channel KAT3 isoform X2     63.2    2e-07   
ref|XP_010274961.1|  PREDICTED: potassium channel KAT1-like isofo...  62.8    2e-07   
ref|XP_008783943.1|  PREDICTED: potassium channel KAT2 isoform X1     63.2    2e-07   
gb|EYU21946.1|  hypothetical protein MIMGU_mgv1a001079mg              62.8    2e-07   
ref|XP_011019758.1|  PREDICTED: potassium channel AKT1 isoform X1     62.8    2e-07   
ref|XP_010274957.1|  PREDICTED: potassium channel KAT3-like isofo...  62.8    2e-07   
ref|XP_002324845.2|  hypothetical protein POPTR_0018s01360g           62.4    2e-07   
dbj|BAE98861.1|  stelar K+ outward rectifying channel                 62.0    2e-07   
ref|XP_010510883.1|  PREDICTED: potassium channel AKT1-like           62.4    3e-07   
ref|NP_001234258.1|  potassium channel                                62.4    3e-07   
ref|XP_011083318.1|  PREDICTED: potassium channel SKOR-like           62.0    4e-07   
gb|EMS48433.1|  Potassium channel SKOR                                62.0    4e-07   
ref|XP_003609240.1|  Potassium channel                                61.6    4e-07   
ref|XP_010502003.1|  PREDICTED: potassium channel SKOR-like           61.6    6e-07   
ref|XP_004508539.1|  PREDICTED: potassium channel AKT1-like isofo...  61.2    7e-07   
ref|XP_004508540.1|  PREDICTED: potassium channel AKT1-like isofo...  61.2    7e-07   
ref|XP_001306280.1|  ankyrin repeat protein                           60.8    7e-07   
ref|XP_011026492.1|  PREDICTED: potassium channel AKT1-like           61.2    7e-07   
ref|XP_006408729.1|  hypothetical protein EUTSA_v10001904mg           61.2    8e-07   
ref|NP_001291230.1|  potassium channel AKT1-like                      61.2    8e-07   
gb|EMT24347.1|  Potassium channel SKOR                                60.8    8e-07   
ref|XP_006408375.1|  hypothetical protein EUTSA_v10020072mg           60.5    1e-06   
emb|CAC87141.1|  K+ channel protein                                   60.5    1e-06   
ref|NP_186934.1|  potassium channel SKOR                              60.5    1e-06   
emb|CAA11281.1|  stelar K+ outward rectifying channel                 60.5    1e-06   
emb|CAA11280.1|  SKOR                                                 60.5    1e-06   
gb|EYU45764.1|  hypothetical protein MIMGU_mgv1a001332mg              60.5    1e-06   
ref|XP_011085902.1|  PREDICTED: potassium channel SKOR-like           60.1    1e-06   
gb|EES53925.1|  Ankyrin                                               58.2    2e-06   
gb|EYU29239.1|  hypothetical protein MIMGU_mgv1a001125mg              60.1    2e-06   
ref|XP_011085880.1|  PREDICTED: potassium channel SKOR-like           59.7    2e-06   
ref|XP_006371939.1|  k transporter family protein                     59.7    2e-06   
ref|XP_001329554.1|  hypothetical protein                             59.3    2e-06   
ref|XP_007137050.1|  hypothetical protein PHAVU_009G095700g           59.3    2e-06   
ref|XP_004287371.1|  PREDICTED: potassium channel AKT1                59.7    2e-06   
ref|XP_009772048.1|  PREDICTED: potassium channel AKT1                59.3    3e-06   
ref|XP_001307718.1|  ankyrin repeat protein                           58.9    3e-06   
emb|CDP03401.1|  unnamed protein product                              58.9    3e-06   
ref|XP_008242715.1|  PREDICTED: potassium channel AKT1                59.3    3e-06   
ref|NP_001268073.1|  inward rectifying shaker-like K+ channel         59.3    3e-06   
gb|AES64187.2|  inwardly rectifying potassium channel subunit         59.3    3e-06   
ref|XP_003593936.1|  Potassium channel                                59.3    3e-06   
ref|XP_009619489.1|  PREDICTED: potassium channel AKT1-like           59.3    3e-06   
ref|XP_010098980.1|  Potassium channel AKT1                           58.9    4e-06   
ref|XP_011085793.1|  PREDICTED: potassium channel AKT1-like isofo...  58.9    4e-06   
ref|XP_011085715.1|  PREDICTED: potassium channel AKT1-like isofo...  58.9    4e-06   
ref|NP_001291250.1|  uncharacterized protein LOC105118640             58.5    5e-06   
ref|XP_007013809.1|  Shaker pollen inward K+ channel isoform 1        58.5    5e-06   
ref|XP_007137051.1|  hypothetical protein PHAVU_009G095700g           58.5    5e-06   
ref|XP_008219894.1|  PREDICTED: potassium channel AKT1-like           58.5    5e-06   
ref|XP_007225029.1|  hypothetical protein PRUPE_ppa019987mg           58.5    5e-06   
ref|XP_006285898.1|  hypothetical protein CARUB_v10007410mg           58.5    5e-06   
emb|CAC10514.1|  outwardly rectifying potassium channel               58.5    5e-06   
ref|XP_011096553.1|  PREDICTED: potassium channel KAT3-like           58.2    6e-06   
ref|XP_003569453.1|  PREDICTED: potassium channel AKT1 isoform X1     58.2    6e-06   
gb|KJB83170.1|  hypothetical protein B456_013G232800                  58.2    6e-06   
gb|KFK32558.1|  hypothetical protein AALP_AA6G258700                  58.2    6e-06   
ref|XP_010051190.1|  PREDICTED: potassium channel AKT1-like           58.2    7e-06   
gb|KCW81436.1|  hypothetical protein EUGRSUZ_C02815                   57.8    8e-06   
ref|XP_001329422.1|  ankyrin repeat protein                           58.2    8e-06   
ref|XP_010271227.1|  PREDICTED: potassium channel SKOR                57.8    8e-06   
ref|XP_002317705.1|  Potassium channel SKOR family protein            57.8    8e-06   
ref|XP_001329769.1|  ankyrin repeat protein                           57.4    1e-05   
ref|NP_955040.1|  CNPV017 ankyrin repeat protein                      57.4    1e-05   
emb|CAN80462.1|  hypothetical protein VITISV_015412                   57.4    1e-05   
ref|XP_008337414.1|  PREDICTED: potassium channel AKT1-like           57.0    1e-05   
ref|XP_007025090.1|  Potassium channel in 2                           57.0    1e-05   
ref|XP_011629401.1|  PREDICTED: potassium channel KOR1                57.0    1e-05   
gb|AHZ30618.1|  potassium channel AKT1                                57.0    2e-05   
emb|CAC05488.1|  outward rectifying potassium channel                 57.0    2e-05   
ref|XP_010056887.1|  PREDICTED: potassium channel KAT3                56.6    2e-05   
ref|XP_001323396.1|  ankyrin repeat protein                           56.6    2e-05   
ref|NP_001284388.1|  potassium channel KAT3-like                      56.6    2e-05   
ref|XP_009348193.1|  PREDICTED: potassium channel AKT1                56.6    2e-05   
gb|ERM93810.1|  hypothetical protein AMTR_s00138p00019640             56.6    2e-05   
gb|AAL24466.1|AF359522_1  inward rectifying potassium channel         56.6    2e-05   
ref|XP_010279668.1|  PREDICTED: potassium channel KAT3                56.6    2e-05   
ref|XP_003524528.2|  PREDICTED: potassium channel AKT1-like           56.6    2e-05   
gb|KHN27401.1|  Potassium channel AKT1                                56.6    2e-05   
emb|CAZ64538.1|  inward rectifying shaker-like K+ channel             56.2    2e-05   
ref|XP_001580069.1|  ankyrin repeat protein                           56.2    3e-05   
gb|EYU43265.1|  hypothetical protein MIMGU_mgv1a002597mg              56.2    3e-05   
ref|XP_008352270.1|  PREDICTED: potassium channel AKT1-like           56.2    3e-05   
ref|XP_002533451.1|  Potassium channel SKOR, putative                 56.2    3e-05   
gb|AAA32812.1|  ankyrin repeat-containing protein                     55.8    3e-05   
ref|XP_002281787.1|  PREDICTED: potassium channel AKT1-like isofo...  55.8    3e-05   
emb|CBI28150.3|  unnamed protein product                              55.8    4e-05   
ref|XP_010656397.1|  PREDICTED: potassium channel AKT1-like isofo...  55.8    4e-05   
ref|XP_009771773.1|  PREDICTED: potassium channel SKOR-like isofo...  55.5    4e-05   
ref|XP_009771782.1|  PREDICTED: potassium channel SKOR-like isofo...  55.5    4e-05   
emb|CBI20997.3|  unnamed protein product                              55.5    4e-05   
ref|WP_036246000.1|  ankryin                                          55.1    5e-05   
ref|XP_001325696.1|  ankyrin repeat protein                           53.1    5e-05   
gb|KCW44523.1|  hypothetical protein EUGRSUZ_L019712                  55.1    5e-05   
ref|XP_010472568.1|  PREDICTED: potassium channel AKT6-like           55.5    5e-05   
ref|NP_001291244.1|  potassium channel SKOR-like                      55.1    5e-05   
ref|XP_011657374.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  55.1    6e-05   
gb|KGN65561.1|  hypothetical protein Csa_1G448920                     55.1    6e-05   
ref|XP_007204288.1|  hypothetical protein PRUPE_ppa001241mg           55.1    6e-05   
gb|KHG13316.1|  Potassium channel KAT3 -like protein                  52.4    6e-05   
ref|XP_009771768.1|  PREDICTED: potassium channel SKOR-like isofo...  55.1    6e-05   
emb|CDY03233.1|  BnaC09g19230D                                        55.1    6e-05   
ref|WP_013867680.1|  ankyrin                                          52.0    6e-05   
gb|KCW69414.1|  hypothetical protein EUGRSUZ_F028821                  55.1    7e-05   
ref|XP_004235283.1|  PREDICTED: potassium channel SKOR-like           55.1    7e-05   
emb|CDX75249.1|  BnaA01g04530D                                        55.1    7e-05   
gb|ADA79674.1|  shaker-like potassium channel 1                       54.7    7e-05   
ref|XP_010538533.1|  PREDICTED: potassium channel KAT1                54.7    8e-05   
ref|XP_001328189.1|  hypothetical protein                             54.3    9e-05   
gb|AAU91564.1|  ankyrin repeat domain protein                         54.3    1e-04   
ref|XP_008219833.1|  PREDICTED: potassium channel KAT3                54.3    1e-04   
ref|XP_009125933.1|  PREDICTED: probable potassium channel AKT5       54.3    1e-04   
gb|KJB82866.1|  hypothetical protein B456_013G218200                  54.3    1e-04   
ref|WP_041361236.1|  ankryin                                          54.3    1e-04   
ref|XP_010423759.1|  PREDICTED: potassium channel AKT6                54.3    1e-04   
gb|KJB07163.1|  hypothetical protein B456_001G002700                  54.3    1e-04   
ref|XP_011014911.1|  PREDICTED: potassium channel AKT1-like           54.3    1e-04   
ref|XP_009799566.1|  PREDICTED: potassium channel AKT1-like isofo...  54.3    1e-04   
ref|XP_009799565.1|  PREDICTED: potassium channel AKT1-like isofo...  54.3    1e-04   
ref|XP_001314616.1|  ankyrin repeat protein                           53.9    1e-04   
ref|XP_011003761.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...  54.3    1e-04   
ref|XP_001322579.1|  ankyrin repeat protein                           53.9    1e-04   
emb|CAG27094.1|  inwardly rectifying potassium channel subunit        53.9    2e-04   
emb|CAN78157.1|  hypothetical protein VITISV_032798                   53.9    2e-04   
gb|KHG04443.1|  Potassium channel KAT1 -like protein                  53.9    2e-04   
ref|NP_001268010.1|  inward rectifying shaker-like K+ channel         53.9    2e-04   
gb|KJB57246.1|  hypothetical protein B456_009G155200                  53.5    2e-04   
ref|XP_001328606.1|  ankyrin repeat protein                           53.5    2e-04   
gb|KJB57248.1|  hypothetical protein B456_009G155200                  53.5    2e-04   
gb|KJB57247.1|  hypothetical protein B456_009G155200                  53.5    2e-04   
ref|XP_010526124.1|  PREDICTED: potassium channel KAT3 isoform X2     53.5    2e-04   
ref|XP_010526123.1|  PREDICTED: potassium channel KAT3 isoform X1     53.5    2e-04   
ref|XP_009114367.1|  PREDICTED: potassium channel KAT1                53.5    2e-04   
emb|CDY35154.1|  BnaA09g17910D                                        53.5    2e-04   
ref|XP_007036946.1|  STELAR K+ outward rectifier isoform 1            53.5    2e-04   
gb|KHG28816.1|  Potassium channel AKT1 -like protein                  53.5    2e-04   
ref|XP_007151492.1|  hypothetical protein PHAVU_004G051200g           53.1    2e-04   
ref|XP_010665823.1|  PREDICTED: potassium channel KAT3-like isofo...  53.1    2e-04   
ref|XP_001276871.1|  ankyrin repeat protein                           53.1    2e-04   
emb|CDX68851.1|  BnaC01g06020D                                        53.5    2e-04   
ref|XP_010665824.1|  PREDICTED: potassium channel KAT3-like isofo...  53.1    2e-04   
ref|XP_001581419.1|  ankyrin repeat protein                           53.1    2e-04   
ref|XP_001582590.1|  ankyrin repeat protein                           53.1    2e-04   
ref|XP_009400651.1|  PREDICTED: potassium channel AKT1-like           53.1    2e-04   
ref|XP_001579989.1|  ankyrin repeat protein                           52.8    2e-04   
gb|EEC76672.1|  hypothetical protein OsI_14643                        52.0    2e-04   
ref|XP_001313907.1|  hypothetical protein                             53.1    3e-04   
gb|KJB69811.1|  hypothetical protein B456_011G043500                  52.8    3e-04   
ref|XP_004486026.1|  PREDICTED: potassium channel KAT1-like isofo...  52.8    3e-04   
ref|XP_003530386.1|  PREDICTED: potassium channel KAT1-like           52.8    3e-04   
emb|CEF76425.1|  unnamed protein product                              53.1    3e-04   
ref|XP_001323771.1|  ankyrin repeat protein                           52.8    3e-04   
ref|XP_004486027.1|  PREDICTED: potassium channel KAT1-like isofo...  52.8    3e-04   
ref|XP_004486028.1|  PREDICTED: potassium channel KAT1-like isofo...  52.8    3e-04   
ref|XP_010429557.1|  PREDICTED: potassium channel AKT6                52.8    3e-04   
ref|XP_009614693.1|  PREDICTED: potassium channel SKOR-like           52.0    3e-04   
ref|XP_007221853.1|  hypothetical protein PRUPE_ppa021985mg           52.8    3e-04   
ref|XP_001330105.1|  ankyrin repeat protein                           52.4    3e-04   
ref|XP_011320658.1|  hypothetical protein FGSG_08155                  52.8    3e-04   
ref|XP_001323779.1|  ankyrin repeat protein                           52.8    4e-04   
ref|XP_005829372.1|  hypothetical protein GUITHDRAFT_74026            49.7    4e-04   
gb|EYU27297.1|  hypothetical protein MIMGU_mgv1a022010mg              52.8    4e-04   



>emb|CAA70947.1| putative inward rectifying potassium channel [Solanum tuberosum]
Length=468

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 183/231 (79%), Gaps = 2/231 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ G+TALW+AIAAK HS F +LYHWAS+SDPY+AGDLLC AA+ ND +VM+ELLKHG
Sbjct  237  LRDVNGHTALWEAIAAKHHSTFHVLYHWASVSDPYIAGDLLCTAARKNDLTVMKELLKHG  296

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDR GSTAI  A+E+N  DM+KLL+MNGAEI+D +K  L+ ++L+++LQKRE+GH
Sbjct  297  LQVDSKDRDGSTAIHVALEQNLEDMVKLLLMNGAEINDKLKYKLSSMNLSDMLQKREVGH  356

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            R+ + +T + E A KW + + Q N+ S   Q   RVSIYRGHP TRR T C EPG+LIKL
Sbjct  357  RVMVSDT-MDEVAQKWREQEKQHNTESTRDQYYFRVSIYRGHPVTRRRTHCSEPGKLIKL  415

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
            P ++A L  IAG K GFDAT++S+TD+EG+ IDSI+VIRDNDKLFIV   N
Sbjct  416  PNSLAVLKIIAGAKFGFDATNASVTDQEGSEIDSIEVIRDNDKLFIVEGPN  466



>ref|XP_011087731.1| PREDICTED: potassium channel AKT2/3 [Sesamum indicum]
Length=847

 Score =   308 bits (788),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 180/231 (78%), Gaps = 0/231 (0%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D  GNTALWDAIAAK HSIF ILYHWASISDPYVAGDLLC AA+ NDS+VM+ELLKHG
Sbjct  615  LRDFNGNTALWDAIAAKHHSIFKILYHWASISDPYVAGDLLCMAARRNDSTVMKELLKHG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRHG TAIQ A EEN  DM+K L+MNG+E+++ VK  ++ ++L E+LQKRE+GH
Sbjct  675  LYVDSKDRHGLTAIQVATEENHMDMVKFLLMNGSEVNEIVKNKISSVNLNEMLQKREVGH  734

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            RI +P+ +          D  +N  S       RVSIY+GHP  RRE++C EPGRLI+LP
Sbjct  735  RIVVPDMLNENVLGVNGNDQQRNGESTKGLVLSRVSIYKGHPTNRRESRCSEPGRLIRLP  794

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
             ++AEL  IAG+K GFDAT++ LT+EEGA IDSI+VIRDNDKLFIV + +S
Sbjct  795  GSLAELKGIAGQKFGFDATNALLTNEEGAEIDSIEVIRDNDKLFIVENPDS  845



>ref|XP_004230485.1| PREDICTED: potassium channel AKT2/3-like [Solanum lycopersicum]
Length=837

 Score =   306 bits (784),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 182/227 (80%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ G+TALW+AIAAK HS F +LYHWAS+SDPY+AGDLLC AA+ ND +VM+ELLKHG
Sbjct  606  LRDVNGHTALWEAIAAKHHSTFHVLYHWASVSDPYIAGDLLCTAARKNDLTVMKELLKHG  665

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDR GSTAI  A+EEN  DM+KLL+MNGAEI+D +K  L+ ++L ++LQKRE+GH
Sbjct  666  LQVDSKDRDGSTAIHVALEENLEDMVKLLLMNGAEINDKLKYKLSSMNLNDMLQKREVGH  725

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            RI + +T + E A KW + + Q NS S   Q S RVSIYRGHP  RR T C EPG+LI L
Sbjct  726  RIMVSDT-MDEVAQKWRQQEKQHNSESTRDQMSFRVSIYRGHPVIRRRTHCSEPGKLITL  784

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            P ++AEL  IAG+K GFDAT++S+TD+EG+ IDSI+VIRDNDKLFIV
Sbjct  785  PNSLAELKIIAGQKFGFDATNASITDQEGSEIDSIEVIRDNDKLFIV  831



>ref|XP_009791067.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana sylvestris]
Length=837

 Score =   306 bits (783),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 182/231 (79%), Gaps = 2/231 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D+ GNTALW+AIAAK+HS F ILYHWAS+SDPYVAG+LLC AAK ND +VM+ELLKHG
Sbjct  606  LPDVNGNTALWEAIAAKQHSTFRILYHWASVSDPYVAGELLCTAAKRNDITVMKELLKHG  665

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDRHGSTAI  A+ EN  DM+KLL+MNGAEI+D  K  L+ ++L E+LQKRE+GH
Sbjct  666  LTVDSKDRHGSTAIDVALGENHEDMVKLLLMNGAEINDKFKHKLSSMNLREILQKREVGH  725

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            R+ +P+T + E A KW + + + NS S   Q S RVSIY+GHP  R+ T C EPG+LI L
Sbjct  726  RVIVPDT-MDEVAQKWREQEQKYNSGSTRDQSSFRVSIYKGHPVIRKRTHCCEPGKLIML  784

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
            P ++AEL  IAG+K GFDAT + +TD+EG+ IDSI+VIRDNDKL+IV D N
Sbjct  785  PNSLAELKIIAGQKFGFDATKALVTDQEGSEIDSIEVIRDNDKLYIVEDPN  835



>dbj|BAA84085.1| potassium channel [Nicotiana paniculata]
Length=824

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 183/229 (80%), Gaps = 2/229 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AIAAK+H  F ILYHWAS+SDPYVAG+LLC AAK N+ +VM+ELLKHG
Sbjct  593  LRDVNGNTALWEAIAAKQHPTFQILYHWASVSDPYVAGELLCTAAKRNELTVMKELLKHG  652

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDS DRHGSTAI  A+EEN  DM+KLL+MNGAEI+D  K  L+ ++L+E+LQKRE+GH
Sbjct  653  LIVDSIDRHGSTAIHVALEENHEDMVKLLLMNGAEINDKFKHKLSSMNLSEMLQKREVGH  712

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            R+ +P+T + E A KW + + + NS S   Q S RVSIY+GHP  R+ T C EPG+LI L
Sbjct  713  RVIVPDT-MDEVAQKWREQEQKYNSGSTRDQSSFRVSIYKGHPVIRKRTHCSEPGKLIIL  771

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P ++AEL  IAG+K GFDAT++ +TD+EG+ IDSI+VIRDNDKLFIV D
Sbjct  772  PNSLAELKIIAGQKFGFDATNALVTDQEGSEIDSIEVIRDNDKLFIVED  820



>ref|XP_009614130.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana tomentosiformis]
Length=824

 Score =   304 bits (778),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 182/229 (79%), Gaps = 2/229 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AIA K+H  F ILYHWAS+SDPYVAG+LLC AAK ND +VM+ELLKHG
Sbjct  593  LRDVNGNTALWEAIAEKQHPTFRILYHWASVSDPYVAGELLCTAAKRNDLTVMKELLKHG  652

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDRHGSTAI  A+EEN  DM+KLL+MNGAEI+D  K  L+ ++L+E+LQKRE+GH
Sbjct  653  LIVDSKDRHGSTAIHVALEENHEDMVKLLLMNGAEINDKFKHKLSSMNLSEMLQKREVGH  712

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            R+ + +T + E A KW + + + NS S   Q S RVSIY+GHP  R+ T C EPG+LI L
Sbjct  713  RVIVSDT-MDEVAQKWREQEQKYNSGSTRDQSSFRVSIYKGHPVIRKRTHCSEPGKLIIL  771

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P ++AEL  IAG+K GFDAT++ +TD+EG+ IDSI+VIRDNDKLFIV D
Sbjct  772  PNSLAELKIIAGQKFGFDATNALVTDQEGSEIDSIEVIRDNDKLFIVED  820



>ref|XP_006349369.1| PREDICTED: potassium channel AKT2/3-like [Solanum tuberosum]
Length=837

 Score =   302 bits (774),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 182/227 (80%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ G+TALW+AIAAK HS F +LYHWAS+SDPY+AGDLLC AA+ ND +VM+ELLKHG
Sbjct  606  LRDVNGHTALWEAIAAKHHSTFHVLYHWASVSDPYIAGDLLCTAARKNDLTVMKELLKHG  665

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDR GSTAI  A+EEN  DM+KLL+MNGAEI+D +K  L+ ++L+++LQKRE+GH
Sbjct  666  LQVDSKDRDGSTAIHVALEENLEDMVKLLLMNGAEINDKLKYKLSSMNLSDMLQKREVGH  725

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            R+ + +T + E A KW +   Q N+ S   Q S RVSIYR HP  RR T C EPG+LIKL
Sbjct  726  RVMVSDT-MDEVAQKWREQVKQHNTESTRDQSSFRVSIYRSHPVIRRRTHCSEPGKLIKL  784

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            P ++AEL  IAG+K GFDAT++++TD+EG+ IDSI+VIRDNDKLFIV
Sbjct  785  PNSLAELKIIAGQKFGFDATNAAVTDQEGSEIDSIEVIRDNDKLFIV  831



>gb|ABF85695.1| potassium channel [Nicotiana rustica]
Length=826

 Score =   301 bits (772),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 184/231 (80%), Gaps = 4/231 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AIAAK+HS F ILYHWAS+SDPYVAG+LLC AAK ND +VM+ELL+HG
Sbjct  593  LRDVNGNTALWEAIAAKQHSTFRILYHWASVSDPYVAGELLCTAAKRNDLTVMKELLEHG  652

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDRHGSTAI  A+EEN  DM+ LL+MNGAEI+D  K  L+ ++L+E+LQKRE+GH
Sbjct  653  LIVDSKDRHGSTAIHVALEENHEDMVNLLLMNGAEINDKFKHKLSSMNLSEMLQKREVGH  712

Query  573  RIAMPNTILHEAASKWAKDD--HQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
            R+ +P+T + E A KW + +  + + S+   Q   RVSIY+GHP  R+ T C EPG+LI 
Sbjct  713  RVIVPDT-MDEVAQKWREQEQKYNSGSTRRDQSCFRVSIYKGHPVIRKRTHCSEPGKLII  771

Query  399  LPETIAELISIAGEKLGFDATDSSL-TDEEGAIIDSIDVIRDNDKLFIVAD  250
            LP ++AEL  IAG+K GFDAT+++L TDEEG+ IDSI+VIRDNDKLFIV D
Sbjct  772  LPNSLAELKIIAGQKFGFDATNAALVTDEEGSEIDSIEVIRDNDKLFIVED  822



>dbj|BAD81033.1| potassium channel NKT2 [Nicotiana tabacum]
Length=824

 Score =   301 bits (772),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 181/229 (79%), Gaps = 2/229 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AIA K+H  F ILYHWAS+SDPYVAG+LLC AAK ND +VM+ELLKHG
Sbjct  593  LRDVNGNTALWEAIAEKQHPTFRILYHWASVSDPYVAGELLCTAAKRNDLTVMKELLKHG  652

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDRHGSTAI  A+EEN  DM+KLL+MNGAEI+D  K  L+ ++L+E+LQKRE+GH
Sbjct  653  LIVDSKDRHGSTAIHVALEENHEDMVKLLLMNGAEINDKFKHKLSSMNLSEMLQKREVGH  712

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            R+ + +T + E A KW + + + NS +   Q S RVSIY+GHP  R+ T C EPG+LI L
Sbjct  713  RVIVSDT-MDEVAQKWREQEQKYNSGNTRDQSSFRVSIYKGHPVIRKRTHCSEPGKLIIL  771

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P ++AEL  IAG+K GFDAT++  TD+EG+ IDSI+VIRDNDKLFIV D
Sbjct  772  PNSLAELKIIAGQKFGFDATNALATDQEGSEIDSIEVIRDNDKLFIVED  820



>ref|XP_009795716.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana sylvestris]
Length=864

 Score =   302 bits (773),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/232 (63%), Positives = 183/232 (79%), Gaps = 2/232 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AIAAK H IF ILYHWASI+DPYVAGDLLC AA+ ND ++M+ELLKHG
Sbjct  632  LQDVNGNTALWEAIAAKHHPIFEILYHWASIADPYVAGDLLCTAARKNDLTIMKELLKHG  691

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDRHGST I+ A+EEN  +M+KLL++NGAEIDD +K  L+ ++LTE+LQKRE+GH
Sbjct  692  LLVDSKDRHGSTPIRVAIEENHVEMVKLLLINGAEIDDILKYKLSSMNLTEMLQKREVGH  751

Query  573  RIAMPNTILHEAASKWAKDDHQNSS-SMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            RI + +    +   KW + + + +S S   QCS RVSIYRGHP  RR T C EPG+LI+L
Sbjct  752  RIIVSDAT-DDFDRKWCEQEQKYASESCKDQCSFRVSIYRGHPEVRRRTHCSEPGKLIRL  810

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
            P ++ EL + AG+K+G DA D+ +TDE+GA IDSI+VIRDNDKLFIV D NS
Sbjct  811  PNSLEELKNTAGQKIGCDAKDAVVTDEQGAEIDSIEVIRDNDKLFIVEDINS  862



>ref|XP_009616703.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana tomentosiformis]
Length=847

 Score =   300 bits (767),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 175/231 (76%), Gaps = 0/231 (0%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AIAAK H IF ILYHWASISDPYVAGDLLC AA+ ND ++M+ELLKHG
Sbjct  615  LQDVNGNTALWEAIAAKHHPIFEILYHWASISDPYVAGDLLCTAARRNDLTIMKELLKHG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDRHGST I  A+EEN  +M+KLL++NGAEIDD +K  L+ ++L+E+LQKRE+GH
Sbjct  675  LLVDSKDRHGSTPIHVAIEENHVEMVKLLLINGAEIDDTLKYKLSSMNLSEILQKREVGH  734

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            RI + +           ++      S   QCS RVSIYRGHP  RR T C EPGRLI+LP
Sbjct  735  RIIVSDATDEFDHKLCEQEQKYGFESSKDQCSFRVSIYRGHPEVRRRTHCSEPGRLIRLP  794

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
             ++ EL S AG+K G DA D+ +TDE+GA IDSI+VIRDNDKLFIV D NS
Sbjct  795  NSLEELKSTAGQKFGCDAKDALVTDEQGAEIDSIEVIRDNDKLFIVEDINS  845



>emb|CDO97567.1| unnamed protein product [Coffea canephora]
Length=848

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 185/236 (78%), Gaps = 6/236 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D++GNTA+W+A+AAK   +F ILYHWASISDPY+AGDLLC AA+ ND++VM+ELLK G
Sbjct  610  LQDIDGNTAIWEAVAAKHQPVFRILYHWASISDPYLAGDLLCTAARKNDAAVMKELLKQG  669

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            LH+DSKD HG TAIQ A+ ENQ DMIKLL+MNGAE+DD +K  L+ +++ E+LQKRE+GH
Sbjct  670  LHIDSKDPHGMTAIQVAVTENQTDMIKLLLMNGAEVDDIIKHKLSSINVNEMLQKREVGH  729

Query  573  RIAMPNTILHEAASKWAKDDHQ-----NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            RI +P+T L + A KW +  H+     +  +   + SIRVSIYRGHP  R++ +C EPGR
Sbjct  730  RITVPDT-LGQDAFKWNEIKHECDKECSEGTCSTRVSIRVSIYRGHPVIRKDIRCSEPGR  788

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
            LI LP+++ EL +IAG+K GFDAT++++  E GA IDSI+VIRDNDK+F + D +S
Sbjct  789  LISLPKSLTELKNIAGKKFGFDATNAAVVSEGGAEIDSIEVIRDNDKIFFIEDHSS  844



>ref|NP_001275259.1| potassium channel AKT2/3-like [Solanum tuberosum]
 emb|CAA70870.1| putative inward rectifying potassium channel [Solanum tuberosum]
Length=845

 Score =   282 bits (722),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 182/237 (77%), Gaps = 12/237 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ G+TALW+AIAAK+H IF ILYHWA ISDPYV+GDLLCKAA+ N+ ++M+ELLKHG
Sbjct  613  LQDVNGDTALWEAIAAKQHPIFEILYHWACISDPYVSGDLLCKAARRNELTIMKELLKHG  672

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L V+S DRH STAI  A+EEN  +M+KLL++NG EIDD +K  L+ ++L+E+LQK+++GH
Sbjct  673  LLVNSNDRHRSTAIHVAIEENHLEMVKLLLLNGDEIDDTLKDKLSSMNLSEMLQKQDVGH  732

Query  573  RIAMPNTI------LHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPG  412
            RI + +T+       HE   K+  + H +      QC+ RVSIYRGHP  RR TQC E G
Sbjct  733  RIIISDTMDEVDHKEHEQEQKYDFESHTD------QCAFRVSIYRGHPEFRRRTQCNELG  786

Query  411  RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
            RLIKLP+++A+L  IAG+K GF+A D+ +T+EEGA IDS++VIRDNDKL+IV   NS
Sbjct  787  RLIKLPDSLAKLKGIAGQKFGFEAKDALVTNEEGAEIDSVEVIRDNDKLYIVEYTNS  843



>ref|XP_010327298.1| PREDICTED: potassium channel AKT2/3-like [Solanum lycopersicum]
Length=841

 Score =   282 bits (721),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 179/228 (79%), Gaps = 2/228 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ G+TALW+AI AK+H IF ILYHWA ISDPYV+GDLLCKAA+ N+ ++M+ELLKHG
Sbjct  615  LQDVNGDTALWEAITAKQHPIFEILYHWACISDPYVSGDLLCKAARRNELTIMKELLKHG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L V+SKDRH STA+  A+EEN  +M+KLL++NG EIDD +K  L+ ++L+E+LQK ++GH
Sbjct  675  LLVNSKDRHRSTAMHIAIEENHLEMVKLLLLNGDEIDDTLKDKLSSMNLSEILQKPDVGH  734

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            RI + +T + E   KW + + + +  S   QC+ RVSIYRGHP  RR +QC EPGRLIKL
Sbjct  735  RIIISDT-MDEVDHKWHEQEQKYDFESHTDQCAFRVSIYRGHPEFRRRSQCNEPGRLIKL  793

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            P+++ +L  IAG K GFDA D+ +T+EEGA IDS++VIRDNDKL+I +
Sbjct  794  PDSLEKLKGIAGHKFGFDAKDALVTNEEGAEIDSVEVIRDNDKLYIYS  841



>ref|XP_006385212.1| potassium channel family protein [Populus trichocarpa]
 gb|ERP63009.1| potassium channel family protein [Populus trichocarpa]
Length=848

 Score =   271 bits (693),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 173/235 (74%), Gaps = 8/235 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AI++K HSIF IL+H+ASISDP  AGDLLC AAK ND  VM+ELLK G
Sbjct  604  LRDINGNTALWEAISSKHHSIFRILFHYASISDPNAAGDLLCTAAKQNDLMVMKELLKQG  663

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRHG TA+Q AM EN  DM+ LLVMNGAE+ +A   + +   L E+LQKRE+GH
Sbjct  664  LNVDSKDRHGKTALQVAMAENHGDMVNLLVMNGAEVAEANTHDFSSTSLNEMLQKREIGH  723

Query  573  RIAMPNTIL-HEAASKWAKDDHQNSSSMPQQ------CSIRVSIYRGHPATRRETQCPEP  415
            RI +P+ +  +E   K  + + + +S   +       C IRVSIYRGHP  RR+T C E 
Sbjct  724  RITVPDVLTANEVLLKRCEGEQECTSCTGKSKGSSSDC-IRVSIYRGHPMVRRQTCCVEA  782

Query  414  GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            GRLIKLP ++ EL SIAGEK GFDA ++ +TDEEG+ +DSI+VIRD DKL++V D
Sbjct  783  GRLIKLPNSLEELKSIAGEKFGFDARNAMVTDEEGSEVDSIEVIRDKDKLYMVED  837



>ref|XP_007042251.1| Potassium transport 2/3 isoform 2 [Theobroma cacao]
 gb|EOX98082.1| Potassium transport 2/3 isoform 2 [Theobroma cacao]
Length=557

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 168/232 (72%), Gaps = 7/232 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM GNTALWDAI+AK HSIF++LYH+A+ISD + AGDLLC AAK ND +VMQELLKHG
Sbjct  326  VRDMNGNTALWDAISAKHHSIFTVLYHFAAISDSFTAGDLLCTAAKRNDLTVMQELLKHG  385

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VD+KDRHG TA+Q AM E   DM+ LLVMNGA++ +A     +   L E+L+KRE+GH
Sbjct  386  LSVDAKDRHGLTALQIAMREKHEDMVNLLVMNGADVINANTYEFSSTALNEMLKKREIGH  445

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCS----IRVSIYRGHPATRRETQCPEPGRL  406
            RI + +T    +  +  K   +    +  +C     +RVSIYRGHP  R E+ C EPG+L
Sbjct  446  RITVTDTT---SGEELLKKLEREDVCILGKCRGLDPLRVSIYRGHPLMRTESCCMEPGKL  502

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            I+LP+++ EL + AGEK G D  ++ +TDE GA IDSI+VIRDNDKLFIVA+
Sbjct  503  IRLPDSLDELKNFAGEKFGIDPRNAIVTDEGGAEIDSIEVIRDNDKLFIVAE  554



>emb|CAC05489.1| potassium channel 2 [Populus tremula x Populus tremuloides]
Length=830

 Score =   266 bits (681),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 171/235 (73%), Gaps = 8/235 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AI++K HSIF IL+  AS+SDP+ AGDLLC AAK ND  VM+ELLK G
Sbjct  587  LRDVNGNTALWEAISSKHHSIFRILFQNASVSDPHAAGDLLCTAAKQNDLMVMKELLKQG  646

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRHG TA+Q AM EN  DM+ LLVM+GAE+ +A     +   L E+LQKRE+GH
Sbjct  647  LNVDSKDRHGKTALQVAMAENHGDMVNLLVMSGAEVAEANTHEFSSTSLNEMLQKREIGH  706

Query  573  RIAMPNTIL-HEAASKWAKDDHQNSSSMPQQ------CSIRVSIYRGHPATRRETQCPEP  415
            RI +P+ +  +E   K  + + + +S   +       C IRVSIYRGHP  RR+T C E 
Sbjct  707  RITVPDVLTANEVLLKRCEGEQECTSCTGKSKGSSSDC-IRVSIYRGHPMVRRQTCCVEA  765

Query  414  GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            GRLIKLP ++ EL SIAGEK GFDA ++ +TDEEG+ +DSI+VIRD DKLFIV D
Sbjct  766  GRLIKLPNSLEELKSIAGEKFGFDARNAMVTDEEGSEVDSIEVIRDKDKLFIVED  820



>gb|EYU26523.1| hypothetical protein MIMGU_mgv1a001765mg [Erythranthe guttata]
Length=762

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 172/232 (74%), Gaps = 4/232 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD+ GNTALW+AIA+K HSIF ILYHWAS+SDPYVAGDLLC AA+ ND  VM ELL++G
Sbjct  529  LKDLNGNTALWEAIASKHHSIFKILYHWASVSDPYVAGDLLCLAARRNDLVVMHELLRNG  588

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDS DRHG+TA+QAA  EN  +M++ L+MNG+E++++VK  +   +L E+L++RE+GH
Sbjct  589  LYVDSHDRHGTTAVQAATNENHMEMVRYLLMNGSEVNESVKNKIPSENLNEMLKEREVGH  648

Query  573  RIAMPNTILHEAASKWAKDDHQN----SSSMPQQCSIRVSIYRGHPATRRETQCPEPGRL  406
            RIA+      +   +  ++D +      +S       RVS+Y+G    RRE +C EPG+L
Sbjct  649  RIAVSEMENDDVLRRVNENDRKGGLGIGNSKGNVVFSRVSVYKGCSNDRREGRCAEPGKL  708

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            I+LP +IAEL  IAGEK GFDA ++ +T+EEGA ID I+VIRDNDKLFIV +
Sbjct  709  IRLPNSIAELKKIAGEKFGFDAENAVVTNEEGAEIDCIEVIRDNDKLFIVEN  760



>ref|XP_002529533.1| Potassium channel AKT2/3, putative [Ricinus communis]
 gb|EEF32836.1| Potassium channel AKT2/3, putative [Ricinus communis]
Length=845

 Score =   263 bits (671),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 169/232 (73%), Gaps = 4/232 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALWDA+++K  +IF IL+H+ASISDP  AGDLLC AAK ND ++M+ELLKHG
Sbjct  609  LRDINGNTALWDALSSKHQTIFRILHHFASISDPQTAGDLLCTAAKRNDLTMMKELLKHG  668

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD+KDR G TAIQ AM E   DM+ LLVMNGA++  +     +   L E+L+KRE+GH
Sbjct  669  LNVDAKDRQGKTAIQIAMAEKYVDMVDLLVMNGADVTASNTYEFSSTTLNEMLKKREIGH  728

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQ----QCSIRVSIYRGHPATRRETQCPEPGRL  406
            RI +P+T+  +       +  Q  +S  +    +C IRVSIY+GHP  R++  C EPGRL
Sbjct  729  RITVPDTVTSDEVILKRDEGEQECNSCGKSDELKCIIRVSIYKGHPLVRKQACCKEPGRL  788

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            I+LP+++ EL  IAG+K GFDA ++ +TD EG++IDSI+VIRDNDKLFI  D
Sbjct  789  IRLPDSLEELKRIAGDKFGFDARNAMVTDVEGSVIDSIEVIRDNDKLFIAED  840



>ref|XP_007225285.1| hypothetical protein PRUPE_ppa001379mg [Prunus persica]
 gb|EMJ26484.1| hypothetical protein PRUPE_ppa001379mg [Prunus persica]
Length=842

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 167/235 (71%), Gaps = 13/235 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALWDAIA+K HSIF ILY+ A+ISDPY  G+LLC AAK ND ++M+ELLKH 
Sbjct  608  VRDINGNTALWDAIASKHHSIFRILYYCAAISDPYTDGNLLCTAAKRNDMTLMEELLKHE  667

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD+K+  G TA+Q AMEEN ADM+ LLVMNGA++ +    +     LTE+LQKRE+GH
Sbjct  668  LNVDAKNHLGKTAVQIAMEENNADMVNLLVMNGADVANTHNFSFPSETLTEMLQKREVGH  727

Query  573  RIAMPNTILHEAASKWAKDDHQ-------NSSSMPQQCSIRVSIYRGHPATRRETQCPEP  415
            RI +P+T L+E       DD Q       N  + P     RVSIYRGHP  RR T C E 
Sbjct  728  RITVPDTTLNEVPLM-RNDDEQNPDWRKSNGVNFP-----RVSIYRGHPIVRRNTCCREA  781

Query  414  GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            GRLI+LP ++ EL +IAGEK GFD+ +  +TDE GA IDSI+VIRDNDKLF+  D
Sbjct  782  GRLIRLPNSVEELKNIAGEKFGFDSRNVLVTDEGGAEIDSIEVIRDNDKLFVFED  836



>ref|NP_001291251.1| potassium channel AKT2/3 [Populus euphratica]
 gb|ACB56631.1| K+ channel protein [Populus euphratica]
Length=831

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 169/235 (72%), Gaps = 8/235 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+ GNTALW+AI++K  SIF IL+H+AS+SDP+ AGDLLC AAK ND  VM+ELLK G
Sbjct  588  LRDVNGNTALWEAISSKHLSIFRILFHYASVSDPHAAGDLLCTAAKQNDLMVMKELLKQG  647

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L +DSK+RHG TA+Q AM EN  DM+ LLVMNGAE+ +A    L+   L E+LQKRE+GH
Sbjct  648  LDIDSKNRHGKTALQVAMAENHGDMVNLLVMNGAEVAEANTHELSSTSLNEMLQKREIGH  707

Query  573  RIAMPNTIL-HEAASKWAKDDHQ------NSSSMPQQCSIRVSIYRGHPATRRETQCPEP  415
            RI +P+ +  +E   K  + + +       S      C +RVSIYRGHP  RR+T   E 
Sbjct  708  RITVPDVLTANEVLLKRCEGEQECTLCTGKSKGSSADC-VRVSIYRGHPMVRRQTCSMEA  766

Query  414  GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            GRLIKLP ++ EL SIAGEK GFDA ++ +TDEEG+ +DSI+VIRD DKLFIV D
Sbjct  767  GRLIKLPNSLEELKSIAGEKFGFDARNAMVTDEEGSEVDSIEVIRDKDKLFIVED  821



>ref|XP_006431831.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
 gb|ESR45071.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
Length=679

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 165/230 (72%), Gaps = 6/230 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+DM GNTALW+AI++K HSIF ILYH  +ISDPY AGDLLC AAK ND SVM+EL+K+G
Sbjct  444  LRDMNGNTALWEAISSKHHSIFRILYHCTAISDPYTAGDLLCTAAKRNDMSVMEELVKYG  503

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRHG TAI+ AM EN  +M+  LVMNG+++  A K   +  +L ++LQKRE+GH
Sbjct  504  LNVDSKDRHGRTAIEIAMAENNVEMVNFLVMNGSDVVGANKCEFSSTNLNDMLQKREIGH  563

Query  573  RIAM--PNTILHEAASKWAK---DDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            RI +   N+  +E   K  +    + +   S    C  RVSIYRGHP  R++  C E GR
Sbjct  564  RITVHDDNSTQNEVLLKKLEIIDFEAKEGKSKGGNCQ-RVSIYRGHPLVRKQACCMEAGR  622

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LIKLP ++ EL  IAGEK GFDA ++ +TDE GA IDSI+VIRDNDK+FI
Sbjct  623  LIKLPNSLEELKKIAGEKFGFDAMNAMVTDEAGAEIDSIEVIRDNDKIFI  672



>ref|XP_008218775.1| PREDICTED: potassium channel AKT2/3 [Prunus mume]
Length=843

 Score =   261 bits (667),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 166/237 (70%), Gaps = 11/237 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALWDAIA+K HSIF ILY+ A+IS+PY  GDLLC AAK ND ++M+ELLKH 
Sbjct  609  VRDINGNTALWDAIASKHHSIFRILYYCAAISNPYTDGDLLCTAAKRNDMTLMEELLKHE  668

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD+K+  G TA+Q AMEEN ADM+ LLVMNGA++ +    +     LTE+LQKRE+GH
Sbjct  669  LNVDAKNHLGKTAVQIAMEENNADMVNLLVMNGADVANTHNFSFPSETLTEMLQKREVGH  728

Query  573  RIAMPNTILHEAASKWAKDDHQ------NSSSMPQQCSIRVSIYRGHPATRRETQCPEPG  412
            RI +P+T L+E       D+        N  + P     RV IYRGHP  RR T C E G
Sbjct  729  RITVPDTTLNEVPLIRYDDEQNPDWRKSNRVNFP-----RVCIYRGHPIVRRNTCCMEAG  783

Query  411  RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
            RLI+LP +I EL +IAGEK GFD+ +  +TDE GA IDSI+VIRDNDKLF+  D  S
Sbjct  784  RLIRLPNSIEELKNIAGEKFGFDSRNVLVTDEGGAEIDSIEVIRDNDKLFVFEDSKS  840



>ref|XP_007042250.1| Potassium transport 2/3 isoform 1 [Theobroma cacao]
 gb|EOX98081.1| Potassium transport 2/3 isoform 1 [Theobroma cacao]
Length=839

 Score =   260 bits (664),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 168/232 (72%), Gaps = 7/232 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM GNTALWDAI+AK HSIF++LYH+A+ISD + AGDLLC AAK ND +VMQELLKHG
Sbjct  608  VRDMNGNTALWDAISAKHHSIFTVLYHFAAISDSFTAGDLLCTAAKRNDLTVMQELLKHG  667

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VD+KDRHG TA+Q AM E   DM+ LLVMNGA++ +A     +   L E+L+KRE+GH
Sbjct  668  LSVDAKDRHGLTALQIAMREKHEDMVNLLVMNGADVINANTYEFSSTALNEMLKKREIGH  727

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCS----IRVSIYRGHPATRRETQCPEPGRL  406
            RI + +T    +  +  K   +    +  +C     +RVSIYRGHP  R E+ C EPG+L
Sbjct  728  RITVTDT---TSGEELLKKLEREDVCILGKCRGLDPLRVSIYRGHPLMRTESCCMEPGKL  784

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            I+LP+++ EL + AGEK G D  ++ +TDE GA IDSI+VIRDNDKLFIVA+
Sbjct  785  IRLPDSLDELKNFAGEKFGIDPRNAIVTDEGGAEIDSIEVIRDNDKLFIVAE  836



>ref|XP_009355247.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Pyrus x bretschneideri]
Length=831

 Score =   260 bits (664),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D  GNTALWDAIA+K HSIF  LY+ A+ISDPY AGDLLC AAK ND +VM+ELLK G
Sbjct  596  VRDTNGNTALWDAIASKHHSIFQSLYYCAAISDPYTAGDLLCTAAKRNDLTVMEELLKQG  655

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSK+  G TA+Q AMEEN ADM+ LLVMNGA++ +A         LTE+LQKRE+GH
Sbjct  656  LNVDSKNHLGKTAVQIAMEENNADMVNLLVMNGADVTNAQNCLFPSQSLTEMLQKREVGH  715

Query  573  RIAMPNTILHEAA-SKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            RI +P + ++E    K  ++ +    S    C  RVSIYRGHP  R+ T C E GR+I+L
Sbjct  716  RITVPESTINEVPLMKNGEERNSGRESYGVNCP-RVSIYRGHPMVRKTTCCREAGRVIRL  774

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            P ++ EL +IAG K GFD+ ++ +TDE GA IDSI+VIRDNDKLF+V
Sbjct  775  PRSLEELRNIAGVKFGFDSGNTLVTDEGGAEIDSIEVIRDNDKLFLV  821



>gb|KHG14137.1| Potassium channel AKT2/3 -like protein [Gossypium arboreum]
Length=676

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 166/233 (71%), Gaps = 7/233 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D  GNTALWDAI++K HSIF ILYH+ASISDP+ AGDLLC AAK ND +VMQELLK G
Sbjct  446  LRDTNGNTALWDAISSKHHSIFRILYHFASISDPFTAGDLLCTAAKRNDLTVMQELLKQG  505

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD+KDRHGSTA+Q AM+E   +M  LLVMNGA++ D      +P  L E+++KRE+GH
Sbjct  506  LNVDAKDRHGSTALQVAMKEKHQEMFNLLVMNGADVVDPNTYEFSPTTLNEIVKKREIGH  565

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCS----IRVSIYRGHPATRRETQCPEPGRL  406
            RI +     +E   K  + D  +   + + C      RVSIYRG P  R+E+ C EPG+L
Sbjct  566  RITVMTD--NEPPLKEVEGD-LHVGIVGKSCRGMDHPRVSIYRGRPLMRKESSCMEPGKL  622

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADW  247
            I+LP +  +LI+ AGEK G DA ++ +TDE GA IDSI+VIRDNDKLFI  ++
Sbjct  623  IRLPGSFDQLINFAGEKFGIDARNAIVTDEAGAEIDSIEVIRDNDKLFIFENF  675



>ref|XP_009355246.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Pyrus x bretschneideri]
Length=870

 Score =   259 bits (663),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D  GNTALWDAIA+K HSIF  LY+ A+ISDPY AGDLLC AAK ND +VM+ELLK G
Sbjct  635  VRDTNGNTALWDAIASKHHSIFQSLYYCAAISDPYTAGDLLCTAAKRNDLTVMEELLKQG  694

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSK+  G TA+Q AMEEN ADM+ LLVMNGA++ +A         LTE+LQKRE+GH
Sbjct  695  LNVDSKNHLGKTAVQIAMEENNADMVNLLVMNGADVTNAQNCLFPSQSLTEMLQKREVGH  754

Query  573  RIAMPNTILHEAA-SKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            RI +P + ++E    K  ++ +    S    C  RVSIYRGHP  R+ T C E GR+I+L
Sbjct  755  RITVPESTINEVPLMKNGEERNSGRESYGVNCP-RVSIYRGHPMVRKTTCCREAGRVIRL  813

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            P ++ EL +IAG K GFD+ ++ +TDE GA IDSI+VIRDNDKLF+V
Sbjct  814  PRSLEELRNIAGVKFGFDSGNTLVTDEGGAEIDSIEVIRDNDKLFLV  860



>ref|XP_002268924.1| PREDICTED: potassium channel AKT2/3 [Vitis vinifera]
Length=841

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 170/235 (72%), Gaps = 4/235 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALWDA++AK +SIF ILYH AS+SDPY +GDLLC AAK ND + M+ELLK G
Sbjct  605  VRDINGNTALWDAVSAKHNSIFWILYHCASLSDPYTSGDLLCTAAKRNDLTAMKELLKQG  664

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++DSK+R G TAIQ AM E+  DM+KLLVMNGA++  A     +   L E+LQKRE+GH
Sbjct  665  LNIDSKNRQGLTAIQIAMAEDHTDMVKLLVMNGADVIHANTYEFSSETLNEMLQKREMGH  724

Query  573  RIAMPNTIL--HEAASK--WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRL  406
            RI +P+T+   HE   +    + +   +         RVSIYRGHP  R+E+ C E GRL
Sbjct  725  RIMVPDTLPTDHETLLRDQGGEKEFNTNGGFKGTNVPRVSIYRGHPLQRKESCCTEAGRL  784

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
            I+LP ++ EL +IAGEKLGFDA ++ +T+EEGA IDSI+VIRDND LF+V D NS
Sbjct  785  IRLPNSLMELKAIAGEKLGFDARNAMVTNEEGAEIDSIEVIRDNDTLFLVEDPNS  839



>ref|XP_010101161.1| Potassium channel [Morus notabilis]
 gb|EXB87379.1| Potassium channel [Morus notabilis]
Length=851

 Score =   259 bits (661),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 169/228 (74%), Gaps = 3/228 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKDM GNTALW+AIA+K H+IF++LYH+A +SDPY+AG+LLC AAK ND +VM+ELLK+G
Sbjct  624  LKDMNGNTALWEAIASKHHTIFNMLYHFAVLSDPYIAGELLCTAAKRNDVTVMKELLKYG  683

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSK+ HGST +Q AM +N  DM+ LLVMNGAE+ +A         L E+L+KRE+G+
Sbjct  684  LNVDSKNHHGSTPVQVAMADNNVDMVNLLVMNGAEVVNANTYEFPSTALNEMLEKREVGY  743

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            RI +P T  +E  S  ++ + + S  +   C  RVSIYRGHP  R+ET C EPG+LI+LP
Sbjct  744  RINVPETAPNEVLSMQSEAEKRKSDGV--NCP-RVSIYRGHPMERKETCCKEPGKLIRLP  800

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +L  +AGEK   +  +  +T+EEGA IDSI+VIRDNDKLFI+ +
Sbjct  801  SSLEDLKKVAGEKFRLNCREIIVTNEEGAEIDSIEVIRDNDKLFIMEN  848



>gb|KJB79210.1| hypothetical protein B456_013G038200 [Gossypium raimondii]
Length=847

 Score =   258 bits (659),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 169/233 (73%), Gaps = 7/233 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D  GNTALWDAI+++ HSIF ILYH+ASISDP+ AGDLLC AA+ ND +VMQELLK G
Sbjct  617  LRDTNGNTALWDAISSRHHSIFRILYHFASISDPFTAGDLLCTAARRNDLTVMQELLKQG  676

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD+KDRHGSTA+Q AM+E   +M+ LLVMNGA++ D      +P  L E+++KRE+GH
Sbjct  677  LNVDAKDRHGSTALQVAMKEKHQEMVNLLVMNGADVIDPNTYEFSPTTLNEMVKKREIGH  736

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCS----IRVSIYRGHPATRRETQCPEPGRL  406
            RI +     +E   K  + D ++   + + C      RVSIYRGHP  R+E+ C EPG+L
Sbjct  737  RITVMTD--NEPPLKEVEGD-RHVGIVGKSCRGIDHPRVSIYRGHPLMRKESSCMEPGKL  793

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADW  247
            I+LP +  +LI+ AGEK G DA ++ +TDE GA IDSI+VIRDNDKLFI  ++
Sbjct  794  IRLPGSFDQLINFAGEKFGIDARNAIVTDEAGAEIDSIEVIRDNDKLFIFENF  846



>ref|XP_006431832.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
 gb|ESR45072.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
Length=833

 Score =   257 bits (657),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 165/230 (72%), Gaps = 6/230 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+DM GNTALW+AI++K HSIF ILYH  +ISDPY AGDLLC AAK ND SVM+EL+K+G
Sbjct  598  LRDMNGNTALWEAISSKHHSIFRILYHCTAISDPYTAGDLLCTAAKRNDMSVMEELVKYG  657

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRHG TAI+ AM EN  +M+  LVMNG+++  A K   +  +L ++LQKRE+GH
Sbjct  658  LNVDSKDRHGRTAIEIAMAENNVEMVNFLVMNGSDVVGANKCEFSSTNLNDMLQKREIGH  717

Query  573  RIAM--PNTILHEAASKWAK---DDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            RI +   N+  +E   K  +    + +   S    C  RVSIYRGHP  R++  C E GR
Sbjct  718  RITVHDDNSTQNEVLLKKLEIIDFEAKEGKSKGGNCQ-RVSIYRGHPLVRKQACCMEAGR  776

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LIKLP ++ EL  IAGEK GFDA ++ +TDE GA IDSI+VIRDNDK+FI
Sbjct  777  LIKLPNSLEELKKIAGEKFGFDAMNAMVTDEAGAEIDSIEVIRDNDKIFI  826



>gb|AEY75251.1| potassium channel [Malus hupehensis]
Length=869

 Score =   256 bits (654),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 162/226 (72%), Gaps = 1/226 (0%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D  GNTALWDAIA+K HSIF  LY  A+ISDPY AGDLLC AAK N+ +VM+ELLK G
Sbjct  635  VRDTNGNTALWDAIASKHHSIFRSLYFCAAISDPYTAGDLLCTAAKRNNLTVMEELLKQG  694

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSK++ G TA+Q AMEEN ADM+ LLVMNGA++ +A         LTE+LQKRE+GH
Sbjct  695  LNVDSKNQLGKTAVQIAMEENNADMVNLLVMNGADVTNAQNCLFPSQGLTEMLQKREVGH  754

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            RI +P++ ++E       + +    S    C  RVSIYRGHP  R+ T C E GR+I+LP
Sbjct  755  RITVPDSTINEVPLMKNGERNSGRESYGVNCP-RVSIYRGHPMVRKTTCCREAGRVIRLP  813

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             ++ EL +IAG K GFD+ +   TDE GA IDSI+VIRDNDKLF+V
Sbjct  814  RSLEELRNIAGVKFGFDSGNILATDEGGAEIDSIEVIRDNDKLFLV  859



>ref|XP_008378877.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Malus domestica]
Length=869

 Score =   254 bits (650),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 162/226 (72%), Gaps = 1/226 (0%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D  GNTALWDAIA+K HSIF  LY  A+ISDPY AGDLLC AAK N+ +VM+ELLK G
Sbjct  635  VRDTNGNTALWDAIASKHHSIFRSLYFCAAISDPYTAGDLLCTAAKRNNLTVMEELLKQG  694

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSK++ G TA+Q AMEEN ADM+ LLVMNGA++ +A         LTE+LQKRE+GH
Sbjct  695  LNVDSKNQLGKTAVQIAMEENNADMVNLLVMNGADVTNAQNCLFPSQSLTEMLQKREVGH  754

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            RI +P++ ++E       + +    S    C  RVSIYRGHP  R+ T C E GR+I+LP
Sbjct  755  RITVPDSTINEVPLMKNGERNSGRESYGVNCP-RVSIYRGHPMVRKTTCCREAGRVIRLP  813

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             ++ EL + AG K GFD+ +  +TDE GA IDSI+VIRDNDKLF+V
Sbjct  814  XSLEELRNXAGVKFGFDSGNILVTDEGGAEIDSIEVIRDNDKLFLV  859



>ref|XP_006471022.1| PREDICTED: potassium channel AKT2/3-like [Citrus sinensis]
Length=833

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 164/230 (71%), Gaps = 6/230 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+DM GNTALW+AI++K HSIF ILYH  +ISDPY AGDLLC AAK ND SVM+EL+K+G
Sbjct  598  LRDMNGNTALWEAISSKHHSIFRILYHCTAISDPYTAGDLLCTAAKRNDMSVMEELVKYG  657

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRHG TAI+ AM EN  +M+ +LVMNG+++  A     +  +L ++LQKRE+GH
Sbjct  658  LNVDSKDRHGRTAIEIAMAENNVEMVNILVMNGSDVVGANTCEFSSTNLNDMLQKREIGH  717

Query  573  RIAM--PNTILHEAASKWAK---DDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            RI +   N+  +E   K  +      +   S    C  RVSIYRGHP  R++  C E GR
Sbjct  718  RITVHDDNSTQNEVLLKKLEIIDFGAKEGKSKGGNCQ-RVSIYRGHPLVRKQACCMEAGR  776

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LIKLP ++ EL  IAGEK GFDA ++ +TDE GA IDSI+VIRDNDK+FI
Sbjct  777  LIKLPNSLEELKKIAGEKFGFDAMNAMVTDEAGAEIDSIEVIRDNDKIFI  826



>ref|XP_004299918.1| PREDICTED: potassium channel AKT2/3 [Fragaria vesca subsp. vesca]
Length=843

 Score =   253 bits (646),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 163/229 (71%), Gaps = 2/229 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM GNTALW+AIA+K HSIF IL ++A+ S PY AGDLLC A + ND ++M+ELLKH 
Sbjct  615  VRDMNGNTALWEAIASKHHSIFKILNYYATFSYPYTAGDLLCTAVRRNDLTMMKELLKHE  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD-LTEVLQKRELG  577
            LHVDSKD +G TA+Q AMEEN  DM+ LLVMNGA+I +     L P   L+++LQKRE+G
Sbjct  675  LHVDSKDCNGKTAVQVAMEENNVDMVNLLVMNGADITNVSHDYLFPSQTLSDMLQKREVG  734

Query  576  HRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-RVSIYRGHPATRRETQCPEPGRLIK  400
            HRI +P++I+ E        +    S +  + +  RVSIYRGHP TR    C E GRLI+
Sbjct  735  HRITVPDSIVTEMLLFRNDGEKNVDSKISNKVNFPRVSIYRGHPVTRSNACCTEAGRLIR  794

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            LP ++ EL +IAGEK GFD  +  +TDEEGA ID I+VIRDNDKLFI +
Sbjct  795  LPHSLEELKNIAGEKFGFDPGNVIITDEEGAEIDCIEVIRDNDKLFIYS  843



>ref|XP_010245054.1| PREDICTED: potassium channel AKT2/3-like isoform X3 [Nelumbo 
nucifera]
Length=680

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 165/232 (71%), Gaps = 4/232 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD++GNT LWDAIAA  HSIF ILYH++SISDPY AG+LLC AAK ND S M+ELLKHG
Sbjct  444  IKDVDGNTPLWDAIAANHHSIFRILYHFSSISDPYTAGELLCTAAKRNDLSTMKELLKHG  503

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+++SK+  G T++Q A+ EN  DM+ LLVMNGA++D A +       L E++QKR +GH
Sbjct  504  LNIESKNHDGFTSLQIALNENYNDMVNLLVMNGAKVDQANQSGFPAASLNEMVQKRGVGH  563

Query  573  RIAMPNTILHEAAS-KWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCPEPGRL  406
             I +P T++H+  S  + K   +  SS  +      +RVSIY+GHP  R+ T   + G+L
Sbjct  564  CITIPGTLIHDNLSVSYRKMQEEKESSEGKSKGGNFLRVSIYKGHPLVRKYTFASDSGKL  623

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            IKLP ++ EL +IAGEK  FD  ++ +T+EEGA IDSI+ IRDNDKLFIV +
Sbjct  624  IKLPSSMEELKNIAGEKFAFDPKNAIITNEEGAEIDSIETIRDNDKLFIVEN  675



>gb|AEO14874.1| rsmv3 protein [Glycine max]
Length=594

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 157/227 (69%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL+C AAK N+ +VM +LL+ G
Sbjct  364  IKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDLMCTAAKRNELTVMTDLLRQG  423

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKD   +TAIQ AM EN   M++LLVMNGA++ D          L E+LQKRE+GH
Sbjct  424  LNVDSKDHRDTTAIQIAMAENHVGMVQLLVMNGADVSDVHNHEFCSSTLNEMLQKREIGH  483

Query  573  RIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   +L E   K    + +H    S       RVSIYRGHP  RRE    E G+LI+
Sbjct  484  LINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIYRGHPVVRREKCSMEAGKLIR  543

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIRDNDKLF 
Sbjct  544  LPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIRDNDKLFF  590



>ref|XP_006585490.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Glycine max]
Length=673

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 158/227 (70%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL+C AAK N+ +VM +LL+ G
Sbjct  443  IKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDLMCTAAKRNELTVMTDLLRQG  502

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ D          L E+LQKRE+GH
Sbjct  503  LNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVSDVHNHEFCSSTLNEMLQKREIGH  562

Query  573  RIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   +L E   K    + +H    S       RVSIYRGHP  RRE    E G+LI+
Sbjct  563  LINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIYRGHPVVRREKCSMEAGKLIR  622

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIRDNDKLF 
Sbjct  623  LPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIRDNDKLFF  669



>ref|XP_004485488.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2/3-like 
[Cicer arietinum]
Length=840

 Score =   248 bits (633),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 162/229 (71%), Gaps = 4/229 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM GNTALWDAI +K +SIF ILY  A++SDPY AG+LLC AAK ND +VM ELLK G
Sbjct  603  IRDMNGNTALWDAIESKHNSIFRILYQLAALSDPYTAGNLLCTAAKRNDLTVMNELLKQG  662

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++DSKDRHG+TAIQ AM EN  DM++LLVMNGA++ +      +   L ++L+KRE+GH
Sbjct  663  LNIDSKDRHGTTAIQIAMSENLVDMVQLLVMNGADVAEVHTHEFSASTLKKMLKKREIGH  722

Query  573  RIAMPNTILHEAASK---WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLI  403
            +I +   +  E A K     +D H        +C  RVSIYR HP  RRE    E G+LI
Sbjct  723  QITVNEAMASEFALKEQNQEEDKHVWGRYNGLECP-RVSIYRSHPVVRRERGFIEAGKLI  781

Query  402  KLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            +LP+++ +L +IAGEK GFDA D+ +T+EEGA ID IDVIRDNDKLF V
Sbjct  782  RLPDSLEKLKTIAGEKFGFDARDAVVTNEEGAEIDCIDVIRDNDKLFFV  830



>ref|XP_012071314.1| PREDICTED: potassium channel AKT2/3 [Jatropha curcas]
 gb|KDP38842.1| hypothetical protein JCGZ_04999 [Jatropha curcas]
Length=830

 Score =   248 bits (633),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 168/231 (73%), Gaps = 4/231 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD+ GNTALW+A++    SIF IL+H+ASISDP+ AGDLLC AA+ ND ++M++LLK G
Sbjct  602  LKDVNGNTALWEALSTNHQSIFRILFHFASISDPHTAGDLLCTAARRNDLTMMKKLLKQG  661

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDR G TAIQ A+ EN  DM+ LLVMNGA++  A   +     L E+LQKRE+GH
Sbjct  662  LNVDSKDRQGKTAIQIAVAENNIDMVDLLVMNGADVTAANTQDFNSTTLNEMLQKREIGH  721

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             I +P+ + +E      K++ ++  S    C+ RVSIYRGHP  R++    E GRLI+LP
Sbjct  722  HITVPDDLSNERLLLKKKEEEEHGKS---SCT-RVSIYRGHPLIRKQNCSRESGRLIRLP  777

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
             ++ EL +IAG+K GFDA ++ +TDEEG+ IDSI+VIRDNDKLFIV D NS
Sbjct  778  SSMEELKNIAGKKFGFDARNAMITDEEGSEIDSIEVIRDNDKLFIVEDQNS  828



>ref|XP_003593018.1| Potassium channel [Medicago truncatula]
 gb|AES63269.1| potassium outward rectifying channel protein [Medicago truncatula]
Length=830

 Score =   247 bits (631),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 163/238 (68%), Gaps = 18/238 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM G+TALW AIA+K HSIF ILY  +++SDPY AG+LLC AAK ND +VM ELLK G
Sbjct  597  IKDMNGDTALWYAIASKHHSIFRILYQLSALSDPYTAGNLLCTAAKRNDITVMNELLKQG  656

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++DSKDRHG TAIQ AM EN  +M++LLVMNGA++ D      +   L E++QKRE+GH
Sbjct  657  LNIDSKDRHGMTAIQIAMSENHVEMVQLLVMNGADVTDVHVHEFSASILNEIMQKREIGH  716

Query  573  RI----AMPNTILHEAASK------WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQC  424
             I     MP+  + +  ++      W +    N    P     RVSIYRGHP  RRE   
Sbjct  717  LINVSEVMPSEFVLKVQNQEEHKQIWGR---YNGLECP-----RVSIYRGHPVVRRERGF  768

Query  423  PEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             E G+LI+LP+++ +L +IAGEK GFDA D+ +T+EEGA ID IDVIRDNDKLF V +
Sbjct  769  IEAGKLIRLPDSLEKLKTIAGEKFGFDAKDTMVTNEEGAEIDCIDVIRDNDKLFFVEE  826



>ref|XP_010245052.1| PREDICTED: potassium channel AKT2/3-like isoform X1 [Nelumbo 
nucifera]
Length=844

 Score =   246 bits (628),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 165/232 (71%), Gaps = 4/232 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD++GNT LWDAIAA  HSIF ILYH++SISDPY AG+LLC AAK ND S M+ELLKHG
Sbjct  608  IKDVDGNTPLWDAIAANHHSIFRILYHFSSISDPYTAGELLCTAAKRNDLSTMKELLKHG  667

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+++SK+  G T++Q A+ EN  DM+ LLVMNGA++D A +       L E++QKR +GH
Sbjct  668  LNIESKNHDGFTSLQIALNENYNDMVNLLVMNGAKVDQANQSGFPAASLNEMVQKRGVGH  727

Query  573  RIAMPNTILHEAAS-KWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCPEPGRL  406
             I +P T++H+  S  + K   +  SS  +      +RVSIY+GHP  R+ T   + G+L
Sbjct  728  CITIPGTLIHDNLSVSYRKMQEEKESSEGKSKGGNFLRVSIYKGHPLVRKYTFASDSGKL  787

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            IKLP ++ EL +IAGEK  FD  ++ +T+EEGA IDSI+ IRDNDKLFIV +
Sbjct  788  IKLPSSMEELKNIAGEKFAFDPKNAIITNEEGAEIDSIETIRDNDKLFIVEN  839



>ref|XP_010245053.1| PREDICTED: potassium channel AKT2/3-like isoform X2 [Nelumbo 
nucifera]
Length=841

 Score =   246 bits (628),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 165/232 (71%), Gaps = 4/232 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD++GNT LWDAIAA  HSIF ILYH++SISDPY AG+LLC AAK ND S M+ELLKHG
Sbjct  605  IKDVDGNTPLWDAIAANHHSIFRILYHFSSISDPYTAGELLCTAAKRNDLSTMKELLKHG  664

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+++SK+  G T++Q A+ EN  DM+ LLVMNGA++D A +       L E++QKR +GH
Sbjct  665  LNIESKNHDGFTSLQIALNENYNDMVNLLVMNGAKVDQANQSGFPAASLNEMVQKRGVGH  724

Query  573  RIAMPNTILHEAAS-KWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCPEPGRL  406
             I +P T++H+  S  + K   +  SS  +      +RVSIY+GHP  R+ T   + G+L
Sbjct  725  CITIPGTLIHDNLSVSYRKMQEEKESSEGKSKGGNFLRVSIYKGHPLVRKYTFASDSGKL  784

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            IKLP ++ EL +IAGEK  FD  ++ +T+EEGA IDSI+ IRDNDKLFIV +
Sbjct  785  IKLPSSMEELKNIAGEKFAFDPKNAIITNEEGAEIDSIETIRDNDKLFIVEN  836



>ref|XP_006585489.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Glycine max]
Length=808

 Score =   245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 158/227 (70%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL+C AAK N+ +VM +LL+ G
Sbjct  578  IKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDLMCTAAKRNELTVMTDLLRQG  637

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ D          L E+LQKRE+GH
Sbjct  638  LNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVSDVHNHEFCSSTLNEMLQKREIGH  697

Query  573  RIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   +L E   K    + +H    S       RVSIYRGHP  RRE    E G+LI+
Sbjct  698  LINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIYRGHPVVRREKCSMEAGKLIR  757

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIRDNDKLF 
Sbjct  758  LPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIRDNDKLFF  804



>ref|XP_003532990.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Glycine max]
Length=834

 Score =   245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 158/227 (70%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL+C AAK N+ +VM +LL+ G
Sbjct  604  IKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDLMCTAAKRNELTVMTDLLRQG  663

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ D          L E+LQKRE+GH
Sbjct  664  LNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVSDVHNHEFCSSTLNEMLQKREIGH  723

Query  573  RIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   +L E   K    + +H    S       RVSIYRGHP  RRE    E G+LI+
Sbjct  724  LINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIYRGHPVVRREKCSMEAGKLIR  783

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIRDNDKLF 
Sbjct  784  LPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIRDNDKLFF  830



>gb|KHN11238.1| Potassium channel AKT2/3 [Glycine soja]
Length=831

 Score =   245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 158/227 (70%), Gaps = 2/227 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTALWDAIA+K +SIF IL+  +++SDP +AGDL+C AAK N+ +VM +LL+ G
Sbjct  601  IKDMNGNTALWDAIASKHYSIFRILFQLSALSDPNIAGDLMCTAAKRNELTVMTDLLRQG  660

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKD   +TAIQ AM EN  DM++LLVMNGA++ D          L E+LQKRE+GH
Sbjct  661  LNVDSKDHRDTTAIQIAMAENHVDMVQLLVMNGADVSDVHNHEFCSSTLNEMLQKREIGH  720

Query  573  RIAMPNTILHEAASKW--AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   +L E   K    + +H    S       RVSIYRGHP  RRE    E G+LI+
Sbjct  721  LINVTEVMLSEVVLKGRHQEQEHNGGRSNSGLKFPRVSIYRGHPVVRREKCSMEAGKLIR  780

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            LP++I EL +IAGEK GFDA D+ +T+EEGA IDS+DVIRDNDKLF 
Sbjct  781  LPDSIEELKTIAGEKFGFDAKDAMVTNEEGAEIDSVDVIRDNDKLFF  827



>ref|XP_006592673.1| PREDICTED: potassium channel AKT2/3-like isoform X2 [Glycine 
max]
Length=669

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTA+WDAIA+K +SIF IL+  +++SDP  AGDLLC AAK N+ +V+ +LLK G
Sbjct  442  IKDMNGNTAIWDAIASKHYSIFRILFQLSAVSDPNTAGDLLCTAAKRNELTVLTDLLKQG  501

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKD H +TAIQ AM EN  DM+ LLVMNGA++ D          L E+LQKRE+GH
Sbjct  502  LNVDSKDHHDTTAIQIAMAENHVDMVHLLVMNGADVSDVHNHEFCSSTLDEMLQKREIGH  561

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-RVSIYRGHPATRRETQCPEPGRLIKL  397
             I +   +      K    + + +          RVSIYRGHP  RRE    E G+LI+L
Sbjct  562  LINVTEVMRSGVVLKGKHQEQELNGGRSNGLKFPRVSIYRGHPVVRREKGSVEAGKLIRL  621

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            P+++ EL +IAGEK GFDA D+ +T+EEGA IDSIDVIRDNDKLF V
Sbjct  622  PDSLEELKTIAGEKFGFDAKDAMVTNEEGAEIDSIDVIRDNDKLFFV  668



>ref|XP_003540163.1| PREDICTED: potassium channel AKT2/3-like isoform X1 [Glycine 
max]
 gb|KHN45473.1| Potassium channel AKT2/3 [Glycine soja]
Length=831

 Score =   241 bits (615),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 155/227 (68%), Gaps = 1/227 (0%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTA+WDAIA+K +SIF IL+  +++SDP  AGDLLC AAK N+ +V+ +LLK G
Sbjct  604  IKDMNGNTAIWDAIASKHYSIFRILFQLSAVSDPNTAGDLLCTAAKRNELTVLTDLLKQG  663

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKD H +TAIQ AM EN  DM+ LLVMNGA++ D          L E+LQKRE+GH
Sbjct  664  LNVDSKDHHDTTAIQIAMAENHVDMVHLLVMNGADVSDVHNHEFCSSTLDEMLQKREIGH  723

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-RVSIYRGHPATRRETQCPEPGRLIKL  397
             I +   +      K    + + +          RVSIYRGHP  RRE    E G+LI+L
Sbjct  724  LINVTEVMRSGVVLKGKHQEQELNGGRSNGLKFPRVSIYRGHPVVRREKGSVEAGKLIRL  783

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            P+++ EL +IAGEK GFDA D+ +T+EEGA IDSIDVIRDNDKLF V
Sbjct  784  PDSLEELKTIAGEKFGFDAKDAMVTNEEGAEIDSIDVIRDNDKLFFV  830



>ref|XP_010065457.1| PREDICTED: potassium channel AKT2/3 [Eucalyptus grandis]
 gb|KCW62963.1| hypothetical protein EUGRSUZ_G00560 [Eucalyptus grandis]
Length=832

 Score =   240 bits (613),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 161/239 (67%), Gaps = 16/239 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D  GN ALW AI++K+HSIF +LY  A+ SDP  AGDLLC AAK ND  VM+ELL HG
Sbjct  600  LRDRNGNNALWHAISSKQHSIFRVLYSCAASSDPCTAGDLLCTAAKRNDLEVMKELLNHG  659

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++DS +  G TA+Q AM EN  DM+ LLVMNGA + ++   +  P  L E+L +RE GH
Sbjct  660  LNIDSMNHQGFTALQIAMAENHEDMVNLLVMNGANVANSNLPDFPPEALNEMLSRRETGH  719

Query  573  RIA---------MPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  421
            RIA         MP   +HE      ++  Q  S M   C+ RVSIYRGHP  RRE +C 
Sbjct  720  RIAVSDGATLQDMPMR-MHEV----ERELTQEKSDMA-ICA-RVSIYRGHPVARRENRCA  772

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
            E GRLI+LP +I +L SIAG+K GFDAT++ + DEEGA ID I+VIRDNDKLF+V D N
Sbjct  773  EAGRLIRLPGSIEDLKSIAGKKFGFDATNTIIVDEEGAEIDCIEVIRDNDKLFVVEDSN  831



>gb|KJB32473.1| hypothetical protein B456_005G242200 [Gossypium raimondii]
Length=832

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 166/232 (72%), Gaps = 11/232 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+DM GNT+LW+AI++K HSIF +LY+ A++S+P+ AGDLLC AA+ ND +VM+ELLKHG
Sbjct  605  LQDMNGNTSLWNAISSKHHSIFRVLYNCAAVSNPFTAGDLLCLAAQRNDQTVMKELLKHG  664

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L +D+K+RHG TA+Q AM+E   +M+ LLVMNGA++ +      +   L E+L+KRE+GH
Sbjct  665  LPIDAKNRHGLTALQIAMKEKHENMVNLLVMNGADVINTNTYEFSSEALNEMLEKREIGH  724

Query  573  RIAMPNTILHEAASK------WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPG  412
            RI +P+T   EA  K        K D   +   P     RVSIY+GHP  R+E+   EPG
Sbjct  725  RINVPDTTSSEALLKKLEGDTVGKLDKSRTVDHP-----RVSIYKGHPLMRKESCSTEPG  779

Query  411  RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            +LI LP+++ +L +IAG+K G DA ++++TDE G  IDSI+VIRDNDKL+IV
Sbjct  780  KLISLPDSLEDLKNIAGKKFGIDARNATVTDEAGDEIDSIEVIRDNDKLYIV  831



>gb|AAD16278.1| pulvinus inward-rectifying channel for potassium SPICK1 [Samanea 
saman]
Length=832

 Score =   239 bits (610),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 156/234 (67%), Gaps = 12/234 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D  GNTALWDAIA+K  SIF ILY  A  SDP   GDLL  AA+ ND +VM ELLK G
Sbjct  604  IRDNNGNTALWDAIASKHLSIFRILYQLACFSDPQTGGDLLRTAAERNDLTVMNELLKQG  663

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDSKDRHG TA Q AM EN  +M++LLVMNGA++ D    N +   L E+L+KRE GH
Sbjct  664  LKVDSKDRHGMTATQVAMAENHMEMVQLLVMNGADVSDIQNHNFSGSALNEMLRKRETGH  723

Query  573  RIAMPNTILHEAASKWAKDDHQ-------NSSSMPQQCSIRVSIYRGHPATRRETQCPEP  415
            +I +      E   +  K + +       + SS P     RVSIYRGHP  RR+  C EP
Sbjct  724  QITVDEATPSEHVVREDKGEQEEQSWGRSSKSSFP-----RVSIYRGHPINRRDKNCKEP  778

Query  414  GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            GRLI+ P+++ EL  IAGEK GF+A D+ +T+EEGA +D+++VIRDN+KLFIV 
Sbjct  779  GRLIRFPDSLEELKKIAGEKFGFEAEDAMVTNEEGAEVDTVEVIRDNEKLFIVG  832



>emb|CAA71598.1| potassium channel [Vicia faba]
Length=807

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 160/230 (70%), Gaps = 6/230 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KDM GNTALW AIA+K +SIF ILY  +++SDPY AG+LLC AAK ND +VM ELLK G
Sbjct  579  IKDMNGNTALWYAIASKHYSIFRILYQLSALSDPYTAGNLLCLAAKRNDLTVMNELLKQG  638

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++DSKD HG   IQ AM EN  DM++LLVMNGA + D      +   L E+LQKRE+GH
Sbjct  639  LNIDSKDGHGMKPIQIAMTENLVDMVQLLVMNGASVLDMHIPEFSASTLNELLQKREIGH  698

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCS----IRVSIYRGHPATRRETQCPEPGRL  406
             I +   +  E   K   ++ ++   + ++C+     RVSIYRGHP  RRE    E G+L
Sbjct  699  LINVNEEMPSEFVLK--GENQEDQKQVWKRCNGVEFPRVSIYRGHPIVRREKGFIEAGKL  756

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            IKLP+++ +L  IAGEK  FDA D+ +T+EEGA IDSIDVIRDNDKL+IV
Sbjct  757  IKLPDSLEKLKIIAGEKFEFDARDAMVTNEEGAEIDSIDVIRDNDKLYIV  806



>ref|XP_007148520.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris]
 gb|ESW20514.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris]
Length=832

 Score =   234 bits (597),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 160/228 (70%), Gaps = 2/228 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM GNTALW+AIA+K +SIF +L+ +A++SD   AGD+LC AAK N+ +VM++LLK G
Sbjct  604  IRDMNGNTALWEAIASKHYSIFRLLFQFAALSDQNTAGDILCTAAKRNELTVMKDLLKLG  663

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRH  TAIQ AM EN  +M++LL+MNGA++ D          L+E+L   E+GH
Sbjct  664  LNVDSKDRHDETAIQIAMAENHVEMVQLLLMNGADVSDVQNHEFCSSTLSEMLHNCEIGH  723

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCS--IRVSIYRGHPATRRETQCPEPGRLIK  400
            RI +   +  E ASK    + ++        S   RVSIYRGHP  RRE    + G+LIK
Sbjct  724  RINVIELMPSEVASKGKHQEEEHGGERRYNGSKIARVSIYRGHPLLRREEGTMQSGKLIK  783

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            +P+++ EL +IAGEK GFDA D+ +T+EEGA I+SIDVIRDNDKLF +
Sbjct  784  MPDSLDELKNIAGEKFGFDAKDAMVTNEEGAEIESIDVIRDNDKLFFI  831



>emb|CBI23771.3| unnamed protein product [Vitis vinifera]
Length=805

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 155/232 (67%), Gaps = 32/232 (14%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALWDA++AK +SIF ILYH AS+SDPY +GDLLC AAK ND + M+ELLK G
Sbjct  603  VRDINGNTALWDAVSAKHNSIFWILYHCASLSDPYTSGDLLCTAAKRNDLTAMKELLKQG  662

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++DSK+R G TAIQ AM E+  DM+KLLVMNGA++  A                     
Sbjct  663  LNIDSKNRQGLTAIQIAMAEDHTDMVKLLVMNGADVIHA---------------------  701

Query  573  RIAMPNTILHEAASK-WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
                 NT   +   K +  +     +++P     RVSIYRGHP  R+E+ C E GRLI+L
Sbjct  702  -----NTYEDQGGEKEFNTNGGFKGTNVP-----RVSIYRGHPLQRKESCCTEAGRLIRL  751

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
            P ++ EL +IAGEKLGFDA ++ +T+EEGA IDSI+VIRDND LF+V D NS
Sbjct  752  PNSLMELKAIAGEKLGFDARNAMVTNEEGAEIDSIEVIRDNDTLFLVEDPNS  803



>ref|XP_008783360.1| PREDICTED: potassium channel AKT2 [Phoenix dactylifera]
Length=844

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 158/237 (67%), Gaps = 14/237 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DMEGNT LW AI AK H IF+ILYH+A  S+P+V G+LLC AAK ND S M+ELLKHG
Sbjct  601  IQDMEGNTLLWLAITAKHHKIFNILYHYACNSNPHVGGNLLCLAAKRNDLSTMKELLKHG  660

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPL--------DLTEV  598
            L ++S++  G T++QAA  EN  DMIK LVMNGA +++   +NL+ L        DL E+
Sbjct  661  LDINSENNEGLTSLQAAFAENHTDMIKFLVMNGANVEN---INLSNLETRKMTQADLQEL  717

Query  597  LQKRELGHRIAMPNTILHEAASKWAKDD-HQNSSSMPQQCSIRVSIYRGHPATRRETQCP  421
            +QKRE+G+ IA+  +      +K ++++ H            RVSIY+GHP  R    C 
Sbjct  718  VQKREVGYPIAILESHEELKQTKVSEEESHMMKWGTRDGLYPRVSIYKGHPLLR--NSCL  775

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            E G+LI LP TI +L  IAG+K G  A  + +T+EEGA IDSI+VIRDNDKLFIV +
Sbjct  776  EAGKLINLPSTIEDLREIAGKKFGVVANSTVITNEEGAEIDSIEVIRDNDKLFIVEN  832



>ref|XP_002441141.1| hypothetical protein SORBIDRAFT_09g021160 [Sorghum bicolor]
 gb|EES19571.1| hypothetical protein SORBIDRAFT_09g021160 [Sorghum bicolor]
Length=838

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 153/242 (63%), Gaps = 16/242 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTA+W+AIAA  H IF+ILYH+A  S+P+  GD+LC AA+  D   ++ELLK G
Sbjct  584  IKDAQGNTAMWNAIAAGHHKIFNILYHFARASNPHAGGDVLCFAARRGDLGALRELLKLG  643

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD-----------AVKLNLAPLDL  607
            L VDS+D  G+TA++ AM E  AD  + L+MNGA +D            A +L ++P +L
Sbjct  644  LDVDSEDHDGATALRVAMAEGHADAARFLIMNGASVDKASLDDDGSGSGAARLTMSPTEL  703

Query  606  TEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRR  436
             E+LQKRELGH I +   P  I    +S  ++      +S   QC  RVS+Y+GHP  R 
Sbjct  704  RELLQKRELGHSITIVDSPAVIPDGGSSGHSRPGRLQGTSSDNQCWPRVSVYKGHPFLRN  763

Query  435  ETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +   E G+LI LP T+ E  +I GEKL  DA    + ++EGA IDSIDVIRDNDKLF+V
Sbjct  764  RSS--EAGKLINLPGTLEEFKAIVGEKLKVDAKKGLIVNDEGAEIDSIDVIRDNDKLFVV  821

Query  255  AD  250
             +
Sbjct  822  TE  823



>ref|XP_010277671.1| PREDICTED: potassium channel AKT2/3-like [Nelumbo nucifera]
Length=838

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 157/234 (67%), Gaps = 9/234 (4%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D++GNT LWDA+AA  HSIF ILYH++SISDPY  GDLLC AA+ ND   M +LLKHGL
Sbjct  606  QDVDGNTPLWDAVAANHHSIFRILYHFSSISDPYTDGDLLCTAARRNDLQTMNKLLKHGL  665

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
            +V+SK+R G  A+Q A++ +  DM+ LLV NGA+   A +   +     E++QK E G+R
Sbjct  666  NVNSKNRDGVAALQIAVDGDYVDMVNLLVTNGAKAYQANQNGHS----DEMMQKPEGGYR  721

Query  570  IAMPNTIL-HEAASKWAKDDHQNSSSMPQQCS----IRVSIYRGHPATRRETQCPEPGRL  406
            I     IL H+A     +   +   S  ++ +    +RV+IY+GHP  RR +   + GRL
Sbjct  722  ITGSEAILPHDALVGRFRKMQEGKESRERRSNGGNCLRVNIYKGHPTVRRYSFGRDAGRL  781

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
            IKLP ++ EL  IAGEK GFD  D+ +T+EEG+II+SI+VIRDN+KLFI  + N
Sbjct  782  IKLPNSMEELKRIAGEKFGFDPKDAIVTNEEGSIIESIEVIRDNEKLFIAENTN  835



>gb|AAD39492.1|AF145272_1 pulvinus inward-rectifying channel SPICK2 [Samanea saman]
Length=810

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 147/225 (65%), Gaps = 17/225 (8%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +DM G+TALWDAI +K +SIF ILY     SDP+ AGDLLCKAAK N+ +VM ELLK GL
Sbjct  602  RDMNGDTALWDAIFSKHYSIFRILYQLCVQSDPHTAGDLLCKAAKRNELTVMSELLKQGL  661

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
            +++SKD HG TA+Q A + N  DMI+LL MNG+++  A+       D     Q+    H 
Sbjct  662  NIESKDHHGCTAMQVAWQHNHVDMIQLLFMNGSDVVGALN-----YDNNNNNQEERGQHN  716

Query  570  IAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
                        S W   ++ N+S+  +  + RVSI+RGHP  RR+  C E G++I+ P 
Sbjct  717  ------------SIWGTYNNNNNSNNHRHIASRVSIFRGHPILRRQQGCIEAGKMIRFPN  764

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            +I EL +IAGE+ GFDA D+ +TDE GA IDSID+IRDNDKLFIV
Sbjct  765  SIKELKTIAGERFGFDAKDAMVTDEGGAEIDSIDLIRDNDKLFIV  809



>ref|XP_010910952.1| PREDICTED: potassium channel AKT2-like isoform X2 [Elaeis guineensis]
Length=678

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 155/239 (65%), Gaps = 18/239 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LW AI  K H IF+ILYH+A IS+P++ G+LL  AAK ND S ++ELLKHG
Sbjct  443  IQDMDGNTPLWLAITGKHHKIFNILYHYACISNPHIGGNLLVLAAKRNDLSTIKELLKHG  502

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPL--------DLTEV  598
            L ++S++  G T +QAA  EN  DMIKLLVMNGA +++   +NL+ L        D+ E+
Sbjct  503  LDINSENNEGLTPLQAAFAENHTDMIKLLVMNGANVEN---INLSSLETRKMTEADIQEL  559

Query  597  LQKRELGHRIAMPNTILHEAASKWA---KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQ  427
            +QKRE+G+ IA+  +  HE   +     +  H            RVSIY+GHP  R  + 
Sbjct  560  VQKREVGYPIAILES--HEELKQIKVSEEKSHMTKWGTRGGIYPRVSIYKGHPFLRNSSS  617

Query  426  CPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              E G+LI LP TI +L  IAGEK G  A  + +T+EEGA IDSI+VIRDNDKLFIV +
Sbjct  618  --EAGKLINLPNTIEDLKEIAGEKFGVVANRTVITNEEGAEIDSIEVIRDNDKLFIVEN  674



>ref|XP_008378876.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Malus domestica]
Length=797

 Score =   210 bits (535),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 134/191 (70%), Gaps = 1/191 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D  GNTALWDAIA+K HSIF  LY  A+ISDPY AGDLLC AAK N+ +VM+ELLK G
Sbjct  596  VRDTNGNTALWDAIASKHHSIFRSLYFCAAISDPYTAGDLLCTAAKRNNLTVMEELLKQG  655

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSK++ G TA+Q AMEEN ADM+ LLVMNGA++ +A         LTE+LQKRE+GH
Sbjct  656  LNVDSKNQLGKTAVQIAMEENNADMVNLLVMNGADVTNAQNCLFPSQSLTEMLQKREVGH  715

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            RI +P++ ++E       + +    S    C  RVSIYRGHP  R+ T C E GR+I+LP
Sbjct  716  RITVPDSTINEVPLMKNGERNSGRESYGVNCP-RVSIYRGHPMVRKTTCCREAGRVIRLP  774

Query  393  ETIAELISIAG  361
             ++ EL + AG
Sbjct  775  XSLEELRNXAG  785



>ref|XP_008378875.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Malus domestica]
Length=821

 Score =   210 bits (535),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 134/191 (70%), Gaps = 1/191 (1%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D  GNTALWDAIA+K HSIF  LY  A+ISDPY AGDLLC AAK N+ +VM+ELLK G
Sbjct  620  VRDTNGNTALWDAIASKHHSIFRSLYFCAAISDPYTAGDLLCTAAKRNNLTVMEELLKQG  679

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSK++ G TA+Q AMEEN ADM+ LLVMNGA++ +A         LTE+LQKRE+GH
Sbjct  680  LNVDSKNQLGKTAVQIAMEENNADMVNLLVMNGADVTNAQNCLFPSQSLTEMLQKREVGH  739

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            RI +P++ ++E       + +    S    C  RVSIYRGHP  R+ T C E GR+I+LP
Sbjct  740  RITVPDSTINEVPLMKNGERNSGRESYGVNCP-RVSIYRGHPMVRKTTCCREAGRVIRLP  798

Query  393  ETIAELISIAG  361
             ++ EL + AG
Sbjct  799  XSLEELRNXAG  809



>ref|XP_010910948.1| PREDICTED: potassium channel AKT2-like isoform X1 [Elaeis guineensis]
Length=836

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 155/239 (65%), Gaps = 18/239 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LW AI  K H IF+ILYH+A IS+P++ G+LL  AAK ND S ++ELLKHG
Sbjct  601  IQDMDGNTPLWLAITGKHHKIFNILYHYACISNPHIGGNLLVLAAKRNDLSTIKELLKHG  660

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPL--------DLTEV  598
            L ++S++  G T +QAA  EN  DMIKLLVMNGA +++   +NL+ L        D+ E+
Sbjct  661  LDINSENNEGLTPLQAAFAENHTDMIKLLVMNGANVEN---INLSSLETRKMTEADIQEL  717

Query  597  LQKRELGHRIAMPNTILHEAASKWA---KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQ  427
            +QKRE+G+ IA+  +  HE   +     +  H            RVSIY+GHP  R  + 
Sbjct  718  VQKREVGYPIAILES--HEELKQIKVSEEKSHMTKWGTRGGIYPRVSIYKGHPFLRNSSS  775

Query  426  CPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              E G+LI LP TI +L  IAGEK G  A  + +T+EEGA IDSI+VIRDNDKLFIV +
Sbjct  776  --EAGKLINLPNTIEDLKEIAGEKFGVVANRTVITNEEGAEIDSIEVIRDNDKLFIVEN  832



>ref|XP_010539356.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Tarenaya hassleriana]
Length=794

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 150/230 (65%), Gaps = 22/230 (10%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI +K H+IF ILYH+A+ISDP+VAGDLLC AA+ N+  VM++LLK G
Sbjct  587  VRDVNGNTALWEAITSKNHAIFRILYHFAAISDPHVAGDLLCAAARQNNLEVMKDLLKLG  646

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++D+KD  G TA+Q AM EN  DM+ LLVM+G+++        +     E++ +RE  +
Sbjct  647  LNIDTKDHKGFTAVQVAMAENHMDMVNLLVMSGSDVIGLNTCEFSSSTFDEMMLEREARN  706

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            R  +      +A  K A                RVSI+RGHP  RR     E G+LI LP
Sbjct  707  RTNV------QAGEKRA----------------RVSIFRGHPLERRGLGFAEYGKLIMLP  744

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
             ++ EL  IAG KLGFDA+ + +TDE GA IDSI+VIRDNDK+++V + N
Sbjct  745  SSLDELKKIAGGKLGFDASGAMVTDETGAEIDSIEVIRDNDKIYLVEEDN  794



>ref|XP_010539338.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Tarenaya hassleriana]
Length=807

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 150/230 (65%), Gaps = 22/230 (10%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI +K H+IF ILYH+A+ISDP+VAGDLLC AA+ N+  VM++LLK G
Sbjct  600  VRDVNGNTALWEAITSKNHAIFRILYHFAAISDPHVAGDLLCAAARQNNLEVMKDLLKLG  659

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++D+KD  G TA+Q AM EN  DM+ LLVM+G+++        +     E++ +RE  +
Sbjct  660  LNIDTKDHKGFTAVQVAMAENHMDMVNLLVMSGSDVIGLNTCEFSSSTFDEMMLEREARN  719

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            R  +      +A  K A                RVSI+RGHP  RR     E G+LI LP
Sbjct  720  RTNV------QAGEKRA----------------RVSIFRGHPLERRGLGFAEYGKLIMLP  757

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
             ++ EL  IAG KLGFDA+ + +TDE GA IDSI+VIRDNDK+++V + N
Sbjct  758  SSLDELKKIAGGKLGFDASGAMVTDETGAEIDSIEVIRDNDKIYLVEEDN  807



>ref|XP_010539347.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Tarenaya hassleriana]
Length=801

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 150/230 (65%), Gaps = 22/230 (10%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI +K H+IF ILYH+A+ISDP+VAGDLLC AA+ N+  VM++LLK G
Sbjct  594  VRDVNGNTALWEAITSKNHAIFRILYHFAAISDPHVAGDLLCAAARQNNLEVMKDLLKLG  653

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L++D+KD  G TA+Q AM EN  DM+ LLVM+G+++        +     E++ +RE  +
Sbjct  654  LNIDTKDHKGFTAVQVAMAENHMDMVNLLVMSGSDVIGLNTCEFSSSTFDEMMLEREARN  713

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            R  +      +A  K A                RVSI+RGHP  RR     E G+LI LP
Sbjct  714  RTNV------QAGEKRA----------------RVSIFRGHPLERRGLGFAEYGKLIMLP  751

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
             ++ EL  IAG KLGFDA+ + +TDE GA IDSI+VIRDNDK+++V + N
Sbjct  752  SSLDELKKIAGGKLGFDASGAMVTDETGAEIDSIEVIRDNDKIYLVEEDN  801



>gb|KDO50099.1| hypothetical protein CISIN_1g038432mg, partial [Citrus sinensis]
Length=602

 Score =   202 bits (515),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 133/195 (68%), Gaps = 6/195 (3%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L DM GNTALW+AI++K HSIF ILYH  +ISDPY AGDLLC A K ND SVM+EL+K+G
Sbjct  409  LLDMNGNTALWEAISSKHHSIFRILYHCTAISDPYTAGDLLCTAEKRNDMSVMEELVKYG  468

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDSKDRHG TAI+ AM EN  +M+  LVMNG+++  A K   +  +L ++LQKRE+GH
Sbjct  469  LNVDSKDRHGRTAIEIAMAENNVEMVNFLVMNGSDVVGANKCEFSSTNLNDMLQKREIGH  528

Query  573  RIAM--PNTILHEAASKWAK---DDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            RI +   N+  +E   K  +    + +   S    C  RVSIYRGHP  R++  C E GR
Sbjct  529  RITVHDDNSTQNEVLLKKLEIIDFEAKEGKSKGGNCQ-RVSIYRGHPLVRKQACCMEAGR  587

Query  408  LIKLPETIAELISIA  364
            LIKLP ++ EL  IA
Sbjct  588  LIKLPNSLEELKKIA  602



>gb|AAA96153.1| AKT3 [Arabidopsis thaliana]
 gb|AAA96154.1| AKT3 [Arabidopsis thaliana]
 emb|CAA16770.1| potassium channel protein AKT3 [Arabidopsis thaliana]
 emb|CAB79175.1| potassium channel protein AKT3 [Arabidopsis thaliana]
Length=787

 Score =   204 bits (520),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 147/232 (63%), Gaps = 38/232 (16%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GN+ALW+AI +K + IF ILYH+A+ISDP++AGDLLC+AAK N+  VM+ LLK G
Sbjct  587  IRDVNGNSALWEAIISKHYEIFRILYHFAAISDPHIAGDLLCEAAKQNNVEVMKALLKQG  646

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN----LAPLDLTEVLQKR  586
            L+VD++D HG TA+Q AM E+Q DM+ LL  NGA   D V +N      PL+   V+++ 
Sbjct  647  LNVDTEDHHGVTALQVAMAEDQMDMVNLLATNGA---DVVCVNTHNEFTPLEKLRVVEEE  703

Query  585  ELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRL  406
            E   R                                RVSIYRGHP  RRE  C E G+L
Sbjct  704  EEEER-------------------------------GRVSIYRGHPLERRERSCNEAGKL  732

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            I LP ++ +L  IAGEK GFD +++ +T+E+GA IDSI+VIRDNDKL+ V +
Sbjct  733  ILLPPSLDDLKKIAGEKFGFDGSETMVTNEDGAEIDSIEVIRDNDKLYFVVN  784



>ref|NP_567651.1| potassium channel AKT2/3 [Arabidopsis thaliana]
 sp|Q38898.1|AKT2_ARATH RecName: Full=Potassium channel AKT2/3 [Arabidopsis thaliana]
 gb|AAA97865.1| potassium channel [Arabidopsis thaliana]
 dbj|BAF01572.1| potassium channel [Arabidopsis thaliana]
 gb|AEE84571.1| potassium channel AKT2/3 [Arabidopsis thaliana]
Length=802

 Score =   204 bits (520),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 147/232 (63%), Gaps = 38/232 (16%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GN+ALW+AI +K + IF ILYH+A+ISDP++AGDLLC+AAK N+  VM+ LLK G
Sbjct  602  IRDVNGNSALWEAIISKHYEIFRILYHFAAISDPHIAGDLLCEAAKQNNVEVMKALLKQG  661

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN----LAPLDLTEVLQKR  586
            L+VD++D HG TA+Q AM E+Q DM+ LL  NGA   D V +N      PL+   V+++ 
Sbjct  662  LNVDTEDHHGVTALQVAMAEDQMDMVNLLATNGA---DVVCVNTHNEFTPLEKLRVVEEE  718

Query  585  ELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRL  406
            E   R                                RVSIYRGHP  RRE  C E G+L
Sbjct  719  EEEER-------------------------------GRVSIYRGHPLERRERSCNEAGKL  747

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            I LP ++ +L  IAGEK GFD +++ +T+E+GA IDSI+VIRDNDKL+ V +
Sbjct  748  ILLPPSLDDLKKIAGEKFGFDGSETMVTNEDGAEIDSIEVIRDNDKLYFVVN  799



>gb|KFK28793.1| hypothetical protein AALP_AA7G048900 [Arabis alpina]
Length=789

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 146/225 (65%), Gaps = 37/225 (16%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D+ GNTALW+AI++K H IF ILYH+A+ISDP++AGDLLC+A + N+  VM++LLK G+
Sbjct  599  RDVNGNTALWEAISSKHHEIFRILYHFAAISDPHIAGDLLCEAVRQNNIEVMKDLLKQGI  658

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
             VD+K+ HG TA+Q AM EN  DM+ LL+MNGA++     + + PL+    ++       
Sbjct  659  SVDTKNHHGFTALQVAMSENHMDMVNLLMMNGADV-----VGVTPLEKLRAVE-------  706

Query  570  IAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
                            ++D +           RVSI+RG+P  RRE  C E G++I LP 
Sbjct  707  ----------------EEDKERG---------RVSIFRGNPLERREQNCNEAGKVILLPP  741

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            T+ +L  IAGEK GFD +++ +T+E+GA IDSI+VIRDNDKL+ V
Sbjct  742  TLDDLKKIAGEKFGFDGSETMVTNEDGAEIDSIEVIRDNDKLYFV  786



>ref|XP_010439358.1| PREDICTED: potassium channel AKT2/3 [Camelina sativa]
Length=803

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 146/228 (64%), Gaps = 30/228 (13%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI  K ++IF ILYH+A+ISDP++AGDLLC+A K N+  VM+ LLK G
Sbjct  603  IRDVNGNTALWEAITTKHYAIFRILYHFAAISDPHIAGDLLCEAVKQNNVEVMKALLKQG  662

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD++D HG TA+Q AMEENQ DM+ LL MNGA   D V +N    +L   L+K     
Sbjct  663  LNVDTEDHHGFTALQVAMEENQMDMVNLLTMNGA---DVVGVNTHG-ELFTPLEKLR---  715

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                                        ++   RVSIYRGHP  RRE  C E G+L+ LP
Sbjct  716  -----------------------VVGEEEEERGRVSIYRGHPLERREQSCNEAGKLVLLP  752

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +L  IAGEK GFD +++ +T+E+GA IDSI+VIRDNDKL+ V +
Sbjct  753  PSLDDLKKIAGEKFGFDGSETMVTNEDGAEIDSIEVIRDNDKLYFVEN  800



>ref|XP_010448923.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
Length=802

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 145/228 (64%), Gaps = 30/228 (13%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI+ K ++IF ILYH+A+ISDP++AGDLLC+A K N+  VM+ LLK G
Sbjct  602  IRDVNGNTALWEAISTKHYAIFRILYHFAAISDPHIAGDLLCEAVKQNNVEVMKALLKQG  661

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VDS+D HG TA+Q AMEENQ DM+ LL MNGA++D                       
Sbjct  662  LNVDSEDHHGFTALQVAMEENQMDMVNLLTMNGADVDG----------------------  699

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                    ++     +   +        ++   RVSIYRGHP  RRE  C E G+L+ +P
Sbjct  700  --------VNTHGELFTPLEKSRVVGEEEEERGRVSIYRGHPLERREQSCNEAGKLVLIP  751

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +L  IAG+K GFD +++ +T+E+GA IDSI+VIRDNDK++ V +
Sbjct  752  PSLDDLKKIAGDKFGFDGSETMVTNEDGAEIDSIEVIRDNDKIYFVEN  799



>ref|XP_002441143.1| hypothetical protein SORBIDRAFT_09g021190 [Sorghum bicolor]
 gb|EES19573.1| hypothetical protein SORBIDRAFT_09g021190 [Sorghum bicolor]
Length=845

 Score =   202 bits (515),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 153/240 (64%), Gaps = 16/240 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTA+W+AIAA  H IF+ILY +A  S+P+  GD+LC AA+  D   ++ELLK G
Sbjct  592  IKDAQGNTAMWNAIAAGHHKIFNILYQFAHASNPHAGGDVLCLAARRGDLDALRELLKLG  651

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID---------DAVKLNLAPLDLTE  601
            L VDS+D  G+TA++ AM     D+ + L+MNGA +D          A +L ++P +L E
Sbjct  652  LDVDSEDHDGATALRVAMANGHVDVARFLIMNGASVDKANLDDDGSSAARLTMSPTELRE  711

Query  600  VLQKRELGHRIAM----PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRE  433
            +LQKRELGH I +    P  +    +S  ++     S+S   Q S RVS+Y+GHP+ R  
Sbjct  712  LLQKRELGHSITIVDSSPAVVPDGGSSGHSRPGRLQSTSSDNQRSPRVSLYKGHPSLRNR  771

Query  432  TQCPEPGRLIKLPE-TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            +   E G+LI L E T+ E  +I GEKL  DA  + + ++EGA IDSIDVIRDNDKLF+V
Sbjct  772  SS--EAGKLINLREATMGEFKAIIGEKLKVDAEKALIVNDEGAEIDSIDVIRDNDKLFVV  829



>ref|XP_006283121.1| hypothetical protein CARUB_v10004143mg, partial [Capsella rubella]
 gb|EOA16019.1| hypothetical protein CARUB_v10004143mg, partial [Capsella rubella]
Length=820

 Score =   202 bits (514),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 149/229 (65%), Gaps = 33/229 (14%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD+ GNTALW+AI+ K ++IF ILYH+A+ISDP++AGDLLC+A K N+  V++ LLK G
Sbjct  621  IKDVNGNTALWEAISTKHYAIFRILYHFAAISDPHIAGDLLCEAVKQNNVEVIKALLKQG  680

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD++D +G TA+Q AMEENQ  M+ LL MNGA   D V +N    + T V +K  +  
Sbjct  681  LNVDTEDHNGFTALQVAMEENQTYMVNLLAMNGA---DVVGVNTHD-EYTLVEKKLRV--  734

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                                      + Q+   RVSIYRGHP  RRE  C E G+LI LP
Sbjct  735  --------------------------VEQEERGRVSIYRGHPLERREQSCNEAGKLILLP  768

Query  393  ETIAELISIAGEKLGFDATDSSL-TDEEGAIIDSIDVIRDNDKLFIVAD  250
             T+ +L  +AGEK GFD +++++ T+E+GA IDSI+VIRDNDKL+ V +
Sbjct  769  PTLDDLKKLAGEKFGFDGSETTMVTNEDGAEIDSIEVIRDNDKLYFVEN  817



>gb|ACF78497.1| unknown [Zea mays]
Length=530

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 149/246 (61%), Gaps = 20/246 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H  F++LY +   S+P   GD++C AA+      +QELLK G
Sbjct  272  IRDAQGNTAMWNAIAAGHHKTFNLLYQFGRASNPRAGGDVMCLAARRGHLGALQELLKLG  331

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD---------------AVKLNLA  619
            L VDS+D  G+TA++ AM E  AD  + L++NGA +D                A +L ++
Sbjct  332  LDVDSEDHDGATALRVAMAEGHADAARFLILNGASVDKASLDDDGSGSGSGSGAARLAMS  391

Query  618  PLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHP  448
            P +L E+LQKRELGH I +   P  + +  +S  ++     S+S   Q   RVS+Y+GHP
Sbjct  392  PTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSRPGRLQSTSSDSQRWPRVSVYKGHP  451

Query  447  ATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDK  268
              R  T   E G+LI LP T+ E  +I GEKL  DA  + +  +EGA IDSIDVIRDNDK
Sbjct  452  FLRNRTS--EAGKLINLPGTMEEFRAIVGEKLKVDAEKALIVSDEGAEIDSIDVIRDNDK  509

Query  267  LFIVAD  250
            LF+V +
Sbjct  510  LFMVTE  515



>ref|XP_004961989.1| PREDICTED: potassium channel AKT2-like isoform X1 [Setaria italica]
Length=855

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 153/254 (60%), Gaps = 33/254 (13%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTALW A+AA  H IF+ILYH+A +S P   GD+LC AA+ ND   ++ELLK G
Sbjct  594  IKDAQGNTALWHAVAAGHHKIFNILYHFARVSSPRAGGDVLCLAARRNDVGALRELLKLG  653

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD----------------AVKLNL  622
            L VDS+D  G+TA++ AM E  AD  + L+MNGA +D                 A +L +
Sbjct  654  LDVDSEDHDGATALRVAMAEGHADAARFLIMNGASVDKAGLDDDDGSGSSSGSGAARLAM  713

Query  621  APLDLTEVLQKRELGHRIAM---PNTI-------LHEAASKWAKDDHQNSSSMPQQCSIR  472
            +P +L E+L+KRELGH+I +   P  +        H    ++ +    +S+  P     R
Sbjct  714  SPGELRELLKKRELGHQITIIDSPAVVPDGGGSSRHRRQGRFQQSTSSDSARWP-----R  768

Query  471  VSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSI  292
            VSIY+GHP  R  +   E G+LI LP T+ E  +I  EKL  DA  + + ++EGA IDSI
Sbjct  769  VSIYKGHPFLRNHSS--EAGKLINLPGTMEEFKAIIREKLKVDAEKALIVNDEGAEIDSI  826

Query  291  DVIRDNDKLFIVAD  250
            DVIRDNDKLF+V +
Sbjct  827  DVIRDNDKLFVVTE  840



>ref|XP_004961990.1| PREDICTED: potassium channel AKT2-like isoform X2 [Setaria italica]
Length=857

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 153/254 (60%), Gaps = 33/254 (13%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTALW A+AA  H IF+ILYH+A +S P   GD+LC AA+ ND   ++ELLK G
Sbjct  596  IKDAQGNTALWHAVAAGHHKIFNILYHFARVSSPRAGGDVLCLAARRNDVGALRELLKLG  655

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD----------------AVKLNL  622
            L VDS+D  G+TA++ AM E  AD  + L+MNGA +D                 A +L +
Sbjct  656  LDVDSEDHDGATALRVAMAEGHADAARFLIMNGASVDKAGLDDDDGSGSSSGSGAARLAM  715

Query  621  APLDLTEVLQKRELGHRIAM---PNTI-------LHEAASKWAKDDHQNSSSMPQQCSIR  472
            +P +L E+L+KRELGH+I +   P  +        H    ++ +    +S+  P     R
Sbjct  716  SPGELRELLKKRELGHQITIIDSPAVVPDGGGSSRHRRQGRFQQSTSSDSARWP-----R  770

Query  471  VSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSI  292
            VSIY+GHP  R  +   E G+LI LP T+ E  +I  EKL  DA  + + ++EGA IDSI
Sbjct  771  VSIYKGHPFLRNHSS--EAGKLINLPGTMEEFKAIIREKLKVDAEKALIVNDEGAEIDSI  828

Query  291  DVIRDNDKLFIVAD  250
            DVIRDNDKLF+V +
Sbjct  829  DVIRDNDKLFVVTE  842



>ref|XP_010434070.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
 ref|XP_010434071.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
Length=801

 Score =   199 bits (505),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 143/228 (63%), Gaps = 31/228 (14%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI  K ++IF ILYH+A+ISDP++AGDLLC+A K N+  VM+ LLK G
Sbjct  602  IRDVNGNTALWEAITTKHYAIFRILYHFAAISDPHIAGDLLCEAVKQNNVEVMKALLKQG  661

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L+VD++D HG TA+Q AME+NQ DM+ LL MNGA   D V +N                 
Sbjct  662  LNVDTEDHHGFTALQVAMEDNQMDMVNLLTMNGA---DVVGVN-----------------  701

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                          ++   +        ++   RVSIYRGHP  RRE  C E  +L+ LP
Sbjct  702  -----------THGEFTPLEKLRVVEEEEEERGRVSIYRGHPLGRREQSCNEAWKLVLLP  750

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +L  IAGEK GFD +++ +T+E+GA IDSI+VIRDNDKL+ V +
Sbjct  751  PSLDDLKKIAGEKFGFDGSETMVTNEDGAEIDSIEVIRDNDKLYFVEN  798



>ref|XP_008655421.1| PREDICTED: potassium channel protein ZMK2 isoform X2 [Zea mays]
Length=699

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 149/246 (61%), Gaps = 20/246 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H  F++LY +   S+P   GD++C AA+      +QELLK G
Sbjct  441  IRDAQGNTAMWNAIAAGHHKTFNLLYQFGRASNPRAGGDVMCLAARRGHLGALQELLKLG  500

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD---------------AVKLNLA  619
            L VDS+D  G+TA++ AM E  AD  + L++NGA +D                A +L ++
Sbjct  501  LDVDSEDHDGATALRVAMAEGHADAARFLILNGASVDKASLDDDGSGSGSGSGAARLAMS  560

Query  618  PLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHP  448
            P +L E+LQKRELGH I +   P  + +  +S  ++     S+S   Q   RVS+Y+GHP
Sbjct  561  PTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSRPGRLQSTSSDSQRWPRVSVYKGHP  620

Query  447  ATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDK  268
              R  T   E G+LI LP T+ E  +I GEKL  DA  + +  +EGA IDSIDVIRDNDK
Sbjct  621  FLRNRTS--EAGKLINLPGTMEEFRAIVGEKLKVDAEKALIVSDEGAEIDSIDVIRDNDK  678

Query  267  LFIVAD  250
            LF+V +
Sbjct  679  LFMVTE  684



>gb|AAV59417.1| putative potassium channel protein [Oryza sativa Japonica Group]
Length=561

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 156/245 (64%), Gaps = 19/245 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY-VAGDLLCKAAKMNDSSVMQELLKH  757
            +KD +GNTALW+AIAA+ H IF+ILYH+A +S P+  AGDLLC AA+  D   ++ELLKH
Sbjct  304  IKDAQGNTALWNAIAARHHKIFNILYHFARVSSPHHAAGDLLCLAARRGDLDTLRELLKH  363

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN-------LAPLDLTEV  598
            GL VDS+DR G+TA++ A+ E  AD+ +LLV+NGA +D A   N       ++  +L E+
Sbjct  364  GLAVDSEDRDGATALRVALAEGHADVARLLVLNGASVDRAASHNEQQAAAAVSVDELREL  423

Query  597  LQKRELGHRIAM----PN----TILHEAASKW-AKDDHQNSSSMPQQCSIRVSIYRGHPA  445
            ++ REL H + +    P+     ++ E  S   +++  + S+        RVSIYRGHP 
Sbjct  424  MKTRELAHPVTIVVDSPSPAAAAVIREVGSSGDSRNGRRQSARSDGAHWPRVSIYRGHPF  483

Query  444  TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  265
             R  +   E G+LI LP T+ E   I  EKL  DA  + + ++EGA IDSIDVIRDNDKL
Sbjct  484  VRNRSS--EAGKLINLPGTMEEFRIIIEEKLKVDARKTLIMNDEGAEIDSIDVIRDNDKL  541

Query  264  FIVAD  250
            FIV +
Sbjct  542  FIVTE  546



>ref|NP_001055614.1| Os05g0428700 [Oryza sativa Japonica Group]
 dbj|BAF17528.1| Os05g0428700, partial [Oryza sativa Japonica Group]
Length=566

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 156/245 (64%), Gaps = 19/245 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY-VAGDLLCKAAKMNDSSVMQELLKH  757
            +KD +GNTALW+AIAA+ H IF+ILYH+A +S P+  AGDLLC AA+  D   ++ELLKH
Sbjct  309  IKDAQGNTALWNAIAARHHKIFNILYHFARVSSPHHAAGDLLCLAARRGDLDTLRELLKH  368

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN-------LAPLDLTEV  598
            GL VDS+DR G+TA++ A+ E  AD+ +LLV+NGA +D A   N       ++  +L E+
Sbjct  369  GLAVDSEDRDGATALRVALAEGHADVARLLVLNGASVDRAASHNEQQAAAAVSVDELREL  428

Query  597  LQKRELGHRIAM----PN----TILHEAASKW-AKDDHQNSSSMPQQCSIRVSIYRGHPA  445
            ++ REL H + +    P+     ++ E  S   +++  + S+        RVSIYRGHP 
Sbjct  429  MKTRELAHPVTIVVDSPSPAAAAVIREVGSSGDSRNGRRQSARSDGAHWPRVSIYRGHPF  488

Query  444  TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  265
             R  +   E G+LI LP T+ E   I  EKL  DA  + + ++EGA IDSIDVIRDNDKL
Sbjct  489  VRNRSS--EAGKLINLPGTMEEFRIIIEEKLKVDARKTLIMNDEGAEIDSIDVIRDNDKL  546

Query  264  FIVAD  250
            FIV +
Sbjct  547  FIVTE  551



>ref|NP_001105120.1| potassium channel protein ZMK2 [Zea mays]
 emb|CAB54856.1| potassium channel protein ZMK2 [Zea mays]
Length=849

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 149/246 (61%), Gaps = 20/246 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H IF++LY +   S+P   GD++C AA+      +QELLK G
Sbjct  591  IRDAQGNTAMWNAIAAGHHKIFNLLYQFGRASNPRAGGDVMCLAARRGHLGALQELLKLG  650

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD---------------AVKLNLA  619
            L VDS+D  G+TA++ AM E  AD  + L++NGA +D                A +L ++
Sbjct  651  LDVDSEDHDGATALRVAMAEGHADAARFLILNGASVDKASLDDDGSGSGSGSGAARLAMS  710

Query  618  PLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHP  448
            P +L E+LQKRELGH I +   P  + +  +S  ++     S+S   Q   RVS+Y+GHP
Sbjct  711  PTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSRPGRLQSTSSDSQRWPRVSVYKGHP  770

Query  447  ATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDK  268
              R  T   E G+LI LP T+ E   I GEKL  DA  + +  +EGA IDSIDVIRDNDK
Sbjct  771  FLRNRTS--EAGKLINLPGTMEEFKVIVGEKLKVDAEKALIVSDEGAEIDSIDVIRDNDK  828

Query  267  LFIVAD  250
            LF+V +
Sbjct  829  LFMVTE  834



>ref|XP_008647796.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Zea mays]
 ref|XP_008647797.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Zea mays]
Length=696

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 148/242 (61%), Gaps = 16/242 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H IF+ILYH A  S+P+  GD++C A +  D   ++ELLK G
Sbjct  442  IRDAQGNTAMWNAIAAGHHKIFNILYHSARASNPHAGGDVMCLATRRGDLDALRELLKLG  501

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD-----------AVKLNLAPLDL  607
            L VDS+D  G+TA++ AM E  AD  + L+ NGA +D            A +L ++P +L
Sbjct  502  LDVDSEDHDGATALRVAMAEGHADAARFLITNGASVDKASLDDDGSGSGAARLTMSPTEL  561

Query  606  TEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRR  436
             E+LQKREL H I +   P  +    +S  ++     S+        RVSIYRGHP  R 
Sbjct  562  HELLQKRELVHSITITDSPPVVPDGGSSGHSRPGRLQSTGSDNTRWPRVSIYRGHPFLRN  621

Query  435  ETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +   E G+LI LP T+ E I++ GEKL  D   + + ++EGA +DSIDVIRDNDKLF+V
Sbjct  622  RSS--EAGKLINLPATMEEFIAVVGEKLKVDTEKALIVNDEGAEVDSIDVIRDNDKLFVV  679

Query  255  AD  250
             +
Sbjct  680  TE  681



>gb|AFW81865.1| potassium channel2 [Zea mays]
Length=769

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 149/246 (61%), Gaps = 20/246 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H  F++LY +   S+P   GD++C AA+      +QELLK G
Sbjct  511  IRDAQGNTAMWNAIAAGHHKTFNLLYQFGRASNPRAGGDVMCLAARRGHLGALQELLKLG  570

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD---------------AVKLNLA  619
            L VDS+D  G+TA++ AM E  AD  + L++NGA +D                A +L ++
Sbjct  571  LDVDSEDHDGATALRVAMAEGHADAARFLILNGASVDKASLDDDGSGSGSGSGAARLAMS  630

Query  618  PLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHP  448
            P +L E+LQKRELGH I +   P  + +  +S  ++     S+S   Q   RVS+Y+GHP
Sbjct  631  PTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSRPGRLQSTSSDSQRWPRVSVYKGHP  690

Query  447  ATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDK  268
              R  T   E G+LI LP T+ E  +I GEKL  DA  + +  +EGA IDSIDVIRDNDK
Sbjct  691  FLRNRTS--EAGKLINLPGTMEEFRAIVGEKLKVDAEKALIVSDEGAEIDSIDVIRDNDK  748

Query  267  LFIVAD  250
            LF+V +
Sbjct  749  LFMVTE  754



>ref|XP_002441145.1| hypothetical protein SORBIDRAFT_09g021210 [Sorghum bicolor]
 gb|EES19575.1| hypothetical protein SORBIDRAFT_09g021210 [Sorghum bicolor]
Length=837

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 148/237 (62%), Gaps = 20/237 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H IF+ILY ++  S+P+  GD+LC AA+  D  +++ELLK G
Sbjct  590  IEDAQGNTAMWNAIAAGHHRIFNILYQFSRASNPHAGGDVLCLAARRGDLGMLRELLKLG  649

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA-----------VKLNLAPLDL  607
            L VDS+D  G+TA++ AM E  AD+ + L+MNGA +D A            +  ++  +L
Sbjct  650  LDVDSEDHDGATALRVAMAEGHADVARFLIMNGASVDKASLDDDGSGSGTARRTMSSTEL  709

Query  606  TEVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQ  427
             E+LQKRELGH I    TI+   A      D   S+   QQ   RVSIY GHP  R  + 
Sbjct  710  RELLQKRELGHSI----TIVDSPA---VIPDRLQSTGSNQQRWPRVSIYNGHPFLRNRSY  762

Query  426  CPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
              E G+LI LP T+ E I+  GEKL  DA    + ++EGA IDSIDVIRDNDKLF+V
Sbjct  763  --EAGKLINLPGTMEEFIATVGEKLKVDAEKVLIVNDEGAEIDSIDVIRDNDKLFVV  817



>ref|XP_008655420.1| PREDICTED: potassium channel protein ZMK2 isoform X1 [Zea mays]
Length=847

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 149/246 (61%), Gaps = 20/246 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H  F++LY +   S+P   GD++C AA+      +QELLK G
Sbjct  589  IRDAQGNTAMWNAIAAGHHKTFNLLYQFGRASNPRAGGDVMCLAARRGHLGALQELLKLG  648

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD---------------AVKLNLA  619
            L VDS+D  G+TA++ AM E  AD  + L++NGA +D                A +L ++
Sbjct  649  LDVDSEDHDGATALRVAMAEGHADAARFLILNGASVDKASLDDDGSGSGSGSGAARLAMS  708

Query  618  PLDLTEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHP  448
            P +L E+LQKRELGH I +   P  + +  +S  ++     S+S   Q   RVS+Y+GHP
Sbjct  709  PTELRELLQKRELGHSITIHDSPAVVPNGGSSGHSRPGRLQSTSSDSQRWPRVSVYKGHP  768

Query  447  ATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDK  268
              R  T   E G+LI LP T+ E  +I GEKL  DA  + +  +EGA IDSIDVIRDNDK
Sbjct  769  FLRNRTS--EAGKLINLPGTMEEFRAIVGEKLKVDAEKALIVSDEGAEIDSIDVIRDNDK  826

Query  267  LFIVAD  250
            LF+V +
Sbjct  827  LFMVTE  832



>ref|NP_001147796.1| potassium channel AKT2/3 [Zea mays]
 gb|ACG28726.1| potassium channel AKT2/3 [Zea mays]
 gb|AFW78085.1| potassium channel AKT2/3 [Zea mays]
Length=838

 Score =   197 bits (501),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 148/242 (61%), Gaps = 16/242 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D +GNTA+W+AIAA  H IF+ILYH A  S+P+  GD++C A +  D   ++ELLK G
Sbjct  584  IRDAQGNTAMWNAIAAGHHKIFNILYHSARASNPHAGGDVMCLATRRGDLDALRELLKLG  643

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD-----------AVKLNLAPLDL  607
            L VDS+D  G+TA++ AM E  AD  + L+ NGA +D            A +L ++P +L
Sbjct  644  LDVDSEDHDGATALRVAMAEGHADAARFLITNGASVDKASLDDDGSGSGAARLTMSPTEL  703

Query  606  TEVLQKRELGHRIAM---PNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRR  436
             E+LQKREL H I +   P  +    +S  ++     S+        RVSIYRGHP  R 
Sbjct  704  HELLQKRELVHSITITDSPPVVPDGGSSGHSRPGRLQSTGSDNTRWPRVSIYRGHPFLRN  763

Query  435  ETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +   E G+LI LP T+ E I++ GEKL  D   + + ++EGA +DSIDVIRDNDKLF+V
Sbjct  764  RSS--EAGKLINLPATMEEFIAVVGEKLKVDTEKALIVNDEGAEVDSIDVIRDNDKLFVV  821

Query  255  AD  250
             +
Sbjct  822  TE  823



>ref|XP_006654434.1| PREDICTED: potassium channel AKT2-like [Oryza brachyantha]
Length=847

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 156/248 (63%), Gaps = 23/248 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTALW+AIAA+ H IF+ILYH+A +S P+ AGDLLC AA+  D   ++ELLKHG
Sbjct  586  IKDAQGNTALWNAIAARHHKIFNILYHFARVSSPHAAGDLLCLAARRGDVDTLRELLKHG  645

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA-----------VKLNLAPLDL  607
            L VDS+D  G+TA++AA+ E  AD  + LV++GA +D A            +  ++P +L
Sbjct  646  LAVDSEDHDGATALRAALAEGHADAARFLVLSGASVDKANLDGSGSGSFPRQTTVSPDEL  705

Query  606  TEVLQKRELGHRIAMPNT-------ILHEAASKWAKDDHQNSSSMP--QQCSIRVSIYRG  454
             E++QKREL H +++ ++       ++ E  S   +   +  S+      C  RVSIY+G
Sbjct  706  RELMQKRELAHAVSIVDSTSPAAAAVVREIGSPADRRKARAPSTRSDGDHCP-RVSIYKG  764

Query  453  HPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDN  274
            HP  R  +   E G+LI LP T+    +I  EKL  DA  + + ++EGA IDSIDVIRDN
Sbjct  765  HPFVRNPSS--EAGKLINLPGTMEAFKAIIEEKLKVDAKKTLIMNDEGAEIDSIDVIRDN  822

Query  273  DKLFIVAD  250
            DKLFIV +
Sbjct  823  DKLFIVTE  830



>ref|XP_006413681.1| hypothetical protein EUTSA_v10024449mg [Eutrema salsugineum]
 gb|ESQ55134.1| hypothetical protein EUTSA_v10024449mg [Eutrema salsugineum]
Length=796

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 143/228 (63%), Gaps = 34/228 (15%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI+ K ++IF ILYH+A+ISDP++AGDLLC A K N+  VM++LLK G
Sbjct  600  IRDVSGNTALWEAISTKHYAIFRILYHFAAISDPHIAGDLLCSAVKQNNVEVMKDLLKQG  659

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            + VD++D HG TA+Q AM EN+ DM+ LL MNGA++     + + PL+   V        
Sbjct  660  ISVDTEDHHGFTALQVAMAENRMDMVNLLTMNGADV-----VGVRPLENLRV--------  706

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                                   +    ++   RV IYRGHP  RRE  C E G+LI LP
Sbjct  707  ---------------------VENGKEEEEERKRVGIYRGHPLERRERSCIEAGKLILLP  745

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +L  IAG+K GFD +++ +T+E+G  IDSI+VIRDNDKL+ V D
Sbjct  746  PSLDDLKKIAGKKFGFDGSETMVTNEDGEEIDSIEVIRDNDKLYFVED  793



>gb|EAY98139.1| hypothetical protein OsI_20054 [Oryza sativa Indica Group]
Length=855

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 156/245 (64%), Gaps = 19/245 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY-VAGDLLCKAAKMNDSSVMQELLKH  757
            +KD +GNTALW+AIAA+ H IF+ILYH+A +S P+  AGDLLC AA+  D   ++ELLKH
Sbjct  598  IKDAQGNTALWNAIAARHHKIFNILYHFARVSSPHHAAGDLLCLAARRGDLDTLRELLKH  657

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN-------LAPLDLTEV  598
            GL VDS+DR G+TA++ A+ E  AD+ +LLV+NGA +D A   N       ++  +L E+
Sbjct  658  GLAVDSEDRDGATALRVALAEGHADVARLLVLNGASVDRAASHNEQQAAAAVSVDELREL  717

Query  597  LQKRELGHRIAM----PN----TILHEAASKW-AKDDHQNSSSMPQQCSIRVSIYRGHPA  445
            ++ REL H + +    P+     ++ E  S   +++  + S+        RVSIYRGHP 
Sbjct  718  MKTRELAHPVTIVVDSPSPAAAAVIREVGSSGDSRNGRRQSARSDGAHWPRVSIYRGHPF  777

Query  444  TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  265
             R  +   E G+LI LP T+ E   I  EKL  DA  + + ++EGA IDSIDVIRDNDKL
Sbjct  778  VRNRSS--EAGKLINLPGTMEEFRIIIEEKLKVDARKTLIMNDEGAEIDSIDVIRDNDKL  835

Query  264  FIVAD  250
            FIV +
Sbjct  836  FIVTE  840



>sp|Q75HP9.1|AKT2_ORYSJ RecName: Full=Potassium channel AKT2 [Oryza sativa Japonica Group]
 gb|AAS90668.1| putative potassium channel protein [Oryza sativa Japonica Group]
 gb|EEE63802.1| hypothetical protein OsJ_18626 [Oryza sativa Japonica Group]
 gb|AFC96958.1| AKT2/3-like potassium channel [Oryza sativa Japonica Group]
Length=855

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 156/245 (64%), Gaps = 19/245 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPY-VAGDLLCKAAKMNDSSVMQELLKH  757
            +KD +GNTALW+AIAA+ H IF+ILYH+A +S P+  AGDLLC AA+  D   ++ELLKH
Sbjct  598  IKDAQGNTALWNAIAARHHKIFNILYHFARVSSPHHAAGDLLCLAARRGDLDTLRELLKH  657

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN-------LAPLDLTEV  598
            GL VDS+DR G+TA++ A+ E  AD+ +LLV+NGA +D A   N       ++  +L E+
Sbjct  658  GLAVDSEDRDGATALRVALAEGHADVARLLVLNGASVDRAASHNEQQAAAAVSVDELREL  717

Query  597  LQKRELGHRIAM----PN----TILHEAASKW-AKDDHQNSSSMPQQCSIRVSIYRGHPA  445
            ++ REL H + +    P+     ++ E  S   +++  + S+        RVSIYRGHP 
Sbjct  718  MKTRELAHPVTIVVDSPSPAAAAVIREVGSSGDSRNGRRQSARSDGAHWPRVSIYRGHPF  777

Query  444  TRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKL  265
             R  +   E G+LI LP T+ E   I  EKL  DA  + + ++EGA IDSIDVIRDNDKL
Sbjct  778  VRNRSS--EAGKLINLPGTMEEFRIIIEEKLKVDARKTLIMNDEGAEIDSIDVIRDNDKL  835

Query  264  FIVAD  250
            FIV +
Sbjct  836  FIVTE  840



>emb|CDX82921.1| BnaC01g13710D [Brassica napus]
Length=862

 Score =   193 bits (491),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 142/226 (63%), Gaps = 38/226 (17%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI+ K HSIF ILYH+A+ISDP+VAGDLLC+A + N+  V+++LLK G
Sbjct  670  IRDVTGNTALWEAISKKHHSIFRILYHFAAISDPHVAGDLLCEAVRQNNVEVIEDLLKQG  729

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++VD+KD HG TA++ AM +NQ D++ LL MNGA   D V   L  L+   V++K +   
Sbjct  730  INVDTKDHHGFTALKVAMSQNQMDLVNLLNMNGA---DMVTNELTSLEKLRVVEKEKE--  784

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                                             RVSI+RGHP  R+E    E G LI LP
Sbjct  785  ---------------------------------RVSIFRGHPLERKERSSYEAGMLILLP  811

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             ++ +L  IA EKLGF+ ++  +T+E+GA IDSI+VIRDNDKL+ V
Sbjct  812  PSLDDLKKIAEEKLGFNGSEMMVTNEDGAEIDSIEVIRDNDKLYFV  857



>ref|XP_002867783.1| hypothetical protein ARALYDRAFT_492645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44042.1| hypothetical protein ARALYDRAFT_492645 [Arabidopsis lyrata subsp. 
lyrata]
Length=801

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 145/233 (62%), Gaps = 41/233 (18%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI++K ++IF ILYH+A+ISDP++AGDLLC+A K N+  VM+ LLK G
Sbjct  602  IRDVNGNTALWEAISSKHYAIFRILYHFAAISDPHIAGDLLCEAVKQNNVEVMKALLKQG  661

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN----LAPLDLTEVLQKR  586
            L+VD++D  G TA+Q A+ E+Q DM+ LL MNGA   D V +N      PL+        
Sbjct  662  LNVDTEDHQGVTALQVALAEDQMDMVNLLAMNGA---DVVGVNTHDEFTPLE--------  710

Query  585  ELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRL  406
                                     +      ++   RVSIYRGHP  RRE  C E G+L
Sbjct  711  -------------------------KLRVVEEEEERGRVSIYRGHPLERRERGCNEAGKL  745

Query  405  IKLPETIAELISIAGEKLGFDATDSSL-TDEEGAIIDSIDVIRDNDKLFIVAD  250
            I LP ++ +L  IAGEK GFD +D ++ T+E+GA IDSI+VIRDNDKL+ V +
Sbjct  746  ILLPPSLDDLKKIAGEKYGFDGSDETMVTNEDGAEIDSIEVIRDNDKLYFVEN  798



>gb|ABE99811.1| inwardly rectifying potassium channel AKT2 [Hordeum vulgare]
 dbj|BAJ86010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 146/242 (60%), Gaps = 18/242 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTALW AIAA+ H +FS LYH A  ++P   GDLLC AA+  D   ++ELLKHG
Sbjct  587  IKDAQGNTALWQAIAARHHKVFSNLYHAARATNPRAGGDLLCLAARRGDLDTLRELLKHG  646

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA---------VKLNLAPLDLTE  601
            L VDS+   G+TA++ A+ E QAD+ + LVMNGA +D A          +  L   +L E
Sbjct  647  LDVDSEGHDGATALRVALSEGQADVARFLVMNGASVDKAGLDDDGSAPQQTTLPAAELRE  706

Query  600  VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-------RVSIYRGHPAT  442
            ++++RE+GH I + +     A    + +  Q    +P            RVSIY+GHP  
Sbjct  707  LVKRREVGHPITIYDYDSPPAVCSSSGELRQGRFPIPGSARSSDSAHWPRVSIYKGHPFV  766

Query  441  RRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  262
            R  T   E G+L+ LP T+ EL ++ GEKL  D  ++ + + EGA IDS+DVIRDNDKLF
Sbjct  767  R--THSSEAGKLVNLPATMEELKTVIGEKLKVDPEEALVVNHEGAEIDSVDVIRDNDKLF  824

Query  261  IV  256
            IV
Sbjct  825  IV  826



>dbj|BAJ96949.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 146/242 (60%), Gaps = 18/242 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTALW AIAA+ H +FS LYH A  ++P   GDLLC AA+  D   ++ELLKHG
Sbjct  587  IKDAQGNTALWQAIAARHHKVFSNLYHAARATNPRAGGDLLCLAARRGDLDTLRELLKHG  646

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA---------VKLNLAPLDLTE  601
            L VDS+   G+TA++ A+ E QAD+ + LVMNGA +D A          +  L   +L E
Sbjct  647  LDVDSEGHDGATALRVALSEGQADVARFLVMNGASVDKAGLDDDGSAPQQTTLPAAELRE  706

Query  600  VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-------RVSIYRGHPAT  442
            ++++RE+GH I + +     A    + +  Q    +P            RVSIY+GHP  
Sbjct  707  LVKRREVGHPITIYDYDSPPAVCSSSGELRQGRFPIPGSARSSDSAHWPRVSIYKGHPFV  766

Query  441  RRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  262
            R  T   E G+L+ LP T+ EL ++ GEKL  D  ++ + + EGA IDS+DVIRDNDKLF
Sbjct  767  R--THSSEAGKLVNLPATMEELKTVIGEKLKVDPEEALVVNHEGAEIDSVDVIRDNDKLF  824

Query  261  IV  256
            IV
Sbjct  825  IV  826



>dbj|BAJ86681.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 146/242 (60%), Gaps = 18/242 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTALW AIAA+ H +FS LYH A  ++P   GDLLC AA+  D   ++ELLKHG
Sbjct  587  IKDAQGNTALWQAIAARHHKVFSNLYHAARATNPRAGGDLLCLAARRGDLDTLRELLKHG  646

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA---------VKLNLAPLDLTE  601
            L VDS+   G+TA++ A+ E QAD+ + LVMNGA +D A          +  L   +L E
Sbjct  647  LDVDSEGHDGATALRVALSEGQADVARFLVMNGASVDKAGLDDDGSAPQQTTLPAAELRE  706

Query  600  VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-------RVSIYRGHPAT  442
            ++++RE+GH I + +     A    + +  Q    +P            RVSIY+GHP  
Sbjct  707  LVKRREVGHPITIYDYDSPPAVCSSSGELRQGRFPIPGSARSSDSAHWPRVSIYKGHPFV  766

Query  441  RRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  262
            R  T   E G+L+ LP T+ EL ++ GEKL  D  ++ + + EGA IDS+DVIRDNDKLF
Sbjct  767  R--THSSEAGKLVNLPATMEELKTVIGEKLKVDPEEALVVNHEGAEIDSVDVIRDNDKLF  824

Query  261  IV  256
            IV
Sbjct  825  IV  826



>ref|XP_009135705.1| PREDICTED: potassium channel AKT2/3 [Brassica rapa]
Length=788

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 140/226 (62%), Gaps = 38/226 (17%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI+ K HSIF ILYH+A+ISDP+VAGDLLC+A + N+  V+++LL  G
Sbjct  596  IRDVSGNTALWEAISKKHHSIFRILYHFAAISDPHVAGDLLCEAVRQNNVEVIKDLLNQG  655

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++VD+KD HG TA++ A+ ENQ DM+ LL  NGA   D V   L  L+   V++K +   
Sbjct  656  INVDTKDHHGFTALKVALSENQMDMVNLLNTNGA---DMVTNELTSLEKLSVVEKEKE--  710

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                                             RVSI+RGHP  R+E    E G LI LP
Sbjct  711  ---------------------------------RVSIFRGHPLERKERSSYEAGMLILLP  737

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             ++ +L  IA EKLGFD ++  +T+E+GA IDSI+VIRDNDKL+ V
Sbjct  738  PSLDDLKKIAEEKLGFDGSEMMVTNEDGAEIDSIEVIRDNDKLYFV  783



>emb|CDX79135.1| BnaA01g12020D [Brassica napus]
Length=788

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 140/226 (62%), Gaps = 38/226 (17%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+ GNTALW+AI+ K HSIF ILYH+A+ISDP+VAGDLLC+A + N+  V+++LL  G
Sbjct  596  IRDVSGNTALWEAISKKHHSIFRILYHFAAISDPHVAGDLLCEAVRQNNVEVIKDLLNQG  655

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++VD+KD HG TA++ A+ ENQ DM+ LL  NGA   D V   L  L+   V++K +   
Sbjct  656  INVDTKDHHGFTALKVALSENQMDMVNLLNTNGA---DMVTNELTSLEKLSVVEKEKE--  710

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                                             RVSI+RGHP  R+E    E G LI LP
Sbjct  711  ---------------------------------RVSIFRGHPLERKERSSYEAGMLILLP  737

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             ++ +L  IA EKLGFD ++  +T+E+GA IDSI+VIRDNDKL+ V
Sbjct  738  PSLDDLKKIAEEKLGFDGSEMMVTNEDGAEIDSIEVIRDNDKLYFV  783



>ref|XP_009405920.1| PREDICTED: potassium channel AKT2 [Musa acuminata subsp. malaccensis]
Length=821

 Score =   187 bits (475),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 148/235 (63%), Gaps = 11/235 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LWDAIAAK H IF++L+  A IS+P  +GDLLC AAK ND S M+ELLKHG
Sbjct  580  IQDMDGNTPLWDAIAAKHHKIFNLLHQCACISNPNTSGDLLCLAAKRNDLSTMKELLKHG  639

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLN------LAPLDLTEVLQ  592
            L++DS++  G TA+Q A+ EN  DM+  LV+NGA I+ A  LN      +    L E+ Q
Sbjct  640  LNIDSENHEGLTALQIALAENYEDMVAFLVLNGASIEKA-NLNGRGARKIRNGVLKEMDQ  698

Query  591  KRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQ-CSIRVSIYRGHPATRRETQCPEP  415
            +R+ G    +P +   +       +  +NS  +       R+S+Y+GHP  R    C   
Sbjct  699  QRDAGCVNTLPESN-GQFTQTLVLEKQENSFKLETNGYPPRISVYKGHPLLR--NNCSGS  755

Query  414  GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            G+L+ LP T+ EL +I G K   DA +  LT+E+GA ++SI+V+RDNDKLF+V D
Sbjct  756  GKLMCLPSTMEELKTIIGNKFEIDARNRILTNEDGAEVESIEVLRDNDKLFVVED  810



>ref|XP_010930758.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2-like [Elaeis 
guineensis]
Length=834

 Score =   187 bits (475),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 153/240 (64%), Gaps = 21/240 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LW AI AK H IF++LY  A IS+P + G+LLC AAK ND S ++ELLKH 
Sbjct  598  IQDMDGNTPLWIAITAKHHKIFNLLYRCACISNPNIGGNLLCLAAKRNDLSTVKELLKHS  657

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA---------VKLNLAPLDLTE  601
            L++DS++  G TA+Q A+ EN  ++I+ LVMNGA I+ A         +K +L    L E
Sbjct  658  LNMDSENHEGLTALQVALAENHEEIIRFLVMNGANIEKAGLSGRNXRKMKHHL----LEE  713

Query  600  VLQKRELGHRIA---MPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRET  430
            ++ KRE+G+ I    +P+       S   +  H  +      C  RVS+Y+GHP  R  +
Sbjct  714  MVHKREVGYPITVLELPSETKQIKVS--GEQGHMLNWERIGHCP-RVSVYKGHPLLRIPS  770

Query  429  QCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
               E G+LI LP T+ EL +I G++LG DA++ ++T+ +GA IDSI+V+R NDKLFIV D
Sbjct  771  S--EAGKLISLPSTMKELKNIIGKRLGIDASNRTVTNADGAEIDSIEVLRHNDKLFIVED  828



>gb|ERN20685.1| hypothetical protein AMTR_s00070p00197870 [Amborella trichopoda]
Length=814

 Score =   185 bits (469),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 149/242 (62%), Gaps = 31/242 (13%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT LW+AI++K HSIF +LY++ASI++P   GDLLC AAK N+  V+QELLK G+ 
Sbjct  580  DDSGNTPLWEAISSKNHSIFRLLYNYASITNPDCGGDLLCLAAKRNNLIVLQELLKQGIS  639

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID---------------DAVKLNLAPL  613
            ++S  R GST +  A+ E   DM+  LV NGA+I+               D  +L  + L
Sbjct  640  INSTSRCGSTPLHIAITEKHIDMVSFLVTNGADINKTDLKGQTVREMVAEDPEQLPCSVL  699

Query  612  DLTEVLQKRELGHRIAMPNTILHEAASKWAKDDH---QNSSSMPQQCSIRVSIYRGHPAT  442
            +  E+LQ + L HRI    T+  E + +  + +H     +  +P     RVSIY+GHP  
Sbjct  700  E--EMLQSQGLDHRI----TVFEEPSERPTRREHLIIGRNGFLP-----RVSIYKGHPWE  748

Query  441  RRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  262
            R    C E G+L+ LP T+A L +IAG+K G +A++  +T+EEGA ID I+VIRDND+LF
Sbjct  749  RE--ICSESGKLVPLPSTLAGLKNIAGKKFGLNASNMIITNEEGAEIDCIEVIRDNDRLF  806

Query  261  IV  256
            +V
Sbjct  807  LV  808



>ref|XP_006859218.2| PREDICTED: potassium channel AKT2/3 [Amborella trichopoda]
Length=852

 Score =   185 bits (469),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 149/242 (62%), Gaps = 31/242 (13%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT LW+AI++K HSIF +LY++ASI++P   GDLLC AAK N+  V+QELLK G+ 
Sbjct  618  DDSGNTPLWEAISSKNHSIFRLLYNYASITNPDCGGDLLCLAAKRNNLIVLQELLKQGIS  677

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID---------------DAVKLNLAPL  613
            ++S  R GST +  A+ E   DM+  LV NGA+I+               D  +L  + L
Sbjct  678  INSTSRCGSTPLHIAITEKHIDMVSFLVTNGADINKTDLKGQTVREMVAEDPEQLPCSVL  737

Query  612  DLTEVLQKRELGHRIAMPNTILHEAASKWAKDDH---QNSSSMPQQCSIRVSIYRGHPAT  442
            +  E+LQ + L HRI    T+  E + +  + +H     +  +P     RVSIY+GHP  
Sbjct  738  E--EMLQSQGLDHRI----TVFEEPSERPTRREHLIIGRNGFLP-----RVSIYKGHPWE  786

Query  441  RRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLF  262
            R    C E G+L+ LP T+A L +IAG+K G +A++  +T+EEGA ID I+VIRDND+LF
Sbjct  787  RE--ICSESGKLVPLPSTLAGLKNIAGKKFGLNASNMIITNEEGAEIDCIEVIRDNDRLF  844

Query  261  IV  256
            +V
Sbjct  845  LV  846



>ref|XP_009403705.1| PREDICTED: potassium channel AKT2-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=683

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 148/237 (62%), Gaps = 15/237 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LWDAI  K H+IF+IL+  A +S+PY + DLLC A+K ND S M+ELL HG
Sbjct  443  IQDMDGNTPLWDAITGKHHNIFNILHRCACVSNPYTSADLLCLASKRNDLSTMRELLNHG  502

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI-----DDAVKLNLAPLDLTEVLQK  589
            L++DS++  G TA+Q A  EN  +M+  LVMNGA I     + +++  +    L E++Q+
Sbjct  503  LNIDSENHEGLTALQIASAENHEEMVTFLVMNGASIVKSNPNGSIERWMKKEILEEMIQQ  562

Query  588  RELGHRIAMPNTILH-EAASKWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCP  421
            R++G+    P   L    A K  +   +  +S+  + +    R+S++ GHP  R      
Sbjct  563  RDVGY----PTMALEPYGAFKKTEVLREQDNSLKLEANEHRPRISVFNGHPLLRNSHS--  616

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            E G+LI LP T+ EL +I G+K   DA    LT+E+ A +DSIDV+RDNDKLFIV +
Sbjct  617  ETGKLISLPSTMEELRTIIGKKFEVDARYKILTNEDAAEVDSIDVLRDNDKLFIVGE  673



>ref|XP_009403704.1| PREDICTED: potassium channel AKT2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 148/237 (62%), Gaps = 15/237 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LWDAI  K H+IF+IL+  A +S+PY + DLLC A+K ND S M+ELL HG
Sbjct  540  IQDMDGNTPLWDAITGKHHNIFNILHRCACVSNPYTSADLLCLASKRNDLSTMRELLNHG  599

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI-----DDAVKLNLAPLDLTEVLQK  589
            L++DS++  G TA+Q A  EN  +M+  LVMNGA I     + +++  +    L E++Q+
Sbjct  600  LNIDSENHEGLTALQIASAENHEEMVTFLVMNGASIVKSNPNGSIERWMKKEILEEMIQQ  659

Query  588  RELGHRIAMPNTILH-EAASKWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCP  421
            R++G+    P   L    A K  +   +  +S+  + +    R+S++ GHP  R      
Sbjct  660  RDVGY----PTMALEPYGAFKKTEVLREQDNSLKLEANEHRPRISVFNGHPLLRNSHS--  713

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            E G+LI LP T+ EL +I G+K   DA    LT+E+ A +DSIDV+RDNDKLFIV +
Sbjct  714  ETGKLISLPSTMEELRTIIGKKFEVDARYKILTNEDAAEVDSIDVLRDNDKLFIVGE  770



>ref|XP_009403703.1| PREDICTED: potassium channel AKT2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score =   180 bits (456),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 148/237 (62%), Gaps = 15/237 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LWDAI  K H+IF+IL+  A +S+PY + DLLC A+K ND S M+ELL HG
Sbjct  596  IQDMDGNTPLWDAITGKHHNIFNILHRCACVSNPYTSADLLCLASKRNDLSTMRELLNHG  655

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI-----DDAVKLNLAPLDLTEVLQK  589
            L++DS++  G TA+Q A  EN  +M+  LVMNGA I     + +++  +    L E++Q+
Sbjct  656  LNIDSENHEGLTALQIASAENHEEMVTFLVMNGASIVKSNPNGSIERWMKKEILEEMIQQ  715

Query  588  RELGHRIAMPNTILH-EAASKWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCP  421
            R++G+    P   L    A K  +   +  +S+  + +    R+S++ GHP  R      
Sbjct  716  RDVGY----PTMALEPYGAFKKTEVLREQDNSLKLEANEHRPRISVFNGHPLLRNSHS--  769

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            E G+LI LP T+ EL +I G+K   DA    LT+E+ A +DSIDV+RDNDKLFIV +
Sbjct  770  ETGKLISLPSTMEELRTIIGKKFEVDARYKILTNEDAAEVDSIDVLRDNDKLFIVGE  826



>ref|XP_009403698.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403699.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403700.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403701.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403702.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score =   180 bits (456),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 148/237 (62%), Gaps = 15/237 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++DM+GNT LWDAI  K H+IF+IL+  A +S+PY + DLLC A+K ND S M+ELL HG
Sbjct  623  IQDMDGNTPLWDAITGKHHNIFNILHRCACVSNPYTSADLLCLASKRNDLSTMRELLNHG  682

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI-----DDAVKLNLAPLDLTEVLQK  589
            L++DS++  G TA+Q A  EN  +M+  LVMNGA I     + +++  +    L E++Q+
Sbjct  683  LNIDSENHEGLTALQIASAENHEEMVTFLVMNGASIVKSNPNGSIERWMKKEILEEMIQQ  742

Query  588  RELGHRIAMPNTILH-EAASKWAKDDHQNSSSMPQQCS---IRVSIYRGHPATRRETQCP  421
            R++G+    P   L    A K  +   +  +S+  + +    R+S++ GHP  R      
Sbjct  743  RDVGY----PTMALEPYGAFKKTEVLREQDNSLKLEANEHRPRISVFNGHPLLRNSHS--  796

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            E G+LI LP T+ EL +I G+K   DA    LT+E+ A +DSIDV+RDNDKLFIV +
Sbjct  797  ETGKLISLPSTMEELRTIIGKKFEVDARYKILTNEDAAEVDSIDVLRDNDKLFIVGE  853



>ref|XP_008781668.1| PREDICTED: potassium channel AKT2-like [Phoenix dactylifera]
Length=734

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 151/267 (57%), Gaps = 46/267 (17%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D++GNT LW AI AK H IF++LY  A IS+P + G+LLC AAK ND S ++ELLKHG
Sbjct  464  IQDVDGNTPLWIAITAKHHKIFNLLYPCACISNPNIGGNLLCLAAKRNDLSTVKELLKHG  523

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD---LTEVLQKRE  583
            L+++S +  G TA+Q A+ EN  ++I+ LVMNGA ++ A     + +    L E++ +RE
Sbjct  524  LNIESGNHEGLTALQVALAENHEEIIRFLVMNGANVEKADPRGQSKMKHHLLEEMVHQRE  583

Query  582  LGHRIAMPNTILH-----EAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPE  418
            +G+    P T+L      E      +  H  +      C  RVS+Y+GHP  R  +   E
Sbjct  584  VGY----PITVLESPSESEQIKVSGEQGHMLNWERIGHCP-RVSVYKGHPLLRIPSS--E  636

Query  417  PGRLIKLPETIAELISI-------------------------------AGEKLGFDATDS  331
             G+LI LP T+ EL +I                                G +LG DA++ 
Sbjct  637  AGKLISLPNTMKELKNIIGMHLYLYLYNVVPIYCKIQKFYENQVSYLLTGGRLGIDASNR  696

Query  330  SLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++T+ +GA IDS++V+RDNDKLFIV D
Sbjct  697  TVTNADGAEIDSMEVLRDNDKLFIVED  723



>ref|XP_010681787.1| PREDICTED: potassium channel AKT2/3 isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=704

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 132/226 (58%), Gaps = 20/226 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+  NTALWDAI+AK ++IF +LY++ +I DP++AGDLL  A K ND +V+++LLK G
Sbjct  495  LRDLNDNTALWDAISAKHYNIFHLLYNYTTIQDPHIAGDLLTTATKRNDIAVIKDLLKCG  554

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDS + HG TA+Q A+  N  ++  LL+  GA+  D              L    +  
Sbjct  555  LDVDSTNLHGLTALQVALTTNHVEIATLLIAYGAKTGD--------------LNGNTISS  600

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
              A  N    +   K   D     S     C+ R+++++G+P +         GRLI+LP
Sbjct  601  IFAARNQHFVQVNKKRGND-----SKFEPSCA-RINLFKGYPTSSNTFDKNSTGRLIRLP  654

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +  EL  IAGEK   +AT+ ++ +EEGA +DSI VIRDNDKL++V
Sbjct  655  SSFEELQVIAGEKFKVNATNLTIVNEEGAEVDSIQVIRDNDKLYVV  700



>ref|XP_010681786.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=730

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 132/226 (58%), Gaps = 20/226 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+  NTALWDAI+AK ++IF +LY++ +I DP++AGDLL  A K ND +V+++LLK G
Sbjct  521  LRDLNDNTALWDAISAKHYNIFHLLYNYTTIQDPHIAGDLLTTATKRNDIAVIKDLLKCG  580

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDS + HG TA+Q A+  N  ++  LL+  GA+  D              L    +  
Sbjct  581  LDVDSTNLHGLTALQVALTTNHVEIATLLIAYGAKTGD--------------LNGNTISS  626

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
              A  N    +   K       N S     C+ R+++++G+P +         GRLI+LP
Sbjct  627  IFAARNQHFVQVNKK-----RGNDSKFEPSCA-RINLFKGYPTSSNTFDKNSTGRLIRLP  680

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +  EL  IAGEK   +AT+ ++ +EEGA +DSI VIRDNDKL++V
Sbjct  681  SSFEELQVIAGEKFKVNATNLTIVNEEGAEVDSIQVIRDNDKLYVV  726



>ref|XP_010681785.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=737

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 132/226 (58%), Gaps = 20/226 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+  NTALWDAI+AK ++IF +LY++ +I DP++AGDLL  A K ND +V+++LLK G
Sbjct  528  LRDLNDNTALWDAISAKHYNIFHLLYNYTTIQDPHIAGDLLTTATKRNDIAVIKDLLKCG  587

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDS + HG TA+Q A+  N  ++  LL+  GA+  D              L    +  
Sbjct  588  LDVDSTNLHGLTALQVALTTNHVEIATLLIAYGAKTGD--------------LNGNTISS  633

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
              A  N    +   K   D     S     C+ R+++++G+P +         GRLI+LP
Sbjct  634  IFAARNQHFVQVNKKRGND-----SKFEPSCA-RINLFKGYPTSSNTFDKNSTGRLIRLP  687

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +  EL  IAGEK   +AT+ ++ +EEGA +DSI VIRDNDKL++V
Sbjct  688  SSFEELQVIAGEKFKVNATNLTIVNEEGAEVDSIQVIRDNDKLYVV  733



>ref|XP_010681784.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=810

 Score =   166 bits (421),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 132/226 (58%), Gaps = 20/226 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+  NTALWDAI+AK ++IF +LY++ +I DP++AGDLL  A K ND +V+++LLK G
Sbjct  601  LRDLNDNTALWDAISAKHYNIFHLLYNYTTIQDPHIAGDLLTTATKRNDIAVIKDLLKCG  660

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L VDS + HG TA+Q A+  N  ++  LL+  GA+  D              L    +  
Sbjct  661  LDVDSTNLHGLTALQVALTTNHVEIATLLIAYGAKTGD--------------LNGNTISS  706

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
              A  N    +   K       N S     C+ R+++++G+P +         GRLI+LP
Sbjct  707  IFAARNQHFVQVNKK-----RGNDSKFEPSCA-RINLFKGYPTSSNTFDKNSTGRLIRLP  760

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +  EL  IAGEK   +AT+ ++ +EEGA +DSI VIRDNDKL++V
Sbjct  761  SSFEELQVIAGEKFKVNATNLTIVNEEGAEVDSIQVIRDNDKLYVV  806



>ref|XP_010529461.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2/3-like 
[Tarenaya hassleriana]
Length=786

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/230 (39%), Positives = 133/230 (58%), Gaps = 43/230 (19%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D++GNTALW+AI +  H+ F ILY +A+ISDP+ AGDLLC A++ N+  VM++LL+ G
Sbjct  599  VRDVKGNTALWEAITSGNHATFRILYRFAAISDPHTAGDLLCTASRQNNVHVMKDLLQLG  658

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            L + SKD++G T +Q A+ EN  D++ LLV                     V  +R L  
Sbjct  659  LDIYSKDQNGLTPLQVALAENHIDIVNLLV--------------------NVPNRRRL--  696

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
                              +D +N         +RVSIYRG P  RR  +  E G+LI LP
Sbjct  697  -------------MVGGGEDSKN--------RVRVSIYRGDPLERRGKRLREAGKLILLP  735

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
             ++ +L  IAGEK G+DA+ + +  E GA +DS++VIRDNDK++ V ++N
Sbjct  736  TSLDKLKEIAGEKFGYDASGTVVRAEAGAEVDSVEVIRDNDKIYFVEEFN  785



>ref|XP_007148521.1| hypothetical protein PHAVU_006G215800g [Phaseolus vulgaris]
 gb|ESW20515.1| hypothetical protein PHAVU_006G215800g [Phaseolus vulgaris]
Length=192

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 123/186 (66%), Gaps = 10/186 (5%)
 Frame = -3

Query  915  NTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSK  736
            N+ALWDAIA+K ++IF I++  A + +  +AG+LLC+AAK N+ +VM++L+K GL+V+S+
Sbjct  16   NSALWDAIASKHYTIFRIIFQHAVLRNQNMAGELLCRAAKKNELTVMKDLIKQGLNVNSR  75

Query  735  DRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI-AMP  559
            D   +TAIQ A+ E   +M+  LVMNGA++ D   +      + ++LQKR++GH I  MP
Sbjct  76   DGRNATAIQVAITEGHVEMVWFLVMNGADVSDCSSI------INQMLQKRKIGHLIEFMP  129

Query  558  NTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPETIAE  379
              I+ +   ++ ++ H       +  + RV+IYRGHP+ R+E    +  ++I+LP++  +
Sbjct  130  GEIILKG--RYQEEKHI-GRRYNRPITPRVTIYRGHPSLRKEKSVTQASKVIRLPDSFDQ  186

Query  378  LISIAG  361
            L +IAG
Sbjct  187  LKTIAG  192



>ref|XP_003568398.1| PREDICTED: potassium channel AKT2 [Brachypodium distachyon]
 ref|XP_010231341.1| PREDICTED: potassium channel AKT2 [Brachypodium distachyon]
Length=858

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/253 (40%), Positives = 138/253 (55%), Gaps = 29/253 (11%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD +GNTALW AIAA+ H +FS+LY  A  + P+  GDLLC AA+  D   + ELLKHG
Sbjct  590  IKDAQGNTALWQAIAARHHKVFSVLYSVARATCPHAGGDLLCLAARRGDVDTLAELLKHG  649

Query  753  LHVDSKDRHGSTAIQAAMEENQ------ADMIKLLVMNGAEIDDA-VKLNLAPLDLTEVL  595
            L VD+    G+TA++ A+  +       AD+ + LVMNGA +D A V  +      T VL
Sbjct  650  LDVDAAGHDGATALRVALSSSSQGGRRAADVARFLVMNGASVDKARVHEDDGATRPTTVL  709

Query  594  -----QKRELGHRIAMPNTILHEAA-----------SKWAKDDHQNSSSMPQQCSI----  475
                 ++ E    +  P TI    A           S  + D  Q   S  +        
Sbjct  710  PLEELRELEKRREVVHPITIYDSPAADVVARVVGGGSNPSGDGRQGRFSSTRSSDSGHWP  769

Query  474  RVSIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDS  295
            RVS+YRGHP  R      E G+LI LP T+AEL ++  +K   DA  + + ++EGA I+S
Sbjct  770  RVSVYRGHPFVRNHGS--EAGKLINLPSTMAELKAVIEKKFKVDAEKALVVNDEGAEIES  827

Query  294  IDVIRDNDKLFIV  256
            +DVIRDND+LFIV
Sbjct  828  VDVIRDNDRLFIV  840



>ref|XP_010681788.1| PREDICTED: potassium channel AKT2/3 isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=701

 Score =   106 bits (265),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L+D+  NTALWDAI+AK ++IF +LY++ +I DP++AGDLL  A K ND +V+++LLK G
Sbjct  601  LRDLNDNTALWDAISAKHYNIFHLLYNYTTIQDPHIAGDLLTTATKRNDIAVIKDLLKCG  660

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD  640
            L VDS + HG TA+Q A+  N  ++  LL+  GA+  D
Sbjct  661  LDVDSTNLHGLTALQVALTTNHVEIATLLIAYGAKTGD  698


 Score = 26.2 bits (56),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 0/12 (0%)
 Frame = -1

Query  974  ECVXVLLKHGCN  939
            ECV +LL HGCN
Sbjct  587  ECVILLLNHGCN  598



>ref|XP_004146262.1| PREDICTED: potassium channel AKT2/3 [Cucumis sativus]
 gb|KGN57590.1| hypothetical protein Csa_3G221730 [Cucumis sativus]
Length=636

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = -3

Query  600  VLQKRELGHRIAMPNTILHEAASKWA-KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQC  424
             LQ+REL H+I +  +   E  +    KD   N     +    RV+IY+GHP  R++  C
Sbjct  521  FLQERELSHKITIEGSPEKEVPTLIEEKDQSFNWKHSIELDFARVNIYKGHPVARKQASC  580

Query  423  PEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
             +PG+LI+LP ++ EL  +AGEK GFDA ++ LT+EEG+ IDSIDVIRDNDK++ 
Sbjct  581  DDPGKLIRLPHSMEELKKLAGEKFGFDARNAVLTNEEGSEIDSIDVIRDNDKIYF  635



>ref|XP_008456068.1| PREDICTED: potassium channel AKT2/3 [Cucumis melo]
Length=634

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -3

Query  597  LQKRELGHRIAMPNTILHEAASKWA-KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  421
            LQ+REL H+I +  +   E  +    KD   N     +    RV+IY+GHP  R++  C 
Sbjct  520  LQERELSHKITIEGSPEKEVPTLIEEKDQSFNWKHSIELDFARVNIYKGHPVARKQASCD  579

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            +PG+LI+LP ++ EL  +AGEK GFDA ++ LT+EEG+ IDSIDVIRDNDK++ 
Sbjct  580  DPGKLIRLPHSMEELKKLAGEKFGFDARNAVLTNEEGSEIDSIDVIRDNDKIYF  633



>gb|EMT08371.1| hypothetical protein F775_52637 [Aegilops tauschii]
Length=887

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  939  HXLKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLK  760
            H   + +GNTALW AIAA+ H +FS LYH A +S+P  AGDLLC AA+      ++ELLK
Sbjct  698  HQRYNAQGNTALWQAIAARHHKVFSNLYHVARVSNPRAAGDLLCLAARRRGLDTLRELLK  757

Query  759  HGLHVDSKDRHGSTAIQAAMEENQAD  682
             GL VD++D  GSTA++ A+ E QAD
Sbjct  758  QGLDVDTEDHDGSTALRVALSEGQAD  783


 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = -3

Query  468  SIYRGHPATRRETQCPEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSID  289
            SIY+GHP  R  +   E G+LI LP T+ E  +I GEKL  D   + + + EGA IDS+D
Sbjct  786  SIYKGHPFVRNHSS--EAGKLINLPATMEEFKTIIGEKLKVDTEKALILNGEGAEIDSLD  843

Query  288  VIRDNDKLFIVAD  250
            VIRDNDKLFIV +
Sbjct  844  VIRDNDKLFIVTE  856



>ref|XP_009378951.1| PREDICTED: potassium channel SKOR-like isoform X1 [Pyrus x bretschneideri]
Length=840

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 118/239 (49%), Gaps = 28/239 (12%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  615  IKDNFGNTPLLEAIKNGNDRVSSLLIQEGASLNIENAGSFICTSIARGDADLLKRLLANG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD---------LTE  601
            +  +SKD    T +  A  E    M KLL+ +GA +    +    PLD         L +
Sbjct  675  VDPNSKDYDHRTPLHVAASEGLYVMAKLLLESGASVFSKDRWGNTPLDEGRMCGNKNLIK  734

Query  600  VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  421
            +L++ +    I  P    + A    A   H      P++C    ++Y  HP   +E +  
Sbjct  735  LLEEAKAAESIEFP----YRAQEITADKMH------PKKC----TVYPFHPWESKEER--  778

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
             PG ++ +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D+ KL++V++
Sbjct  779  RPGIVLWVPTTIGELIRTAGEQLEFSSSGSCMILTEDAGKILD-VDLINDSQKLYLVSE  836



>ref|XP_009378953.1| PREDICTED: potassium channel SKOR-like isoform X3 [Pyrus x bretschneideri]
Length=768

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 118/239 (49%), Gaps = 28/239 (12%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  543  IKDNFGNTPLLEAIKNGNDRVSSLLIQEGASLNIENAGSFICTSIARGDADLLKRLLANG  602

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD---------LTE  601
            +  +SKD    T +  A  E    M KLL+ +GA +    +    PLD         L +
Sbjct  603  VDPNSKDYDHRTPLHVAASEGLYVMAKLLLESGASVFSKDRWGNTPLDEGRMCGNKNLIK  662

Query  600  VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  421
            +L++ +    I  P    + A    A   H      P++C    ++Y  HP   +E +  
Sbjct  663  LLEEAKAAESIEFP----YRAQEITADKMH------PKKC----TVYPFHPWESKEER--  706

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
             PG ++ +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D+ KL++V++
Sbjct  707  RPGIVLWVPTTIGELIRTAGEQLEFSSSGSCMILTEDAGKILD-VDLINDSQKLYLVSE  764



>ref|XP_004501299.1| PREDICTED: potassium channel AKT1-like [Cicer arietinum]
Length=891

 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 127/294 (43%), Gaps = 71/294 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYV--AGDLLCKAAKMNDSSVMQELLKH  757
            KD++G+  LW+A+     SI  IL    S +D +    G L C AA+ N+  +++EL+++
Sbjct  602  KDLDGSVPLWEAMVGGHKSIKKILID--SGADIFCTDVGHLACHAAENNNIELLKELIEY  659

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE--------  601
            G+ V   +  G+TA+ AA+ E  A+++K L+  GAE+D        P  L E        
Sbjct  660  GVDVTKPESSGTTALHAAVCEGNAEIVKFLLDQGAEVDKPNGSGWTPRSLAEHQGHEEIK  719

Query  600  --------------VLQKRELGH-----------RIAMPNTI---------LHEAASKWA  523
                          V+   E G              AMP  +          ++  S W 
Sbjct  720  NIFQNIQENKKTTPVILIPEYGKPNMSCMGRFQSEPAMPGVLGSQESMQQPPNQEVSAWL  779

Query  522  KDDHQNSSSMPQQCSIRVSIYRGHPATRRETQ-------------------CPEPG----  412
                + +++        +S  R +   R+E++                   CPE G    
Sbjct  780  DSHRRRANTFNNSIFGIISAARRYKKERKESESRGNNIRSMNGVVARVTLYCPEKGEHAR  839

Query  411  RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            +L+ LP+++ EL+ I  +K  FD + + + + EGA ID ID+IRD D L I  D
Sbjct  840  KLVFLPKSLEELLHIGAKK--FDISPTKILNREGAEIDDIDLIRDGDHLVIARD  891



>ref|XP_008343076.1| PREDICTED: potassium channel SKOR-like isoform X2 [Malus domestica]
 ref|XP_008353841.1| PREDICTED: potassium channel SKOR-like isoform X2 [Malus domestica]
Length=840

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 121/234 (52%), Gaps = 19/234 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  G+T L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  616  IKDNFGSTPLLEAIKNGNDRVSSLLIQEGASLNMDNAGSFICTSVARGDTDLLKRLLANG  675

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+ +GA +    +    PLD     + R  G+
Sbjct  676  IDPNSKDSDHRTPLHVAASEGLYVMAKLLLESGASVFPKDRWGNTPLD-----ESRMCGN  730

Query  573  RIAMPNTILHEAAS----KWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRL  406
            +  +   +L EA S    ++  +  +N+  M ++   + ++Y  HP   ++ +   PG +
Sbjct  731  KNLIK--LLEEAKSAQSIEFPXNAQENTDKMHRK---KCTVYPFHPWESKQER--RPGIV  783

Query  405  IKLPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
            + +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D  KL++V++
Sbjct  784  LWVPTTIGELIRTAGEQLEFSSSSSCIJLTEDAGKILD-VDLINDGQKLYLVSE  836



>ref|XP_009378952.1| PREDICTED: potassium channel SKOR-like isoform X2 [Pyrus x bretschneideri]
Length=839

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 121/235 (51%), Gaps = 21/235 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  615  IKDNFGNTPLLEAIKNGNDRVSSLLIQEGASLNIENAGSFICTSIARGDADLLKRLLANG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+ +GA +    +    PLD     + R  G+
Sbjct  675  VDPNSKDYDHRTPLHVAASEGLYVMAKLLLESGASVFSKDRWGNTPLD-----EGRMCGN  729

Query  573  RIAMPNTILHEAAS----KWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA +    ++     + +  M P++C    ++Y  HP   +E +   PG 
Sbjct  730  KNLIK--LLEEAKAAESIEFPYRAQEITDKMHPKKC----TVYPFHPWESKEER--RPGI  781

Query  408  LIKLPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D+ KL++V++
Sbjct  782  VLWVPTTIGELIRTAGEQLEFSSSGSCMILTEDAGKILD-VDLINDSQKLYLVSE  835



>ref|XP_011038255.1| PREDICTED: potassium channel SKOR-like isoform X2 [Populus euphratica]
Length=781

 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 113/229 (49%), Gaps = 12/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GN+ L +AI      + S+L+   +I +   AG +LC+A    DS  ++ +L +G
Sbjct  561  IKDKFGNSPLLEAIKNGHDRVESLLFKQGAILNIDDAGSVLCRAVARGDSDFLKRILSNG  620

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD   +   ++L  
Sbjct  621  IDPNSKDYDHRTPLHLAASEGLYLMAKLLIEAGASVFSKDRWGNTPLDEGRMCGSKKL--  678

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQC-SIRVSIYRGHPATRRETQCPEPGRLIKL  397
                   +L EA S    + H ++    ++  + + +I+  HP   R  +   PG ++ +
Sbjct  679  -----IKLLEEAKSSQKLEFHYSAHETTEKVLTKKCTIFPFHP---RAEEQRRPGVVLWV  730

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P T+ EL+  A E+L F      L++E G I+D +++I D  KL++ +D
Sbjct  731  PSTMEELVKAASEQLQFPDGSCILSEEAGKILD-VNMIDDGQKLYLTSD  778



>ref|XP_006372521.1| Potassium channel SKOR family protein [Populus trichocarpa]
 gb|ERP50318.1| Potassium channel SKOR family protein [Populus trichocarpa]
Length=841

 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 116/233 (50%), Gaps = 20/233 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L+   +I +   AG +LC+A    DS  ++ +L +G
Sbjct  618  IKDKFGNTPLLEAIKNGHDRVESLLFKQGAILNIDDAGSVLCRAVARGDSDFLKRILSNG  677

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  678  IDPNSKDYDHRTPLHVAASEGLYLMAKLLIEAGASVFSKDRWGNTPLD-----EGRMCGN  732

Query  573  RIAMPNTILHEAASKWAKDDHQNS-----SSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA S    + H ++       +P++C    +I+  HP  R E Q   PG 
Sbjct  733  KKLI--KLLEEAKSSQKLEFHYSTHETTEKVLPKKC----TIFPFHP--RAEEQ-RRPGV  783

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P T+ EL+  A E+L F      L+++ G I+D +++I    KL++ +D
Sbjct  784  VLWVPNTMEELVKAASEQLQFPDGSCILSEDAGKILD-VNMIDGGQKLYLTSD  835



>ref|XP_011038254.1| PREDICTED: potassium channel SKOR-like isoform X1 [Populus euphratica]
Length=839

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 114/229 (50%), Gaps = 12/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GN+ L +AI      + S+L+   +I +   AG +LC+A    DS  ++ +L +G
Sbjct  619  IKDKFGNSPLLEAIKNGHDRVESLLFKQGAILNIDDAGSVLCRAVARGDSDFLKRILSNG  678

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD     + R  G 
Sbjct  679  IDPNSKDYDHRTPLHLAASEGLYLMAKLLIEAGASVFSKDRWGNTPLD-----EGRMCGS  733

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQC-SIRVSIYRGHPATRRETQCPEPGRLIKL  397
            +  +   +L EA S    + H ++    ++  + + +I+  HP   R  +   PG ++ +
Sbjct  734  KKLIK--LLEEAKSSQKLEFHYSAHETTEKVLTKKCTIFPFHP---RAEEQRRPGVVLWV  788

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P T+ EL+  A E+L F      L++E G I+D +++I D  KL++ +D
Sbjct  789  PSTMEELVKAASEQLQFPDGSCILSEEAGKILD-VNMIDDGQKLYLTSD  836



>ref|XP_010249975.1| PREDICTED: potassium channel AKT1-like [Nelumbo nucifera]
Length=876

 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 126/288 (44%), Gaps = 61/288 (21%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D EGN  LW+AI  +   +  +L  + A+I    V G   C AA+ N   +++++++HG
Sbjct  587  RDSEGNVPLWEAIMGRHEPVIKLLKDNGANIVSGDV-GQFACTAAEQNKLDLLKDIVRHG  645

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE---------  601
              V     +G+TA+  A+ E   ++++ L+ +GA+ID       +P DL E         
Sbjct  646  GDVTLSRSNGTTALHVAVCEGNIEVVEFLLDHGADIDKPDSHGWSPRDLAEQQGHEEIKT  705

Query  600  VLQK------------------RELGHRIAMPNTI-LHEAASK------W------AKDD  514
            + Q                   R LG   + P+   L+   +       W        D+
Sbjct  706  LFQSKKEAKNQSTIIVSEQQRVRYLGRFTSEPSLYALYPGGAAIHPEMPWRDRRRRRTDN  765

Query  513  HQNS-------------SSMPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPETI  385
              NS               +P    +  S   G+   R    CPE     G+L+ LP++I
Sbjct  766  FHNSLFGIMSAAQTGDKGLVPLTAHVNCSKSCGNYPARVTITCPEKGLVTGKLLLLPQSI  825

Query  384  AELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
             EL++I  +K GF  + S +  +EGA ID I +IRD D L I +D+ +
Sbjct  826  EELLAICSQKFGF--SPSKVLSKEGAEIDDIQLIRDGDHLIIASDYGT  871



>ref|XP_009370080.1| PREDICTED: potassium channel SKOR isoform X3 [Pyrus x bretschneideri]
Length=839

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 119/235 (51%), Gaps = 21/235 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  615  IKDNFGNTPLLEAIKNGNDRVSSLLIQQGASLNIDNAGSFICTSIARGDADLLKRLLANG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  675  IDPNSKDYDHRTPLHVAASEGLYIMAKLLLEAGASVFSKDRWGNTPLD-----EGRMCGN  729

Query  573  RIAMPNTILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA     +++     + +  M P++C    ++Y  HP   +E +   PG 
Sbjct  730  KNLIK--LLEEAKAAQLTEFPYCAQEITDKMHPKKC----TVYPFHPWESKEGR--RPGI  781

Query  408  LIKLPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D  KL++V++
Sbjct  782  VLWVPSTIGELIRTAGEQLEFSSSGSGIILTEDVGKILD-VDLINDGQKLYLVSE  835



>ref|XP_009370078.1| PREDICTED: potassium channel SKOR isoform X1 [Pyrus x bretschneideri]
 ref|XP_009370079.1| PREDICTED: potassium channel SKOR isoform X2 [Pyrus x bretschneideri]
Length=840

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 116/236 (49%), Gaps = 22/236 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  615  IKDNFGNTPLLEAIKNGNDRVSSLLIQQGASLNIDNAGSFICTSIARGDADLLKRLLANG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  675  IDPNSKDYDHRTPLHVAASEGLYIMAKLLLEAGASVFSKDRWGNTPLD-----EGRMCGN  729

Query  573  RIAMPNTILHEAASK------WAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPG  412
            +  +   +L EA +       +   +       P++C    ++Y  HP   +E +   PG
Sbjct  730  KNLIK--LLEEAKAAQLTEFPYCAQEITADKMHPKKC----TVYPFHPWESKEGR--RPG  781

Query  411  RLIKLPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D  KL++V++
Sbjct  782  IVLWVPSTIGELIRTAGEQLEFSSSGSGIILTEDVGKILD-VDLINDGQKLYLVSE  836



>ref|XP_002305894.2| Potassium channel SKOR family protein [Populus trichocarpa]
 gb|EEE86405.2| Potassium channel SKOR family protein [Populus trichocarpa]
Length=842

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 114/233 (49%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +I +   AG +LC+A    DS  ++ +L +G
Sbjct  621  IKDKFGNTPLLEAIKNGHDRVASLLSEQGAILNIDDAGSVLCRAVARGDSDFLKRVLSNG  680

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PL     ++ R  G+
Sbjct  681  IDPNSKDYDHRTPLHVAASEGLYLMAKLLIEAGASVFSKDRWGNTPL-----VEGRICGN  735

Query  573  RIAMPNTILHEAASKWAKDDHQNSSS-----MPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA S    + H  S       +P++C    +I+  HP   +E +   PG 
Sbjct  736  KNLI--KLLEEAKSSQKLEFHYASHETTEKMLPKKC----TIFPFHPWGAKEQR--RPGV  787

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P T+ EL+  A EKL        L+++ G I++ +D+I D  KL++ +D
Sbjct  788  VLWIPHTMEELVKAASEKLQLPDGSCILSEDAGKILE-VDMIDDGQKLYLTSD  839



>ref|XP_008381509.1| PREDICTED: potassium channel SKOR [Malus domestica]
Length=773

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 116/235 (49%), Gaps = 21/235 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  549  IKDNFGNTPLLEAIKNGNDRVSSLLIQQGASLNIDNAGSFICTSIARGDADLLKRLLANG  608

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  609  IDPNSKDYDHRTPLHVAASEGLYIMSKLLLEAGASVFSKDRWGNTPLD-----EGRMCGN  663

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA +    +    +  +     P++C    ++Y  HP   +E +   PG 
Sbjct  664  KNLIK--LLEEAKAAQLTELPYCAQEITDKMHPKKC----TVYPFHPWEXKEGR--RPGI  715

Query  408  LIKLPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P TI ELI  AGE+L F ++ S   LT + G I+D +D+I D  KL++V++
Sbjct  716  VLWVPSTIGELIRTAGEQLEFSSSGSGIILTXDAGKILD-VDLINDGQKLYLVSE  769



>ref|XP_008343077.1| PREDICTED: potassium channel SKOR-like isoform X3 [Malus domestica]
 ref|XP_008353842.1| PREDICTED: potassium channel SKOR-like isoform X3 [Malus domestica]
Length=768

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 119/232 (51%), Gaps = 14/232 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  G+T L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  543  IKDNFGSTPLLEAIKNGNDRVSSLLIQEGASLNMDNAGSFICTSVARGDTDLLKRLLANG  602

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+ +GA +    +    PLD     + R  G+
Sbjct  603  IDPNSKDSDHRTPLHVAASEGLYVMAKLLLESGASVFPKDRWGNTPLD-----ESRMCGN  657

Query  573  RIAMPNTILHEAASKWAKDDHQNS--SSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
            +  +   +L EA S  + +   N+  ++  +    + ++Y  HP   ++ +   PG ++ 
Sbjct  658  KNLI--KLLEEAKSAQSIEFPXNAQENTADKMHRKKCTVYPFHPWESKQER--RPGIVLW  713

Query  399  LPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
            +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D  KL++V++
Sbjct  714  VPTTIGELIRTAGEQLEFSSSSSCIJLTEDAGKILD-VDLINDGQKLYLVSE  764



>ref|XP_011043907.1| PREDICTED: potassium channel SKOR [Populus euphratica]
Length=856

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 114/233 (49%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +I +   AG +LC+A    DS  ++ +L +G
Sbjct  633  IKDKFGNTPLLEAIKNGHDRVASLLSEQGAILNIDDAGSVLCRAVARGDSDFLKRVLSNG  692

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PL     ++ R  G+
Sbjct  693  IDPNSKDYDHRTPLHVAASEGLYLMAKLLIEAGASVFSKDRWGNTPL-----VEGRICGN  747

Query  573  RIAMPNTILHEAASKWAKDDHQNS-----SSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA S    + H  S       +P++C    +I+  HP   +E +   PG 
Sbjct  748  KNLI--KLLEEAKSSQKLEFHYASHETTEKMLPKKC----TIFPFHPWGAKEQR--RPGV  799

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P T+ EL+  A EKL        L+++ G I++ +D+I D  KL++ +D
Sbjct  800  VLWIPHTMEELVKAASEKLQLPDGSCILSEDAGKILE-VDMIDDGQKLYLTSD  851



>ref|XP_006352480.1| PREDICTED: potassium channel SKOR-like [Solanum tuberosum]
Length=828

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 114/225 (51%), Gaps = 11/225 (5%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L +AI +    + S+L    ++ +   AG  LC      DS +++ LL +G+ 
Sbjct  610  DKFGNTPLLEAIKSGHDRVASLLVKEGALLNIENAGSFLCMVIAKGDSDLLRRLLSNGVD  669

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             ++KD    T +  A  + Q  M KLL+  GA +    +    P+D   V   +++   I
Sbjct  670  PNNKDYDQRTPLHVAASQGQYSMAKLLLGAGASVFSKDRWGNTPVDEARVSGNKQM---I  726

Query  567  AMPNTILHEAASKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
            ++         S++    H+ S  + P++C    +++  HP   ++ +  + G ++ +P+
Sbjct  727  SLLEEAKSAQLSEFPDVPHEISDKLRPRKC----TVFPFHPWESKDVR--KHGVVLWIPQ  780

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            TI EL+  A E+LGF +    L+++ G I+D +D+I D  KL+++
Sbjct  781  TIEELVITASEQLGFPSGSCILSEDAGKILD-VDMIVDGQKLYLI  824



>ref|XP_008343075.1| PREDICTED: potassium channel SKOR-like isoform X1 [Malus domestica]
 ref|XP_008353840.1| PREDICTED: potassium channel SKOR-like isoform X1 [Malus domestica]
Length=841

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 119/232 (51%), Gaps = 14/232 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  G+T L +AI      + S+L    +  +   AG  +C +    D+ +++ LL +G
Sbjct  616  IKDNFGSTPLLEAIKNGNDRVSSLLIQEGASLNMDNAGSFICTSVARGDTDLLKRLLANG  675

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+ +GA +    +    PLD     + R  G+
Sbjct  676  IDPNSKDSDHRTPLHVAASEGLYVMAKLLLESGASVFPKDRWGNTPLD-----ESRMCGN  730

Query  573  RIAMPNTILHEAASKWAKDDHQNS--SSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
            +  +   +L EA S  + +   N+  ++  +    + ++Y  HP   ++ +   PG ++ 
Sbjct  731  KNLIK--LLEEAKSAQSIEFPXNAQENTADKMHRKKCTVYPFHPWESKQER--RPGIVLW  786

Query  399  LPETIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
            +P TI ELI  AGE+L F ++ S   LT++ G I+D +D+I D  KL++V++
Sbjct  787  VPTTIGELIRTAGEQLEFSSSSSCIJLTEDAGKILD-VDLINDGQKLYLVSE  837



>emb|CDP04802.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 73/286 (26%), Positives = 127/286 (44%), Gaps = 64/286 (22%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            KD +GN  LWDAI  K  ++  +L  + A+IS   V G   C A + N+  ++++++K+G
Sbjct  600  KDSDGNVPLWDAILNKHEAVIKLLIDNGANISSGDVGG-FACFAVEQNNLELLKDIIKYG  658

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE---------  601
              V   +  G+TA+  A+ E+ A+M+K L+  GA++D        P  L +         
Sbjct  659  GDVTLLNSLGTTALHTAISEDNAEMVKFLIEQGADVDKPDVHGWTPRALADYQANEGIKL  718

Query  600  VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMP----------------------Q  487
            +LQ ++   R  + ++   +A S   K  +Q+  ++P                      +
Sbjct  719  LLQNQKKSTRQPVASSPQMQAVSYLKK--YQSEPTLPPLTPEVAVSVTEADTSRNRLKRR  776

Query  486  QCSIRVSIYRGHPATRRETQ-----------------------CPEPG----RLIKLPET  388
              + R S++    A  R  +                       C E G    RL+ LPE+
Sbjct  777  ASNFRNSLFGIMSAANRPNEGGKSIAASPINVNTLNHARVTISCRERGCDICRLVLLPES  836

Query  387  IAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            I EL+ I  +K GF  T   +  ++GA+++ I V+RD D L +  D
Sbjct  837  IQELLDIGAKKFGFCPT--RVFTKDGALVEDIAVVRDGDHLILAGD  880



>gb|KHN08108.1| Potassium channel AKT1 [Glycine soja]
Length=346

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 117/273 (43%), Gaps = 49/273 (18%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            + DM+G+  LW+A+  +  S+  IL    +      AG L C A + N+  +++E+++ G
Sbjct  68   VTDMDGSVPLWEAMKGRHESVMKILIDNGADISLANAGHLACSAVEQNNMELLKEIIQCG  127

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            + V    ++G TA+  A+ E   +MI  LV  GA+ID        P  + E   + E+ +
Sbjct  128  VDVTQPKKNGITALHTAIAEGNTEMINFLVDQGADIDMPDANGWTPRVMAEQHGREEIRN  187

Query  573  RI----------------------------AMPNTILHEAASKWAKDDHQNSSSMPQQCS  478
                                          +MP  I  E+ S       ++SSS      
Sbjct  188  IFDNIKESRKPSVIPIPRNDNRSGRFQIDPSMP-AITQESMSLLPYHGRRSSSSFDNSIF  246

Query  477  IRVSI-YRGHPA-------------TRRETQCPEP----GRLIKLPETIAELISIAGEKL  352
              +SI  RG  +             TR    CPE     G+L+ LP+T+ EL+ I   K 
Sbjct  247  GMISIANRGKVSEGRSSNRGNVNGLTRVTLSCPEKGEHAGKLVLLPKTLEELLDIGARK-  305

Query  351  GFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
             FD + + +   +GA +D I+++RD D L I  
Sbjct  306  -FDISATKILTIDGAEVDDINLLRDGDHLIIAG  337



>ref|XP_006579054.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=878

 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 72/270 (27%), Positives = 117/270 (43%), Gaps = 49/270 (18%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KDM+G+  LW+A+  +  S+  IL    +      AG L C A + N+  +++E+++ G+
Sbjct  601  KDMDGSVPLWEAMKGRHESVMKILIDNGADISLANAGHLACSAVEQNNMELLKEIIQCGV  660

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
             V    ++G TA+  A+ E   +MI  LV  GA+ID        P  + E   + E+ + 
Sbjct  661  DVTQPKKNGITALHTAIAEGNTEMINFLVDQGADIDMPDANGWTPRVMAEQHGREEIRNI  720

Query  570  I----------------------------AMPNTILHEAASKWAKDDHQNSSSMPQQCSI  475
                                         +MP  I  E+ S       ++SSS       
Sbjct  721  FDNIKESRKPSVIPIPRNDNRSGRFQIDPSMP-AITQESMSLLPYHGRRSSSSFDNSIFG  779

Query  474  RVSI-YRGHPA-------------TRRETQCPE----PGRLIKLPETIAELISIAGEKLG  349
             +SI  RG  +             TR    CPE     G+L+ LP+T+ EL+ I   K  
Sbjct  780  MISIANRGKVSEGRSSNRGNVNGLTRVTLSCPEKGEHAGKLVLLPKTLEELLDIGARK--  837

Query  348  FDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            FD + + +   +GA +D I+++RD D L I
Sbjct  838  FDISATKILTIDGAEVDDINLLRDGDHLII  867



>ref|XP_010925255.1| PREDICTED: potassium channel AKT1-like isoform X1 [Elaeis guineensis]
Length=762

 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 131/292 (45%), Gaps = 70/292 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D+EGN  LW+AI+ K   +  +L  + A IS   VA    C AA+ N   ++Q+++++G
Sbjct  472  RDLEGNIPLWEAISGKHEGVIRLLIDNGADISTGDVA-HFACMAAEQNSLELLQDIVRYG  530

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDL---------TE  601
              V      G+TA+  A+ E    M+K L+  G  ID        P DL         T 
Sbjct  531  GDVTLAKSDGTTALHHAVCEGNLQMVKFLIEQGTNIDKPDIRGWTPRDLADQQGHEDITA  590

Query  600  VLQ---KRELG--------HRIAMPNTILHEAA--------------SKWAKDDH-----  511
            + Q   +R+ G         +I+ P  I+H  A               + + DDH     
Sbjct  591  LFQATKERDSGTSKTPAVATKISSP--IVHLNAKFRSDPSMPVPKLIQESSGDDHRQRNS  648

Query  510  ----------------QNSSSMPQQCSIR-VSIYRG---HPATRRET-QCPEPG----RL  406
                            ++S S+P   + R V   RG   H AT R T  CPE G    +L
Sbjct  649  NFHNSLFGIISAAHAGRSSCSLPVAPAARYVGGSRGPQHHHATPRVTISCPEKGSTAPKL  708

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            + LP ++ EL+ +  +K GF    + +  ++GA ID++++IRD D L +V D
Sbjct  709  VLLPRSLDELLDVGAKKFGF--LPAKVLTKDGAEIDNVNLIRDGDHLVLVGD  758



>ref|XP_009802068.1| PREDICTED: potassium channel SKOR-like [Nicotiana sylvestris]
Length=821

 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 111/227 (49%), Gaps = 11/227 (5%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L +AI +    + S+L    +      AG  LC      DS +++ LL +G+ 
Sbjct  602  DKFGNTPLLEAIKSGHDRVASLLVKEGAFLKIENAGSFLCMVIAKGDSDLLRRLLSNGVD  661

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             +SKD    T +  A  +    M KLL+  GA +    +    P+D   V   +++   I
Sbjct  662  PNSKDYDQRTPLHVAASQGLYSMAKLLLGAGASVFTKDRWGNTPVDEARVSGNKQM---I  718

Query  567  AMPNTILHEAASKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
             +         S++    H+ S  + P++C    +++  HP   ++ +  + G ++ +P+
Sbjct  719  GLLEEAKSAQLSEFPDVPHEISEKLRPRKC----TVFPFHPWESKDVR--KHGVVMWIPQ  772

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            TI EL++ A EKL F +    L+++ G I+D ID+I D  KL+++ D
Sbjct  773  TIEELVTTASEKLNFPSDSCILSEDAGKILD-IDMIADGQKLYLIND  818



>ref|XP_010925257.1| PREDICTED: potassium channel AKT1-like isoform X2 [Elaeis guineensis]
Length=884

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 131/292 (45%), Gaps = 70/292 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D+EGN  LW+AI+ K   +  +L  + A IS   VA    C AA+ N   ++Q+++++G
Sbjct  594  RDLEGNIPLWEAISGKHEGVIRLLIDNGADISTGDVA-HFACMAAEQNSLELLQDIVRYG  652

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDL---------TE  601
              V      G+TA+  A+ E    M+K L+  G  ID        P DL         T 
Sbjct  653  GDVTLAKSDGTTALHHAVCEGNLQMVKFLIEQGTNIDKPDIRGWTPRDLADQQGHEDITA  712

Query  600  VLQ---KRELG--------HRIAMPNTILHEAA--------------SKWAKDDH-----  511
            + Q   +R+ G         +I+ P  I+H  A               + + DDH     
Sbjct  713  LFQATKERDSGTSKTPAVATKISSP--IVHLNAKFRSDPSMPVPKLIQESSGDDHRQRNS  770

Query  510  ----------------QNSSSMPQQCSIR-VSIYRG---HPATRRET-QCPEPG----RL  406
                            ++S S+P   + R V   RG   H AT R T  CPE G    +L
Sbjct  771  NFHNSLFGIISAAHAGRSSCSLPVAPAARYVGGSRGPQHHHATPRVTISCPEKGSTAPKL  830

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            + LP ++ EL+ +  +K GF    + +  ++GA ID++++IRD D L +V D
Sbjct  831  VLLPRSLDELLDVGAKKFGF--LPAKVLTKDGAEIDNVNLIRDGDHLVLVGD  880



>ref|XP_009626879.1| PREDICTED: potassium channel SKOR [Nicotiana tomentosiformis]
Length=810

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/227 (27%), Positives = 112/227 (49%), Gaps = 11/227 (5%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L +AI +    + S+L    ++     AG  LC      DS +++ LL +G+ 
Sbjct  591  DKFGNTPLLEAIKSGHDRVASLLVKEGALLKIENAGSFLCMVIAKGDSDLLRRLLSNGVD  650

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             +SKD    T +  A  +    M K+L+  GA +    +    P+D   V   +++   I
Sbjct  651  PNSKDYDQRTPLHVAASQGLYSMAKMLLGAGASVFTKDRWGNTPVDEARVSGNKQM---I  707

Query  567  AMPNTILHEAASKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
             +         S++    H+ S  + P++C    +++  HP   ++ +  + G ++ +P+
Sbjct  708  GLLEEAKSAQLSEFPDVPHEISEKLRPRKC----TVFPFHPWESKDVR--KHGVVMWIPQ  761

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            TI EL++ A EKL F +    L+++ G I+D ID+I D  KL+++ D
Sbjct  762  TIEELVTTASEKLNFPSDSCILSEDAGKILD-IDMIVDGQKLYLIND  807



>ref|XP_010450509.1| PREDICTED: potassium channel GORK-like isoform X2 [Camelina sativa]
Length=531

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 117/233 (50%), Gaps = 17/233 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  D   +G+ LC      DS  ++ LL  G
Sbjct  308  LKDKFGNTALFEAVKAGQDGVIGLLVKEGASFDIQDSGNFLCTTVSKGDSDFLKRLLLSG  367

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD     + R  G+
Sbjct  368  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLD-----EARMCGN  422

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI---RVSIYRGHPATRRETQCPEPGRLI  403
            +  +    L E  +  A+    +SS  PQQ      + +++  HP   +E    + G ++
Sbjct  423  KKLIK---LLEDGNVTAE---SSSSQEPQQERFERRKCTVFPFHPREAKEEPSRKHGVML  476

Query  402  KLPETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             +P  + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL+++++
Sbjct  477  WIPSDLHKLVVTAVQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLISN  528



>ref|XP_010440864.1| PREDICTED: potassium channel GORK isoform X2 [Camelina sativa]
Length=646

 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 113/230 (49%), Gaps = 11/230 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  D   +G+ LC      DS  ++ LL  G
Sbjct  423  LKDKFGNTALFEAVKAGQDGVVGLLVREGASFDIEDSGNFLCTTVAKGDSDFLKRLLLSG  482

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD   +   ++L  
Sbjct  483  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLDEARMCGNKKLIK  542

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             +   N     ++S     + Q      ++C    +++  HP   +E    + G ++ +P
Sbjct  543  LLEDGNVTAESSSSH----ERQQERIERRKC----TVFPFHPHEAKEEPSRKHGVMLWIP  594

Query  393  ETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL+++++
Sbjct  595  SDLHKLVVTAAQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLISN  643



>ref|XP_010450508.1| PREDICTED: potassium channel GORK-like isoform X1 [Camelina sativa]
Length=818

 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 114/230 (50%), Gaps = 11/230 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  D   +G+ LC      DS  ++ LL  G
Sbjct  595  LKDKFGNTALFEAVKAGQDGVIGLLVKEGASFDIQDSGNFLCTTVSKGDSDFLKRLLLSG  654

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD   +   ++L  
Sbjct  655  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLDEARMCGNKKLIK  714

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             +   N     ++S+    + Q      ++C    +++  HP   +E    + G ++ +P
Sbjct  715  LLEDGNVTAESSSSQ----EPQQERFERRKC----TVFPFHPREAKEEPSRKHGVMLWIP  766

Query  393  ETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL+++++
Sbjct  767  SDLHKLVVTAVQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLISN  815



>ref|XP_010440863.1| PREDICTED: potassium channel GORK isoform X1 [Camelina sativa]
Length=818

 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 113/230 (49%), Gaps = 11/230 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  D   +G+ LC      DS  ++ LL  G
Sbjct  595  LKDKFGNTALFEAVKAGQDGVVGLLVREGASFDIEDSGNFLCTTVAKGDSDFLKRLLLSG  654

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD   +   ++L  
Sbjct  655  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLDEARMCGNKKLIK  714

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             +   N     ++S     + Q      ++C    +++  HP   +E    + G ++ +P
Sbjct  715  LLEDGNVTAESSSSH----ERQQERIERRKC----TVFPFHPHEAKEEPSRKHGVMLWIP  766

Query  393  ETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL+++++
Sbjct  767  SDLHKLVVTAAQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLISN  815



>ref|XP_003560852.1| PREDICTED: potassium channel KOR1 [Brachypodium distachyon]
Length=833

 Score = 79.3 bits (194),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 107/238 (45%), Gaps = 28/238 (12%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D  GNT L +A+      + ++L+   +I +   AG  LC A    DS  ++  L  G
Sbjct  607  LIDKFGNTPLLEAVKQGHDRVATLLFKKGAILNLQNAGSHLCSAVSKGDSDFIRRALACG  666

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
               DSKD    + +  A  E    M KLLV  GA +    +    PLD     + R+ G 
Sbjct  667  ADPDSKDYDHRSPLHIAAAEGLYMMAKLLVEAGASVFATDRWGTTPLD-----EGRKSGS  721

Query  573  RIAMPNTILHEAA-----SKW-AKDDHQNSSSMPQQCSIRVSIYRGHP----ATRRETQC  424
            +   P  +L E A     SK+ A+ +       P++C    S++  HP      R+E   
Sbjct  722  K---PLMMLLEQAKAEELSKFPARSEEVRDKMHPRRC----SVFPNHPWDTDGKRKE---  771

Query  423  PEPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
               G  + +P TI  LI  A EKLG   +   L  E+GA +  +D++ D  KL++V D
Sbjct  772  ---GVTLWIPHTIDWLIRSAQEKLGLSGSCLRLLGEDGARVQDVDMVNDGQKLYLVGD  826



>ref|XP_010905454.1| PREDICTED: potassium channel KOR1 [Elaeis guineensis]
Length=688

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 115/234 (49%), Gaps = 22/234 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D  GNT L++A+      + S+L+   +  +   AG  LC AA   DS  ++  L +G
Sbjct  460  LSDNFGNTPLFEAVKVGHDRVASLLFSRGAQLNLKDAGSHLCTAAAKGDSDFIRRALSYG  519

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    TA+  A  E    + KLL+  GA +    +    PLD     + R+ G+
Sbjct  520  VDPNSKDYDHRTALHIAASEGLYFIAKLLLEAGASVFAMDRWGATPLD-----EGRKSGN  574

Query  573  RIAMPNTILHEAA-----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPG  412
            +  M   +L E A     SK+ +   +    M P++C    +++  HP   +E +    G
Sbjct  575  QSLM---LLLEGAKSDELSKFPEHAREVQDKMHPRRC----TVFPFHPWDPKEAR--REG  625

Query  411  RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +P TI ELI  + E+L   ++ S +  E+G  I  +D+I D  KL++VAD
Sbjct  626  VVLWIPCTIEELIRSSREQL--KSSGSCILSEDGGRILDVDMISDGQKLYLVAD  677



>ref|XP_004240037.1| PREDICTED: potassium channel SKOR-like [Solanum lycopersicum]
Length=824

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 109/227 (48%), Gaps = 11/227 (5%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L++AI      + S+L    +      AG  LC      DS +++ LL +G+ 
Sbjct  606  DNFGNTPLFEAIKNGHDRVASLLVKEGAFLKIENAGSFLCTLVTKGDSDLLRRLLSNGID  665

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             +SKD    T +  A  +    M +LL+  GA +    +    P D   +    +L    
Sbjct  666  ANSKDYDHRTPLHVAASQGLLAMARLLLGAGASVFSKDRWGNTPFDEARLSGNNQL----  721

Query  567  AMPNTILHEAASKWAKDDHQNSSSMPQQCSIR-VSIYRGHPATRRETQCPEPGRLIKLPE  391
                 +L EA S    + H  S  + ++  +R  ++Y  HP   ++ +  + G ++ +P 
Sbjct  722  ---IKLLEEAKSAQTSEIHSVSHEISEKIHLRKCTVYPIHPWEPKDLR--KHGVVLWVPT  776

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ EL++ A E+L F +    L+++ G I+D ID+I D  KL+++++
Sbjct  777  SMEELVTAASEQLNFSSGSCILSEDAGKILD-IDMISDGQKLYLISE  822



>ref|XP_008787403.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT1-like [Phoenix 
dactylifera]
Length=881

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 125/295 (42%), Gaps = 76/295 (26%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D+EGN  LW+AI  K  ++  +L  + A IS   VA    C AA+ N   ++Q+++++G
Sbjct  581  RDLEGNVPLWEAILGKHEAVIRLLIDNGADISTGDVA-RFACMAAEQNSLELLQDIVRYG  639

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
              V      G+TA+  A+ E    +++ L+  G  ID       +P DL +     + GH
Sbjct  640  GDVTLAKNDGATALHHAVCEGNLQIVRFLIEQGESIDKPDIHGWSPRDLAD-----QQGH  694

Query  573  -------------------------RIAMPNTILHE--------AASKWAK----DDHQN  505
                                     RI+ P   L+          A K+ +    DDH+ 
Sbjct  695  EDIKALFQATKGCDSKTSKTPAAAARISSPTVHLNAKFKSDPSMPAPKFMQESSGDDHRQ  754

Query  504  SSS---------------------MPQQCSIR-VSIYRG----HPATRRETQCPEPG---  412
            SSS                     +P   + R V   RG    H   R    CPE G   
Sbjct  755  SSSYFHNSLFGIMSAAHAGRSSCPLPAAPATRYVGGSRGPQHHHAPPRVTISCPEKGDAA  814

Query  411  -RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             +L+ LP ++ EL++I   K G     + +  ++GA ID++++IRD D L +V D
Sbjct  815  RKLVPLPRSLDELLNIGAXKFG--VLPAKVLTKDGAEIDNVNLIRDGDHLVLVGD  867



>ref|XP_007217689.1| hypothetical protein PRUPE_ppa001431mg [Prunus persica]
 gb|EMJ18888.1| hypothetical protein PRUPE_ppa001431mg [Prunus persica]
Length=830

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 106/233 (45%), Gaps = 18/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +A       + S+L    +  +   AG  +C A    DS  ++ LL +G
Sbjct  607  IKDTFGNTPLLEATKNGNDRVSSLLIKEGASLEMDNAGSFICTAITRGDSDFIKRLLSNG  666

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD  ++   + L  
Sbjct  667  IDPNSKDYDHRTPLHVAASEGLYMMAKLLLEAGASVFSKDRWGNTPLDEGQMCGNKNL--  724

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
                   +L EA +    +    +  +     P++C    +++  HP   +E +   PG 
Sbjct  725  -----IKLLEEAKATQLTESPYRAQVLTDKLHPKKC----TVFPFHPWDGKEQR--RPGI  773

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P TI ELI  A + L F +    +  E+G  I  +D+I D  KL++V+D
Sbjct  774  VLWVPTTIQELIKTATDLLEFSSGSFIILSEDGGKILDVDLINDGQKLYLVSD  826



>ref|XP_008244385.1| PREDICTED: potassium channel SKOR-like [Prunus mume]
Length=739

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 105/233 (45%), Gaps = 18/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +      AG  +C A    DS  ++ LL +G
Sbjct  516  IKDTFGNTPLLEAIKNGNDRVSSLLIKEGASLKMDNAGSFICTAITKGDSDFIKRLLSNG  575

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD  ++   + L  
Sbjct  576  IDPNSKDYDHRTPLHVAASEGLYMMAKLLLEAGASVFSKDRWGNTPLDEGQMCGNKNL--  633

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
                   +L EA +    +    +  +     P++C    +++  HP   +E +   PG 
Sbjct  634  -----IKLLEEATATQLTESPYRAQELADKLHPKKC----TVFPFHPWEGKEQR--RPGI  682

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P TI  LI  A + L F +    +  E+G  I  +D+I D  KL++V+D
Sbjct  683  VLWVPTTIQGLIKTATDLLEFSSGSFIILSEDGGKILDVDLINDGQKLYLVSD  735



>ref|XP_003526425.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=879

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/281 (25%), Positives = 120/281 (43%), Gaps = 67/281 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KDM+G+  LW+A+  +  S+  IL    +      AG L C A + N+  +++E+++ G+
Sbjct  600  KDMDGSVPLWEAMKGRHESVMKILIDNGADISFADAGHLACSAVEQNNMELLKEIIQCGM  659

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
             V    ++G+TA+  A+ E   +MI  LV  GA+ID        P  L E  +  E+   
Sbjct  660  DVTQPKKNGATALHTAVVEGNTEMINFLVDQGADIDMQDVNGWTPRVLAEQSESEEI---  716

Query  570  IAMPNTILHE-------AASKWAKDDHQNSS--------SMPQQCSIRVSIYRGH-----  451
                  I H+            +K+D+++          ++PQ+ S+ +  Y G      
Sbjct  717  ----KNIFHDIKDSRKPGVIPISKNDNRSGRFQIDPSMLTIPQE-SMLLPPYDGRRRSSS  771

Query  450  -------------------------PATRRETQ--------CPE----PGRLIKLPETIA  382
                                      +TRR           CPE     G+L+ LP+T+ 
Sbjct  772  SFDNSIFGMMSTANRAKRDLQASESSSTRRSVNGLARVTLSCPEKGEHAGKLVLLPKTLE  831

Query  381  ELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            EL+ I   K  FD + + +    GA ++ I+++RD D L I
Sbjct  832  ELLDIGARK--FDISATKILTTNGAEVEDINLVRDGDHLII  870



>gb|KHN32491.1| Potassium channel AKT1 [Glycine soja]
Length=864

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 77/278 (28%), Positives = 122/278 (44%), Gaps = 57/278 (21%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKH  757
            +KD++GN  LW+AI     S+  +L  + A IS   V G L C   + N+  +++ +++ 
Sbjct  590  IKDLDGNVPLWEAIKGGHDSVMKLLIDNGADISSGDV-GSLACVGVEQNNLELLKHIVQC  648

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLT------EVL  595
            G  V     +G+TA+ AA+ E   +++K L+ +GA+ID        P  L       E++
Sbjct  649  GGDVTQSTSNGTTALHAAVCEGNVEIVKFLLEHGADIDKQDGSGWTPRFLADQQCHEEII  708

Query  594  Q-KRELGHRI---AMPNTILHE------------AASK-------WAKDDHQNSSSMPQQ  484
               +++GH+    A+P T   E              SK       W  D+HQ     P  
Sbjct  709  NVFKKVGHKKTPHAIPTTSFFERYQSEPTIPGIPQGSKPPNEEPTWF-DNHQRRRVSPFH  767

Query  483  CSI-------------------RVSIYRGHPATRRETQCPEPG----RLIKLPETIAELI  373
             S                       I R     R    CP+ G    +LI LP+++ EL+
Sbjct  768  NSFFGIMSNANYDKKDSTTASQSSHISREELLARVTLSCPKKGEHAKKLIFLPKSLEELL  827

Query  372  SIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
             I  EK  FD + + +  +EGA I+ I VIRD D L +
Sbjct  828  HIGAEK--FDYSATRILSKEGAEIEDIYVIRDGDLLIL  863



>ref|XP_003545498.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=875

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 77/278 (28%), Positives = 122/278 (44%), Gaps = 57/278 (21%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKH  757
            +KD++GN  LW+AI     S+  +L  + A IS   V G L C   + N+  +++ +++ 
Sbjct  601  IKDLDGNVPLWEAIKGGHDSVMKLLIDNGADISSGDV-GSLACVGVEQNNLELLKHIVQC  659

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLT------EVL  595
            G  V     +G+TA+ AA+ E   +++K L+ +GA+ID        P  L       E++
Sbjct  660  GGDVTQSTSNGTTALHAAVCEGNVEIVKFLLEHGADIDKQDGSGWTPRFLADQQCHEEII  719

Query  594  Q-KRELGHRI---AMPNTILHE------------AASK-------WAKDDHQNSSSMPQQ  484
               +++GH+    A+P T   E              SK       W  D+HQ     P  
Sbjct  720  NVFKKVGHKKTPHAIPTTSFFERYQSEPTIPGIPQGSKPPNEEPTWF-DNHQRRRVSPFH  778

Query  483  CSI-------------------RVSIYRGHPATRRETQCPEPG----RLIKLPETIAELI  373
             S                       I R     R    CP+ G    +LI LP+++ EL+
Sbjct  779  NSFFGIMSNANYDKKDSTTASQSSHISREELLARVTLSCPKKGEHAKKLIFLPKSLEELL  838

Query  372  SIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
             I  EK  FD + + +  +EGA I+ I VIRD D L +
Sbjct  839  HIGAEK--FDYSATRILSKEGAEIEDIYVIRDGDLLIL  874



>gb|KHN07100.1| Potassium channel AKT1 [Glycine soja]
Length=880

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/281 (25%), Positives = 120/281 (43%), Gaps = 67/281 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KDM+G+  LW+A+  +  S+  IL    +      AG L C A + N+  +++E+++ G+
Sbjct  601  KDMDGSVPLWEAMKGRHESVMKILIDNGADISFADAGHLACSAVEQNNMELLKEIIQCGM  660

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
             V    ++G+TA+  A+ E   +MI  LV  GA+ID        P  L E  +  E+   
Sbjct  661  DVTQPKKNGATALHTAVVEGNTEMINFLVDQGADIDMQDVNGWTPRVLAEQSESEEI---  717

Query  570  IAMPNTILHE-------AASKWAKDDHQNSS--------SMPQQCSIRVSIYRGH-----  451
                  I H+            +K+D+++          ++PQ+ S+ +  Y G      
Sbjct  718  ----KNIFHDIKDSRKPGVIPISKNDNRSGRFQIDPSMLTIPQE-SMLLPPYDGRRRSSS  772

Query  450  -------------------------PATRRETQ--------CPE----PGRLIKLPETIA  382
                                      +TRR           CPE     G+L+ LP+T+ 
Sbjct  773  SFDNSIFGMMSTANRAKRDLQASESSSTRRSVNGLARVTLSCPEKGEHAGKLVLLPKTLE  832

Query  381  ELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
            EL+ I   K  FD + + +    GA ++ I+++RD D L I
Sbjct  833  ELLDIGARK--FDISATKILTTNGAEVEDINLVRDGDHLII  871



>ref|XP_010435585.1| PREDICTED: potassium channel GORK-like isoform X4 [Camelina sativa]
Length=760

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 114/230 (50%), Gaps = 5/230 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  +   +G+ LC      DS  ++ LL  G
Sbjct  531  LKDKFGNTALFEAVKAGQDGVIGLLVREGASFNIEDSGNFLCTTVAKGDSDFLKRLLLSG  590

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD   +   ++L  
Sbjct  591  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLDEARMCGNKKLIK  650

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             +   N I   ++S+  +     +    ++   + +++  HP   +E    + G ++ +P
Sbjct  651  LLEDGNVIAESSSSQEPQRIQTQTEERIERR--KCTVFPFHPRETKEEPSRKHGVMLWIP  708

Query  393  ETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL++ ++
Sbjct  709  SDLHKLVVSAAQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLFSN  757



>ref|XP_010919840.1| PREDICTED: potassium channel KAT3-like [Elaeis guineensis]
Length=780

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 108/238 (45%), Gaps = 57/238 (24%)
 Frame = -3

Query  825  AGDLLCKAAKMNDSSVMQELLKHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEI  646
             G +LCKAA+ ND   + ELL+ G + +S D +G TA+ AA+++   ++IK+L+  GA +
Sbjct  550  TGSILCKAAENNDLGTIHELLRLGANPNSTDANGRTALHAAVQKGHCEIIKILLEQGAVM  609

Query  645  DDAVKLNLAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAKDDH------------QNS  502
            D+       P  L E     + G +  M     +E +    ++DH            +N+
Sbjct  610  DNPDAGRWTPKTLGE-----KHGEKGTMEPLSSNEKSRTRLENDHEIEFVEMRASTNENN  664

Query  501  SSMPQ-------------------------QCSI----------RVSIYRGHPATRRETQ  427
            +S P+                          C +          R++IY     T+  T+
Sbjct  665  TSYPETRGWSPCFQHSQVADMMTICWEKSGNCLVDKNTMKATNKRITIYMHSQNTKTATE  724

Query  426  CPEPGRLIKLPETIAELISIAGEKL-GFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
              + G+LI LP ++ EL+ I GEK  G+  T   + + E A ID I  +RD D LF++
Sbjct  725  --QVGKLINLPGSMEELLRIGGEKFVGYHPT--KVVNHENAEIDDISTVRDGDHLFLL  778



>gb|KDO49853.1| hypothetical protein CISIN_1g0101682mg, partial [Citrus sinensis]
Length=367

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 110/233 (47%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  LC A    DS  ++ +L +G
Sbjct  147  IKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNG  206

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +   S+D    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  207  VDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLD-----EGRMCGN  261

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L +A      + H  S  M     P++C    +++  HP   +  +    G 
Sbjct  262  KNLI--KLLEDAECTQLSEFHYCSQGMIDKMHPRKC----TVFPFHPWDEKVHR--RHGI  313

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P  I ELI +A +KL F    S L+++ G I+D +D+I D  KL+++++
Sbjct  314  VLWVPHNIEELIKLAVDKLDFPDGHSILSEDGGKILD-VDMINDGQKLYLISE  365



>ref|XP_010435584.1| PREDICTED: potassium channel GORK-like isoform X3 [Camelina sativa]
Length=761

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 114/230 (50%), Gaps = 5/230 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  +   +G+ LC      DS  ++ LL  G
Sbjct  532  LKDKFGNTALFEAVKAGQDGVIGLLVREGASFNIEDSGNFLCTTVAKGDSDFLKRLLLSG  591

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD   +   ++L  
Sbjct  592  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLDEARMCGNKKLIK  651

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             +   N I   ++S+  +     +    ++   + +++  HP   +E    + G ++ +P
Sbjct  652  LLEDGNVIAESSSSQEPQRIQTQTEERIERR--KCTVFPFHPRETKEEPSRKHGVMLWIP  709

Query  393  ETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL++ ++
Sbjct  710  SDLHKLVVSAAQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLFSN  758



>ref|XP_010435582.1| PREDICTED: potassium channel GORK-like isoform X1 [Camelina sativa]
Length=771

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 114/230 (50%), Gaps = 5/230 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  +   +G+ LC      DS  ++ LL  G
Sbjct  542  LKDKFGNTALFEAVKAGQDGVIGLLVREGASFNIEDSGNFLCTTVAKGDSDFLKRLLLSG  601

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD   +   ++L  
Sbjct  602  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLDEARMCGNKKLIK  661

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             +   N I   ++S+  +     +    ++   + +++  HP   +E    + G ++ +P
Sbjct  662  LLEDGNVIAESSSSQEPQRIQTQTEERIERR--KCTVFPFHPRETKEEPSRKHGVMLWIP  719

Query  393  ETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL++ ++
Sbjct  720  SDLHKLVVSAAQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLFSN  768



>gb|AAL25648.1|AF197332_1 inward-rectifying K+ channel [Eucalyptus camaldulensis]
Length=873

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 73/272 (27%), Positives = 116/272 (43%), Gaps = 51/272 (19%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD---LLCKAAKMNDSSVMQELLK  760
            +D EGN  LW+AI      +  +L   A      V+GD     C AA+ N+  +++E+ +
Sbjct  591  RDSEGNVPLWEAIKGGSEPVVKLL---AENGANLVSGDVGQFSCTAAEQNNLDLLKEISR  647

Query  759  HGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKREL  580
            +G  V     +G+TA+  A+ E+  +++K L+  GA+I+        P DL +     E+
Sbjct  648  YGGDVTLPKSNGTTALHVAVSEDNIEIVKFLLDRGADINKPDIHGWTPRDLADQQGHEEI  707

Query  579  G------HRIAMPNTILHE----AASKWAKDDHQNSSSMPQQCS----------------  478
            G          MP  I  E     AS+    D     S P++ +                
Sbjct  708  GILFQSIKETEMPPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTSNFHNSLFGIMSAARD  767

Query  477  ----IRVSI---------YRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLG  349
                + +SI         +   PA R    CPE     G+L+ LPE   EL+ +A +K G
Sbjct  768  GEGDVLLSINHNKSANKPFVARPAIRVVVSCPEVGDVEGKLMLLPENFQELLEMARKKFG  827

Query  348  FDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
               T   +  + GA ID + VIRD D L  ++
Sbjct  828  L--TLLKVLTKNGAEIDDVAVIRDGDHLVFLS  857



>ref|XP_010435583.1| PREDICTED: potassium channel GORK-like isoform X2 [Camelina sativa]
Length=770

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 114/230 (50%), Gaps = 5/230 (2%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNTAL++A+ A +  +  +L    +  +   +G+ LC      DS  ++ LL  G
Sbjct  541  LKDKFGNTALFEAVKAGQDGVIGLLVREGASFNIEDSGNFLCTTVAKGDSDFLKRLLLSG  600

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +++D    T +  A  E    M K+LV  GA I    +   +PLD   +   ++L  
Sbjct  601  MNPNTEDYDHRTPLHVAASEGLYLMAKMLVEAGASISSKDRWGNSPLDEARMCGNKKLIK  660

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             +   N I   ++S+  +     +    ++   + +++  HP   +E    + G ++ +P
Sbjct  661  LLEDGNVIAESSSSQEPQRIQTQTEERIERR--KCTVFPFHPRETKEEPSRKHGVMLWIP  718

Query  393  ETIAELISIAGEKLGF--DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              + +L+  A ++LG   +A+   L+++EG I D ID+I +  KL++ ++
Sbjct  719  SDLHKLVVSAAQELGLSDEASFVILSEDEGRITD-IDMISNGQKLYLFSN  767



>ref|XP_012086443.1| PREDICTED: potassium channel SKOR-like isoform X1 [Jatropha curcas]
 gb|KDP25819.1| hypothetical protein JCGZ_22541 [Jatropha curcas]
Length=834

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 109/232 (47%), Gaps = 16/232 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWA---SISDPYVAGDLLCKAAKMNDSSVMQELL  763
            +KD  GNT L++AI      + S+L       S+ D   AG  LC      DS +++ LL
Sbjct  611  IKDKFGNTPLFEAIKNGHDHVASLLVKQGAHLSLDD---AGSFLCSTVSKGDSDLLKRLL  667

Query  762  KHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRE  583
             +G+  +SKD    T +  A  E    M KLL+  GA +    +    PLD     + R 
Sbjct  668  SNGIDPNSKDYDHRTPLHVAASEGLYIMTKLLLEAGASVSSKDRWGKTPLD-----EGRM  722

Query  582  LGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIR-VSIYRGHPATRRETQCPEPGRL  406
             G++  +   +L +A S    +    S  +  +   R  +++  HP + +E +   PG +
Sbjct  723  CGNKNLI--KLLEDAKSSQLAEFPSQSQEISDKVHKRKCTVFPFHPWSPKENR--RPGIV  778

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            + +P+T+ ELI  A E+L      + +  E G  I  ++ I D  KL+++++
Sbjct  779  LWIPQTMEELIKTAAEQLQLPNDYTCILSENGGKILHVEFIDDGAKLYLISE  830



>gb|KDO49854.1| hypothetical protein CISIN_1g0101682mg, partial [Citrus sinensis]
Length=441

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 110/233 (47%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  LC A    DS  ++ +L +G
Sbjct  221  IKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNG  280

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +   S+D    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  281  VDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLD-----EGRMCGN  335

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L +A      + H  S  M     P++C    +++  HP   +  +    G 
Sbjct  336  KNLI--KLLEDAECTQLSEFHYCSQGMIDKMHPRKC----TVFPFHPWDEKVHR--RHGI  387

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P  I ELI +A +KL F    S L+++ G I+D +D+I D  KL+++++
Sbjct  388  VLWVPHNIEELIKLAVDKLDFPDGHSILSEDGGKILD-VDMINDGQKLYLISE  439



>ref|XP_004250206.1| PREDICTED: potassium channel SKOR-like [Solanum lycopersicum]
Length=829

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 111/229 (48%), Gaps = 18/229 (8%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L +AI      + S+L    ++ +   AG  LC      DS +++ LL +G+ 
Sbjct  610  DKFGNTPLLEAIKIGHDRVASLLVKEGALLNIENAGSFLCMVIARGDSDLLRRLLSNGVD  669

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             ++KD    T +  A  + Q  M KLL+  GA +    +    P+D   V   +++    
Sbjct  670  PNTKDYDQRTPLHVAASQGQYSMAKLLLGAGASVFSKDRWGNTPVDEARVSGNKQM----  725

Query  567  AMPNTILHEAAS----KWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLI  403
                ++L EA S    ++    H+ S  + P++C    ++   HP   ++ +  + G ++
Sbjct  726  ---ISLLEEAKSAQLCEFPDVPHEISDKLRPRKC----TVLPFHPWESKDLR--KHGVVL  776

Query  402  KLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             +P+TI EL++ A E+L F +  S +  E+   I  +D+I D  KL+++
Sbjct  777  WIPQTIEELVTTASEQLDFPSGTSCILSEDAGKILDVDMIVDGQKLYLI  825



>gb|EMS48430.1| Potassium channel SKOR [Triticum urartu]
Length=817

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 106/236 (45%), Gaps = 31/236 (13%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D  GNT L +A+      + ++L+   +  +   AG  LC A    DS  ++  L +G
Sbjct  595  LADKFGNTPLLEAVKQGHDRVAALLFGRGAKLNLENAGSHLCMAVSKGDSDFVRRALAYG  654

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
               DSKD    + +  A  +    M K+LV  GA +    +    PLD     + R+ G 
Sbjct  655  ADPDSKDYDHRSPLHIAAADGLYMMAKMLVDAGASVFATDRWGTTPLD-----EGRKSGS  709

Query  573  RIAMPNTILHEAA-----SKWAKDDHQNSSSMPQQCSIRVSIYRGHP----ATRRETQCP  421
            +   P  +L E A     SK+   D  +    P++CS+    +  HP    A RRE    
Sbjct  710  K---PLMMLLEQAKADELSKFPARDRMH----PRRCSV----FPNHPWDDGAGRRE----  754

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
              G  + +P TI  LI  A EKLG   +   L  E+GA +  +D++ D  KL++V 
Sbjct  755  --GVTLWIPHTIDGLIRSAQEKLGLSGSGLRLLGEDGARVQEVDMVHDGQKLYLVG  808



>gb|AAK83636.1| AT5g37500/mpa22_p_30 [Arabidopsis thaliana]
 gb|AAN28787.1| At5g37500/mpa22_p_30 [Arabidopsis thaliana]
Length=317

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 114/232 (49%), Gaps = 12/232 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  G+T L++A+ A +  +  +L    +  +   +G+ LC      DS  ++ LL  G
Sbjct  89   LKDKFGHTPLFEAVKAGQEGVIGLLVKEGASFNLEDSGNFLCTTVAKGDSDFLKRLLSSG  148

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +S+D    T +  A  E    M K+LV  GA +    +   +PLD   +   ++L  
Sbjct  149  MNPNSEDYDHRTPLHVAASEGLFLMAKMLVEAGASVISKDRWGNSPLDEARLCGNKKL--  206

Query  573  RIAMPNTILHEAASKWAKD--DHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   + +  +S +     + Q      ++C    +++  HP   +E +  + G ++ 
Sbjct  207  -IKLLEDVKNAQSSIYPSSLRELQEERIERRKC----TVFPFHPQEAKEERSRKHGVVVW  261

Query  399  LPETIAELISIAGEKLGFD--ATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            +P  + +LI  A ++LG    A+   L++++G I D ID+I D  KL++++D
Sbjct  262  IPSNLEKLIVTAAKELGLSDGASFVLLSEDQGRITD-IDMISDGHKLYMISD  312



>gb|AAL25649.1|AF197333_1 inward-rectifying K+ channel [Eucalyptus camaldulensis]
Length=873

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 72/270 (27%), Positives = 117/270 (43%), Gaps = 47/270 (17%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSIL-YHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D EGN  LW+AI      +  +L  + A++    V G   C AA+ N+  +++E+ ++G
Sbjct  591  RDSEGNVPLWEAIKGGSEPVVKLLALNGANLVSGDV-GQFSCTAAEQNNLDLLKEISRYG  649

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELG-  577
              V     +G+TA+  A+ E+  +++K L+  GA+I+        P DL +     E+G 
Sbjct  650  GDVTLPKSNGTTALHVAVSEDNIEIVKFLLDRGADINKPDIHGWTPRDLADQQGHEEIGI  709

Query  576  -----HRIAMPNTILHE----AASKWAKDDHQNSSSMPQQCS------------------  478
                     MP  I  E     AS+    D     S P++ +                  
Sbjct  710  LFQSIKETEMPPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTSNFHNSLFGIMSAARDGE  769

Query  477  --IRVSI---------YRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLGFD  343
              + +SI         +   PA R    CPE     G+L+ LPE   EL+ +A +K G  
Sbjct  770  GDVLLSINHNKSANKPFVARPAIRVVVSCPEVGDVEGKLMLLPENFQELLEMARKKFGL-  828

Query  342  ATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
             T   +  + GA ID + VIRD D L  ++
Sbjct  829  -TLLKVLTKNGAEIDDVAVIRDGDHLVFLS  857



>ref|XP_010432708.1| PREDICTED: probable potassium channel AKT5 [Camelina sativa]
Length=882

 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 121/278 (44%), Gaps = 54/278 (19%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D EGN  LW+AI+ +   I  +L    +       G   C A   N    ++++LK+G
Sbjct  604  IRDSEGNVPLWEAISGRHEEIAKLLSENGATLSFDTVGHFSCLAVGQNSLDTLKDILKYG  663

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID---------------------DA  637
              +   D +G+TA+  A+ E   +++K L+   A++D                      A
Sbjct  664  GDISLPDVNGTTALHRAVSEGNVEIVKFLLEQRADMDKPDVYGWTARGLAEHQGHEDIKA  723

Query  636  VKLNLAPLD-----LTEVLQKRELGHRIAMPNTILHEA-----------ASKWAKDDHQN  505
            +  N  P++     ++   + + L    + P  I H +           + +W   + +N
Sbjct  724  LFHNQRPVEKKQNFVSGTPEFKSLMKHCSEPVMIYHRSREAMPPLDRAVSQRWKPSNFKN  783

Query  504  S---------SSMPQQCSIRV-SIYRG----HPA-TRRETQCPEPGRLIKLPETIAELIS  370
            S         + + +  S R  +I  G    +PA      +    G+++KLP+++ EL  
Sbjct  784  SLFGIMSAANTGVERGASTRTAAISEGAGVVYPARVTISGEVSSSGKVVKLPDSLEELFE  843

Query  369  IAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            I  +KLGF AT   +  +EGA ID I +IRD D L ++
Sbjct  844  IGEKKLGFVAT--KILSKEGAEIDDISIIRDGDYLLLL  879



>emb|CAN64951.1| hypothetical protein VITISV_022830 [Vitis vinifera]
Length=559

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 113/233 (48%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            + D  GNT L +AI      + S+L +  ++     AG  LC      DS  ++ +L +G
Sbjct  337  ISDNFGNTPLLEAIKNAHDRVASLLVNKGALLKIDDAGGFLCATIARGDSDFLKRILSNG  396

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+  GA +    +    PLD     +  + G+
Sbjct  397  IDPNSKDYDHRTPLHVAASEGLYFMAKLLLEAGASVFSKDRWGNTPLD-----EGWKCGN  451

Query  573  RIAMPNTILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  M   +L +A     S++     + +  M P++C    +++  HP   +E +   PG 
Sbjct  452  KNLM--KLLEDAKVAQLSEFPDCSREITDKMHPRKC----TVFPFHPWDPKEHK--RPGI  503

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P+TI ELI  A E L F +    L+++ G I+D +D+I D  KL+++ +
Sbjct  504  MLWVPQTIEELIKTATEGLQFSSESCILSEDGGKILD-VDMISDGQKLYLLCE  555



>ref|XP_002529373.1| Potassium channel AKT1, putative [Ricinus communis]
 gb|EEF33040.1| Potassium channel AKT1, putative [Ricinus communis]
Length=901

 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 118/290 (41%), Gaps = 66/290 (23%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KD EGN  LW+A+      +  +L    +       G   C AA+ N+ ++++E+ + G 
Sbjct  589  KDSEGNVPLWEAMVGGHEGVTKLLMENGANIQSGDVGHFACTAAEQNNLNLLKEIARLGG  648

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDL------------  607
             V    ++G+TA+  A+ E+  ++++ L+  GA+ID        P DL            
Sbjct  649  DVTCPRKNGTTALHVAVCEDNTEIVRYLLDQGAKIDKPDIHGWTPRDLADQQGHEEIKFI  708

Query  606  --------TEVLQK----------RELGHRIAMPNT-ILHEAASKWAKDDHQNSSSMPQQ  484
                    TE +            R LG   + PN   L    S    DD   S + P++
Sbjct  709  FETCKEPKTETVVSIPEKPQPPGIRFLGRFTSEPNIRPLSRDGSFTGTDDRSWSQNRPRR  768

Query  483  ----------------------------CSIRVSIYRGHPATRRETQCPEP----GRLIK  400
                                         SI V  Y  +PA R    CPE     G+L+ 
Sbjct  769  RTNNFHNSLFGMMSAAHKGEKELPFPVTPSIGVDNYGTNPA-RVVISCPEKVEIAGKLVL  827

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            LP  + EL+ I  +K G   + + + +++ A ID I+VIRD D +  V+D
Sbjct  828  LPRNLQELVEIGSKKFGL--SHAKVLNKDRAEIDDIEVIRDGDHILFVSD  875



>ref|XP_004289583.1| PREDICTED: potassium channel SKOR isoform X2 [Fragaria vesca 
subsp. vesca]
Length=838

 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 69/232 (30%), Positives = 112/232 (48%), Gaps = 19/232 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  LC A    DS  +++LL +G
Sbjct  616  IKDNFGNTPLLEAIKNAHDRVSSLLIKEGASLNIDNAGSFLCTAIAKGDSDFLKKLLSNG  675

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SK     T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  676  IDPNSKGYDQRTPLHIAASEGLYLMAKLLLEAGASVFSKDRWGNTPLD-----EGRMCGN  730

Query  573  RIAMPNTILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA     S++     + +  M P++C    +++  HP   +E +    G 
Sbjct  731  KNLI--KLLEEAKAAQLSEFPYRAQEIADKMHPKKC----TVFPFHPWDSKEHR--RSGI  782

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            ++ +P TI ELI+ A EKL F      L+++ G I+D ID+I D  KL++V 
Sbjct  783  VLWVPPTIEELINTASEKLEFLGGVCILSEDAGKILD-IDLINDGQKLYLVT  833



>ref|XP_011469478.1| PREDICTED: potassium channel SKOR isoform X1 [Fragaria vesca 
subsp. vesca]
Length=851

 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 69/232 (30%), Positives = 112/232 (48%), Gaps = 19/232 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  LC A    DS  +++LL +G
Sbjct  629  IKDNFGNTPLLEAIKNAHDRVSSLLIKEGASLNIDNAGSFLCTAIAKGDSDFLKKLLSNG  688

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SK     T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  689  IDPNSKGYDQRTPLHIAASEGLYLMAKLLLEAGASVFSKDRWGNTPLD-----EGRMCGN  743

Query  573  RIAMPNTILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L EA     S++     + +  M P++C    +++  HP   +E +    G 
Sbjct  744  KNLI--KLLEEAKAAQLSEFPYRAQEIADKMHPKKC----TVFPFHPWDSKEHR--RSGI  795

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            ++ +P TI ELI+ A EKL F      L+++ G I+D ID+I D  KL++V 
Sbjct  796  VLWVPPTIEELINTASEKLEFLGGVCILSEDAGKILD-IDLINDGQKLYLVT  846



>ref|XP_007023146.1| STELAR K+ outward rectifier isoform 2 [Theobroma cacao]
 gb|EOY25768.1| STELAR K+ outward rectifier isoform 2 [Theobroma cacao]
Length=826

 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 110/229 (48%), Gaps = 11/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GN  L +AI      + ++L    +  +   AG  LC A    DS  ++ +L +G
Sbjct  606  LKDKFGNAPLLEAIKNGHDHVAAMLVREGAYLNIDDAGSFLCAAVVKGDSDFIKRVLSNG  665

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            + ++S+D    TA+  A  E    M KLL+  GA +    +    PLD   +   +   H
Sbjct  666  IDLNSRDYDHRTALHVAASEGLYLMAKLLIEAGASVFTKDRWGNTPLDEGRMCGNK---H  722

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
             I +         +++     + +  M P++C    +++  HP   +E +    G ++ +
Sbjct  723  LIKLLEDAKSTQLTEFPYCSREITDKMHPKKC----TVFPFHPQEAKEQR--RHGIVLWI  776

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P TI +L+  A E+L F      L+++ G I+D +D+I D +KL+++++
Sbjct  777  PHTIEDLVKTAAEQLEFPDGSCVLSEDAGKILD-VDMINDGEKLYLISE  824



>ref|XP_007023145.1| STELAR K+ outward rectifier isoform 1 [Theobroma cacao]
 gb|EOY25767.1| STELAR K+ outward rectifier isoform 1 [Theobroma cacao]
Length=839

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 110/229 (48%), Gaps = 11/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GN  L +AI      + ++L    +  +   AG  LC A    DS  ++ +L +G
Sbjct  619  LKDKFGNAPLLEAIKNGHDHVAAMLVREGAYLNIDDAGSFLCAAVVKGDSDFIKRVLSNG  678

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            + ++S+D    TA+  A  E    M KLL+  GA +    +    PLD   +   +   H
Sbjct  679  IDLNSRDYDHRTALHVAASEGLYLMAKLLIEAGASVFTKDRWGNTPLDEGRMCGNK---H  735

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
             I +         +++     + +  M P++C    +++  HP   +E +    G ++ +
Sbjct  736  LIKLLEDAKSTQLTEFPYCSREITDKMHPKKC----TVFPFHPQEAKEQR--RHGIVLWI  789

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P TI +L+  A E+L F      L+++ G I+D +D+I D +KL+++++
Sbjct  790  PHTIEDLVKTAAEQLEFPDGSCVLSEDAGKILD-VDMINDGEKLYLISE  837



>gb|EMT23906.1| hypothetical protein F775_52673 [Aegilops tauschii]
Length=927

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 105/234 (45%), Gaps = 31/234 (13%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L +A+      + ++L+   +  +   AG  LC A    DS  ++  L +G  
Sbjct  707  DKFGNTPLLEAVKQGHDRVATLLFGRGAKLNLENAGSHLCMAVSKGDSDFVRRALAYGAD  766

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             DSKD    + +  A  +    M K+LV  GA +    +    PLD     + R+ G + 
Sbjct  767  PDSKDYDHRSPLHIAAADGLYMMAKMLVDAGASVFATDRWGTTPLD-----EGRKSGSK-  820

Query  567  AMPNTILHEAA-----SKWAKDDHQNSSSMPQQCSIRVSIYRGHP----ATRRETQCPEP  415
              P  +L E A     SK+   D  +    P++CS+    +  HP    A RRE      
Sbjct  821  --PLMMLLEQAKADELSKFPARDRMH----PRRCSV----FPSHPWDDGAERRE------  864

Query  414  GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            G  + +P TI  LI  A EKLG   +   L  E+GA +  +D++ D  KL++V 
Sbjct  865  GVTLWIPHTIDGLIRSAQEKLGLSGSGLRLLGEDGARVQEVDMVHDGQKLYLVG  918



>gb|AIB06354.1| potassium channel [Saccharum hybrid cultivar]
Length=885

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 128/284 (45%), Gaps = 60/284 (21%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D EG   LW+A+  K +++  +L    +           C A + ND+ +++ ++++G 
Sbjct  591  RDSEGKVPLWEALCEKHNAVIELLVESGAELSSGDTALYACIAVEENDAELLENIIRYGG  650

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLT--------EVL  595
            +++S  + G+T +  A+ +    M++LL+ +GA+ID     + +  DL         +VL
Sbjct  651  NINSSTKDGTTPLHRAVCDGNVQMVELLLEHGADIDKQDNNSWSARDLADQQGHDDIQVL  710

Query  594  QKRELGHR-------------------IAMPNTILHEAASKWAKD----------DHQNS  502
             K    HR                    +MPN + HE A   +K             QNS
Sbjct  711  FKSRKAHRQHASSGRVAPMLIGRFNSEPSMPN-MNHEDAEVRSKVVPQKLLRKRVSFQNS  769

Query  501  ------SSMPQQCSIRVS----IYRGHPATRRET------QCPEPG----RLIKLPETIA  382
                  SS  +Q + R+        G P+ R ++       CPE G    +L++LP ++ 
Sbjct  770  LFGVISSSQARQDTGRLVSKGLAGTGGPSCRHDSLIRVTISCPEKGNAAGKLVRLPRSMT  829

Query  381  ELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            EL+ +  +K GF    + +    GA ID +++IRD D + +V+D
Sbjct  830  ELLELGAKKFGFKP--AKVLTIGGAEIDEVELIRDGDHILLVSD  871



>gb|KDO53362.1| hypothetical protein CISIN_1g003425mg [Citrus sinensis]
Length=662

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 108/230 (47%), Gaps = 12/230 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +AI        S+L    +  +   AG  LC A    DS +++ +L +G
Sbjct  441  LKDNFGNTPLLEAIKYGNDGAASLLVKEGASLNVEEAGSFLCTAVARGDSDLLKRVLSNG  500

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +++D    T +  A  E    M KLLV  GA +    +    PLD   +   + L  
Sbjct  501  IDPNTRDYDLRTPLHVAASEGLYLMAKLLVEAGASVFPKDRWGNTPLDEGRMCGNKNLIK  560

Query  573  RI--AMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             +  A    +L          D +N +   ++C    +++  HP   +E++    G ++ 
Sbjct  561  LLEDAKSTQLLEFPHGFQDTADKRNPT---RKC----TVFPFHPWDAKESR--RHGIVLW  611

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            +P+ I +LI  A E+L F   D  L+ E G I+D +D+I D+ KL+++ +
Sbjct  612  IPQNIKDLIKTAAEQLDFRGGDCILSSEGGKILD-VDMINDDQKLYLIQE  660



>gb|KDO53361.1| hypothetical protein CISIN_1g003425mg [Citrus sinensis]
Length=821

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 111/237 (47%), Gaps = 26/237 (11%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +AI        S+L    +  +   AG  LC A    DS +++ +L +G
Sbjct  600  LKDNFGNTPLLEAIKYGNDGAASLLVKEGASLNVEEAGSFLCTAVARGDSDLLKRVLSNG  659

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLD---------LTE  601
            +  +++D    T +  A  E    M KLLV  GA +    +    PLD         L +
Sbjct  660  IDPNTRDYDLRTPLHVAASEGLYLMAKLLVEAGASVFPKDRWGNTPLDEGRMCGNKNLIK  719

Query  600  VLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCP  421
            +L+  +    +  P+     A       D +N +   ++C    +++  HP   +E++  
Sbjct  720  LLEDAKSTQLLEFPHGFQDTA-------DKRNPT---RKC----TVFPFHPWDAKESR--  763

Query  420  EPGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              G ++ +P+ I +LI  A E+L F   D  L+ E G I+D +D+I D+ KL+++ +
Sbjct  764  RHGIVLWIPQNIKDLIKTAAEQLDFRGGDCILSSEGGKILD-VDMINDDQKLYLIQE  819



>gb|KCW79761.1| hypothetical protein EUGRSUZ_C011052, partial [Eucalyptus grandis]
Length=293

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 115/280 (41%), Gaps = 60/280 (21%)
 Frame = -3

Query  921  EGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHV  745
            EG+  LW+A+      +  +L  + A+IS   V G   C AA+ N+  +++E++ +G  V
Sbjct  2    EGSVPLWEAMLGGHDPVVKLLAENGANISSGDV-GQFACTAAEQNNLYLLKEIVHYGGDV  60

Query  744  DSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKREL-----  580
                 HG+TA+  A+ E+  +++K L+  GA++D        P DL +     E+     
Sbjct  61   TLPSSHGNTALHIAVSEDNLEIVKFLLEQGADMDKPDTYGWTPRDLADQQGHEEIKLLFQ  120

Query  579  GHRIAMPNTIL------HEAAS---------------------KWAK-------DDHQNS  502
                A P +++      HEA S                      W +       ++  NS
Sbjct  121  SSEDAKPQSVIAIPEKHHEARSLGRFTSEPMIRPASRESNVEGSWGQSRPRRRSNNFHNS  180

Query  501  -------------SSMPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPETIAELI  373
                           MP       S+  G    R    CPE     G+L+ LP ++ EL+
Sbjct  181  LFGVMSAAHKGKKREMPFPVDQVHSVKSGIDPARVTISCPEIGDSAGKLVLLPGSLEELL  240

Query  372  SIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
                +K GF    + +  + GA +D I+VIRD D L  V 
Sbjct  241  QTGAKKFGF--MPAKILMKNGAEVDDIEVIRDGDHLIFVG  278



>ref|XP_008795354.1| PREDICTED: potassium channel KOR1 [Phoenix dactylifera]
Length=817

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 115/234 (49%), Gaps = 22/234 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D  GNT L++AI      + S+L+   +      AG  LC AA   DS  ++  L +G
Sbjct  589  LSDNFGNTPLFEAIKDGHDRVASLLFSRGAQLSLKDAGSQLCAAAAEGDSDFIKRALSYG  648

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    TA+  A  E    + KLL+  GA +    +    PLD     + R+ G+
Sbjct  649  VDPNSKDYDHRTALHIAAAEGLYFIAKLLLDAGASVFAMDRWGATPLD-----EARKSGN  703

Query  573  RIAMPNTILHEAA-----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPG  412
            +  M   +L E A     SK+ +   +    M P++C    +++  HP   +E +    G
Sbjct  704  KSLM---LLLEGAKSDELSKFPERAREVQDKMHPRRC----TVFPFHPWDSKEER--REG  754

Query  411  RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +P T+ +LI  + E+L   ++ S +  E+GA I  +D+I D  KL++VAD
Sbjct  755  VMLWIPCTMEKLIRSSREQL--KSSGSRILSEDGARILDVDMISDGQKLYLVAD  806



>ref|XP_003616247.1| Potassium channel SKOR [Medicago truncatula]
Length=874

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/231 (29%), Positives = 108/231 (47%), Gaps = 20/231 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +A+      I S+L    +       G  LC A    DS  ++ LL +G
Sbjct  655  VKDNFGNTPLLEAVKNGHDRIASLLVREGASLKIDDGGSFLCSAVARGDSDYLKRLLSNG  714

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  + KD    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  715  MDANLKDYDYRTPLHVAASEGLIFMAKLLLEAGASVFTKDRWGNTPLD-----EARMSGN  769

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRV-----SIYRGHPATRRETQCPEPGR  409
            +  +   +L +A S             PQ+ + +V     +++  HP   +E +    G 
Sbjct  770  KNLIK--LLEDAKSA-----QLTEFPFPQEITDKVHPKKCTVFPFHPWDPKEQR--RNGI  820

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            ++ +P TI ELI  A E++GF +    L+++ G IID I +I+D+ KL++V
Sbjct  821  VLWIPHTIQELIITAAEQIGFSSDACILSEDAGKIID-ISMIKDDQKLYLV  870



>gb|EMS61998.1| Potassium channel AKT1 [Triticum urartu]
Length=742

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 117/271 (43%), Gaps = 52/271 (19%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D EG   LW+A+ AK  ++  +L    +           C A + N+  +++++LKH +
Sbjct  467  RDSEGKVPLWEAVYAKHDTVVQLLVKGGAELSSGDTSLYACTAVEQNNIELLKQILKHVI  526

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRE---L  580
             V+   + G+  +  A+ +   +M++LL+ +GA+ID        P  L E     E   L
Sbjct  527  DVNRPSKDGNIPLHRAVCDGNVEMVELLLRHGADIDKQDSNGWTPRALAEQQGHEEIQNL  586

Query  579  GHRIAMPNTILHEAASKWAKDD--HQNSSSMPQ--QCSIRVSIY----RGHPATRRET--  430
               +  P     +  S   ++D   Q S  +PQ  + S   S++      HP  RRET  
Sbjct  587  FRSVIAP----RKYTSNVIREDVEQQPSKVLPQRRKVSFHNSLFGVISSAHP--RRETDH  640

Query  429  ---------------------------QCPE----PGRLIKLPETIAELISIAGEKLGFD  343
                                        CPE     G+L+ LP +I EL+ +  +K  FD
Sbjct  641  LLSRGLAATGGPTYPQAHHNPLIRVTISCPEMGNTAGKLVILPGSIKELLQLGAKK--FD  698

Query  342  ATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
               + +   EGA +D +++IRD D L + +D
Sbjct  699  MMPTKVLTIEGAEVDEVELIRDGDHLVLASD  729



>gb|KFK33311.1| hypothetical protein AALP_AA6G358500 [Arabis alpina]
Length=815

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 108/229 (47%), Gaps = 10/229 (4%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +A+ A    + S+L    +  D   +G+ LC A    DS  +++LL  G
Sbjct  591  LKDKFGNTPLLEAVKAGHDKVISLLVKEGASFDLEDSGNFLCTAVVKGDSDFLKKLLSSG  650

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +++D    T +  A  E    M K+LV  GA +    +   +PLD     + R  G+
Sbjct  651  MDPNTEDYDHRTPLHIAASEGLYLMAKMLVEAGASVVAKDRWGNSPLD-----EARMCGN  705

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            +  +   +L +A  K A       SS   Q   + +I+  HP   +E    + G ++ +P
Sbjct  706  KKLIK--LLEDA--KTAHSSIYPESSHGLQERRKCTIFPFHPREAKEEHNRKHGVVVWIP  761

Query  393  ETIAELISIAGEKLGFDATDSS-LTDEEGAIIDSIDVIRDNDKLFIVAD  250
              I +L+  A ++LG     S  +  E+G    +ID+I D  KL++ +D
Sbjct  762  SDIRKLVETAVQELGISNEGSFVILSEDGGRFTNIDMITDGQKLYLTSD  810



>gb|AES99205.2| potassium outward rectifying channel protein [Medicago truncatula]
Length=835

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/231 (29%), Positives = 108/231 (47%), Gaps = 20/231 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +A+      I S+L    +       G  LC A    DS  ++ LL +G
Sbjct  616  VKDNFGNTPLLEAVKNGHDRIASLLVREGASLKIDDGGSFLCSAVARGDSDYLKRLLSNG  675

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  + KD    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  676  MDANLKDYDYRTPLHVAASEGLIFMAKLLLEAGASVFTKDRWGNTPLD-----EARMSGN  730

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRV-----SIYRGHPATRRETQCPEPGR  409
            +  +   +L +A S             PQ+ + +V     +++  HP   +E +    G 
Sbjct  731  KNLIK--LLEDAKSA-----QLTEFPFPQEITDKVHPKKCTVFPFHPWDPKEQR--RNGI  781

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            ++ +P TI ELI  A E++GF +    L+++ G IID I +I+D+ KL++V
Sbjct  782  VLWIPHTIQELIITAAEQIGFSSDACILSEDAGKIID-ISMIKDDQKLYLV  831



>ref|XP_004140369.2| PREDICTED: potassium channel SKOR [Cucumis sativus]
 ref|XP_011655224.1| PREDICTED: potassium channel SKOR [Cucumis sativus]
 gb|KGN51027.1| hypothetical protein Csa_5G409690 [Cucumis sativus]
Length=828

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 115/232 (50%), Gaps = 17/232 (7%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWAS---ISDPYVAGDLLCKAAKMNDSSVMQELL  763
            LKD  GNT L +AI      +  +L    +   + +P   G  LC A    DS +++ LL
Sbjct  608  LKDNFGNTPLMEAIKNGNDQVAVLLSKEGASLKVDNP---GSFLCTAVSRGDSDLVKRLL  664

Query  762  KHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRE  583
             +G+  +SKD    T +  A+ E    M KLL+ +GA +    +    PLD     + R 
Sbjct  665  CYGIDPNSKDYDSRTPLHIAVSEGLTLMAKLLLESGASVFSKDRWGNTPLD-----EGRI  719

Query  582  LGHRIAMPNTILHEA-ASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRL  406
             G++  +   +L EA AS+ ++  + +     ++ + + +++  HP    E +   PG +
Sbjct  720  CGNKNML--KLLEEAKASQLSESPYSSREFTDKKPTKKCTVFPFHPWDPEENK--RPGIM  775

Query  405  IKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            + +P TI ELI  + E+L        L+++ G I+D + +I ++ KL++V D
Sbjct  776  LWVPLTIEELIKESSEQLQVSGECCILSEDGGKILD-VHMIDESQKLYLVPD  826



>ref|XP_006421368.1| hypothetical protein CICLE_v10004332mg [Citrus clementina]
 gb|ESR34608.1| hypothetical protein CICLE_v10004332mg [Citrus clementina]
Length=816

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 110/233 (47%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  LC A    DS  ++ +L +G
Sbjct  596  IKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNG  655

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +   S+D    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  656  VDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLD-----EGRMCGN  710

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L +A      + H  S  M     P++C    +++  HP   +  +    G 
Sbjct  711  KNLIK--LLEDAECTQLSEFHYCSQGMIDKMHPRKC----TVFPFHPWDEKVHR--RHGI  762

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P  I ELI +A +KL F    S L+++ G I+D +D+I D  KL+++++
Sbjct  763  VLWVPHNIEELIKLAVDKLDFLDGHSILSEDGGKILD-VDMINDGQKLYLISE  814



>ref|XP_009147315.1| PREDICTED: potassium channel SKOR isoform X2 [Brassica rapa]
Length=827

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 104/228 (46%), Gaps = 11/228 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + ++L    +      AG  LC      DS  ++ LL +G
Sbjct  610  IKDKLGNTPLLEAIKNGNDRVAALLVKEGATLSIENAGTFLCTVVAKGDSDFLKRLLNNG  669

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    + + LV  GA +    +    PLD   V      G+
Sbjct  670  IDPNSKDYDQRTPLHVASSEGLYLLARQLVEAGANVLKKDRWGNTPLDEALV-----CGN  724

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
            ++ +    L E A         NSS   +    + ++Y  HP   +E +    G ++ +P
Sbjct  725  KMLIK---LLEDAKTSQMSTFLNSSKEIKVYKKKCTVYSSHPNDSKEKR--RRGIVLWVP  779

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++I EL+  A E+L F      L+++EG IID +++I D  KL++  +
Sbjct  780  KSIEELVRSAAEQLNFPEASCVLSEDEGKIID-VELISDGQKLYLTVE  826



>ref|NP_198566.2| potassium channel GORK [Arabidopsis thaliana]
 sp|Q94A76.2|GORK_ARATH RecName: Full=Potassium channel GORK; AltName: Full=Guard cell 
outward rectifying K(+) channel; Short=AtGORK [Arabidopsis 
thaliana]
 gb|AED94198.1| potassium channel GORK [Arabidopsis thaliana]
Length=820

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 114/232 (49%), Gaps = 12/232 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  G+T L++A+ A +  +  +L    +  +   +G+ LC      DS  ++ LL  G
Sbjct  592  LKDKFGHTPLFEAVKAGQEGVIGLLVKEGASFNLEDSGNFLCTTVAKGDSDFLKRLLSSG  651

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +S+D    T +  A  E    M K+LV  GA +    +   +PLD   +   ++L  
Sbjct  652  MNPNSEDYDHRTPLHVAASEGLFLMAKMLVEAGASVISKDRWGNSPLDEARLCGNKKL--  709

Query  573  RIAMPNTILHEAASKWAKD--DHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   + +  +S +     + Q      ++C    +++  HP   +E +  + G ++ 
Sbjct  710  -IKLLEDVKNAQSSIYPSSLRELQEERIERRKC----TVFPFHPQEAKEERSRKHGVVVW  764

Query  399  LPETIAELISIAGEKLGFD--ATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            +P  + +LI  A ++LG    A+   L++++G I D ID+I D  KL++++D
Sbjct  765  IPSNLEKLIVTAAKELGLSDGASFVLLSEDQGRITD-IDMISDGHKLYMISD  815



>ref|XP_006364280.1| PREDICTED: potassium channel AKT1-like [Solanum tuberosum]
Length=847

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 117/287 (41%), Gaps = 63/287 (22%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            KD EGN  LWDAI  K  ++  +L  + A+IS   V G   C A +     +++E++K+G
Sbjct  566  KDSEGNVPLWDAIVGKHEAVVKLLVDNGATISSGDV-GQFACFAVEQGSLDLLKEIIKYG  624

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
              V   +  G+TAI  A+ E   +++K L+  G +ID A      P  L E     E+  
Sbjct  625  GDVTLLNSLGTTAIHTAISEENVEIVKFLLEQGTDIDKADVHGWTPRALAEYQGHGEIKE  684

Query  573  RI------------------------------AMPNTILHEAASKWAKDD---------H  511
                                            A+P  I  E A +    +          
Sbjct  685  LFNLMQPTSKETNVCPPEAPFAPYLMKYQSDPAIPLFIHEETARETGSSNGRLRRRASFF  744

Query  510  QNS--------------SSMPQQCSIRVSIYRGHPATRRETQCPEPG----RLIKLPETI  385
            QNS                 P+  S +++  R    +R   +C E      R + LP++I
Sbjct  745  QNSLIGFVAARQRHHEGGGGPEYSSTKIANSR--IPSRITIRCLEKAHIGRRAVLLPDSI  802

Query  384  AELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
             EL+ I  EK G   + + +  E+GA+I+ I+VIRD D L +    N
Sbjct  803  NELLDIGAEKFG--VSLAKVLTEDGALIEDIEVIRDGDHLVLATSEN  847



>gb|KHN06658.1| Potassium channel AKT1 [Glycine soja]
Length=850

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 71/278 (26%), Positives = 121/278 (44%), Gaps = 57/278 (21%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKH  757
            +KD++GN  LW+AI     S+  +L  + A IS   V G L C +   N+  +++++++ 
Sbjct  576  IKDLDGNVPLWEAIKGGHDSVMKLLIDNGADISSGDV-GSLACISVAQNNLELLKDIVQC  634

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAP------------L  613
            G  V     +GSTA+ AA+ E  A+++K L+ +GA+ID      L P            +
Sbjct  635  GGDVTRSASNGSTALHAAVCEGNAEIVKFLLEHGADIDKQDDSGLTPRILADQQCHEEII  694

Query  612  DLTEVLQKRELGHRIAMPNTI-----------LHEAAS------KWAKDDHQNSSSMPQQ  484
            ++ + + + +  H I   + +           +H+ +        W  D+HQ     P  
Sbjct  695  NIFKKVGQNKAPHGIPTTSFVARCQSKPTILGIHQGSKPPNEEVTWF-DNHQRRKMSPFH  753

Query  483  CSI-------------------RVSIYRGHPATRRETQCPEPG----RLIKLPETIAELI  373
             S                         R     R    CPE G    +L+ LP+++ EL+
Sbjct  754  NSFFGIMSTENYDKKDSTSSSKTSHTSREELPARVTLSCPEKGEHGKKLVFLPKSLEELL  813

Query  372  SIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFI  259
             I  EK  FD + + +  +E A I+ I VIRD D L +
Sbjct  814  RIGAEK--FDFSPTKILSKERAEIEDIYVIRDGDLLIL  849



>ref|XP_007161234.1| hypothetical protein PHAVU_001G053200g [Phaseolus vulgaris]
 gb|ESW33228.1| hypothetical protein PHAVU_001G053200g [Phaseolus vulgaris]
Length=873

 Score = 74.3 bits (181),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 77/280 (28%), Positives = 118/280 (42%), Gaps = 58/280 (21%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKH  757
            +KDMEGN+ALW+AI     ++  IL  + A IS   V  D    A + N+  +++E+++ 
Sbjct  598  MKDMEGNSALWEAIKGGHETVMRILVENGAEISSNNVV-DYARLAIEKNNLEILKEIIQR  656

Query  756  GLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRE--  583
            G  V       +T + AA+ E  ++++K LV  GA+ID    + L    L E     E  
Sbjct  657  GGDVMQCSDKMTTLLHAAVCEGNSEIVKYLVELGADIDRQDSVGLTARSLAEHQCHEEIL  716

Query  582  -----LGHR-----IAMPNTILHEAASK------------------WAKDDHQNSSSMPQ  487
                 +GH+     I   +T +    S+                  W  D+HQ     P 
Sbjct  717  NIFNTIGHKNERNGIPQISTFVGRCQSEPTIPALPLPIKPPNKELTWF-DNHQRRRVSPF  775

Query  486  QCSI-------------------RVSIYRGHPATRRETQCPEPG----RLIKLPETIAEL  376
              S                         +     R    CPE G    +L+ LP++I EL
Sbjct  776  HNSFFGIMSSANYGKNDSTTSSQTSQSIKEEVLPRITLSCPEKGEDAKKLLFLPDSINEL  835

Query  375  ISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
            + +  +K  F+ T S +   EGA I+ IDVIRD D L +V
Sbjct  836  LRVGAKK--FNCTPSKILTTEGAQIEDIDVIRDGDHLLLV  873


 Score = 22.3 bits (46),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 8/11 (73%), Positives = 9/11 (82%), Gaps = 0/11 (0%)
 Frame = -1

Query  971  CVXVLLKHGCN  939
            CV VLL+HG N
Sbjct  585  CVIVLLEHGAN  595



>emb|CAC17380.1| guard cell outward rectifying K+ channel [Arabidopsis thaliana]
Length=820

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 114/232 (49%), Gaps = 12/232 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  G+T L++A+ A +  +  +L    +  +   +G+ LC      DS  ++ LL  G
Sbjct  592  LKDKFGHTPLFEAVKAGQEGVIGLLVKEGASFNLEDSGNFLCTTVAKGDSDFLKRLLSSG  651

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +S+D    T +  A  E    M K+LV  GA +    +   +PLD   +   ++L  
Sbjct  652  MNPNSEDYDHRTPLHVAASEGLFLMAKMLVEAGASVISKDRWGNSPLDEARLCGNKKL--  709

Query  573  RIAMPNTILHEAASKWAKD--DHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIK  400
             I +   + +  +S +     + Q      ++C    +++  HP   +E +  + G ++ 
Sbjct  710  -IKLLEDVKNAQSSIYPSSLRELQEERIERRKC----TVFPFHPQEAKEERSRKHGVVVW  764

Query  399  LPETIAELISIAGEKLGFD--ATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            +P  + +LI  A ++LG    A+   L++++G I D ID+I D  KL++++D
Sbjct  765  VPSNLEKLIVTAAKELGLSDGASFVLLSEDQGRITD-IDMISDGHKLYMISD  815



>ref|XP_010047779.1| PREDICTED: potassium channel AKT1-like isoform X1 [Eucalyptus 
grandis]
Length=885

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 117/283 (41%), Gaps = 60/283 (21%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D EG+  LW+A+      +  +L  + A+IS   V G   C AA+ N+  +++E++ +G
Sbjct  591  RDSEGSVPLWEAMLGGHDPVVKLLAENGANISSGDV-GQFACTAAEQNNLYLLKEIVHYG  649

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
              V     HG+TA+  A+ E+  +++K L+  GA++D        P DL +     E+  
Sbjct  650  GDVTLPSSHGNTALHIAVSEDNLEIVKFLLEQGADMDKPDTYGWTPRDLADQQGHEEIKL  709

Query  573  RI-----AMPNTIL------HEAAS---------------------KWAK-------DDH  511
                   A P +++      HEA S                      W +       ++ 
Sbjct  710  LFQSSEDAKPQSVIAIPEKHHEARSLGRFTSEPMIRPASRESNVEGSWGQSRPRRRSNNF  769

Query  510  QNS-------------SSMPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPETIA  382
             NS               MP       S+  G    R    CPE     G+L+ LP ++ 
Sbjct  770  HNSLFGVMSAAHKGKKREMPFPVDQVHSVKSGIDPARVTISCPEIGDSAGKLVLLPGSLE  829

Query  381  ELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            EL+    +K GF    + +  + GA +D I+VIRD D L  V 
Sbjct  830  ELLQTGAKKFGF--MPAKILMKNGAEVDDIEVIRDGDHLIFVG  870



>ref|XP_006286320.1| hypothetical protein CARUB_v100041251mg, partial [Capsella rubella]
 gb|EOA19218.1| hypothetical protein CARUB_v100041251mg, partial [Capsella rubella]
Length=752

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 109/229 (48%), Gaps = 13/229 (6%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KD  GNT L++A+ A +  +  +L    +  D   +G+ LC      DS  ++ LL  GL
Sbjct  530  KDKFGNTPLFEAVKAGQEGVIRLLVKEGASFDLEDSGNFLCATVVKGDSDFLKRLLLSGL  589

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
              +++D    T +  A  E    M K+L+  GA +    +    P+D   +   ++L   
Sbjct  590  DPNTEDYDHRTPLHVAASEGLYLMAKMLLEAGASVVSKDRWGNTPIDEARMCGNKKLIKL  649

Query  570  IAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
            +   NT      ++ +  + Q      ++C    +++  HP   +E +  + G ++ +P 
Sbjct  650  LEDANT------AQPSSHEQQQERVQRRKC----TVFPFHPREAKEERKRKHGVMVWIPS  699

Query  390  TIAELISIAGEKLGFDATDSS--LTDEEGAIIDSIDVIRDNDKLFIVAD  250
             +  LI  A ++LG    DS   L++++G + D ID+I +  KL++++D
Sbjct  700  DLQTLILTAAQELGLSDEDSFVILSEDQGRVTD-IDMISNEQKLYMISD  747



>ref|XP_004490839.1| PREDICTED: potassium channel SKOR-like [Cicer arietinum]
Length=839

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 102/226 (45%), Gaps = 10/226 (4%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +A+      + S+L    +       G  LC A    DS  ++ LL +G
Sbjct  620  VKDNFGNTPLLEAVKNGHDRVASLLVREGASMRIENGGSFLCTAVARGDSDYLKRLLSNG  679

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  + KD    T +  A  E    M KLL+  GA +    +    PLD   +   + L  
Sbjct  680  VDPNLKDYDYRTPLHVAASEGLIFMAKLLLDAGASVFTKDRWGNTPLDEARMSGNKNL--  737

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLP  394
             I +         S +           P++C    +++  HP   +E +    G ++ +P
Sbjct  738  -IKLLEDAKSAQLSAFPCSQEITDKVHPKKC----TVFPFHPWDPKEHR--SNGIVLWVP  790

Query  393  ETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             TI ELI  A E++GF +    L+++ G IID + +I+D+ KL++V
Sbjct  791  HTIEELIKTAAEQIGFSSDSCILSEDAGKIID-VSMIKDDQKLYLV  835



>gb|EEE55080.1| hypothetical protein OsJ_02815 [Oryza sativa Japonica Group]
Length=884

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 67/280 (24%), Positives = 119/280 (43%), Gaps = 63/280 (23%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D EG   LW+A+  K  ++  +L    +       G   C A + +D+ ++ +++ +G 
Sbjct  611  RDSEGKVPLWEALCEKHAAVVQLLVEGGADLSSGDTGLYACIAVEESDTELLNDIIHYGG  670

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE----------  601
             V+   R G+TA+  A+ +    M +LL+ +GA+ID        P  L E          
Sbjct  671  DVNRARRDGTTALHRAVCDGNVQMAELLLEHGADIDKQDGNGWTPRALAEQQGHDDIQLL  730

Query  600  ---------------------VLQKRELGHRIAMPNTILHEAASKWAK--DDHQ------  508
                                 VL ++    R+   N++    +S  A+   DH       
Sbjct  731  FRSRKAATGEWPPSDADLPSRVLPEKLRRKRVTFQNSLFGVISSSQAQRETDHPLSRGGL  790

Query  507  ------NSSSMPQQCSIRVSIYRGHPATRRETQCPEPG----RLIKLPETIAELISIAGE  358
                  N SS  +   IRV+I            CPE G    +L+ LP+T+  L+ +  +
Sbjct  791  AATGSPNPSSGSRNAVIRVTI-----------SCPEKGNTAGKLVLLPQTLDMLLELGAK  839

Query  357  KLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA-DWNS  241
            K  FD   + +   EGA +D +++IRD D L +V+ +W++
Sbjct  840  K--FDFAPTKVLTVEGAEVDEVELIRDGDHLVLVSNEWDA  877



>gb|KDP32353.1| hypothetical protein JCGZ_13278 [Jatropha curcas]
Length=635

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 118/289 (41%), Gaps = 65/289 (22%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KD EGN  LW+A+     S+  +L    +       G   C AA+ N+ ++++E++++G 
Sbjct  337  KDSEGNVPLWEAMVGGHESVTRLLIENGASLKSGDVGHFACTAAEQNNLNLLKEIVRYGG  396

Query  750  HVD--SKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLT---------  604
             V      + G+TA+  A+ E   ++ + L+  GA ID        P DL          
Sbjct  397  DVTCPCPRKSGTTALHVAVCEENIEIARFLLDQGANIDKPDIHGWTPRDLADQQGHEQIK  456

Query  603  -------------------EVLQKRELGHRIAMPNT--ILHEAA-----SKWAKDDHQNS  502
                               E  + R LG   + P    + HE +       W+++  +  
Sbjct  457  LIFQNFCKEPKSQSVVAIPERQEPRYLGRFTSEPTIRPLSHEGSFSGTDRSWSQNRPRRR  516

Query  501  SS---------------------MPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKL  397
            ++                      P   SI V  Y  +PA R    CPE     G+L+ L
Sbjct  517  TNNFHNSLFGMMSAANKGDKELPFPVTPSIGVDKYGANPA-RVVISCPERLGIAGKLVLL  575

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P+T+ EL+ I  +K  F+     +  ++ A I+ I+VIRD D +  V+D
Sbjct  576  PKTLQELLEIGAKK--FELNHPKILSKDRAEIEDIEVIRDGDHILFVSD  622



>gb|AAN78090.2| putative AKT1-like potassium channel [Hordeum vulgare]
Length=593

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 125/291 (43%), Gaps = 70/291 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD---LLCKAAKMNDSSVMQELLK  760
            +D EG   LW+A+ AK  ++  +L    +      AGD     C A + ND  +++++LK
Sbjct  299  RDSEGKVPLWEAVYAKHDTVVQLLIKGGA---ELSAGDTSLYACTAVEQNDIELLKQILK  355

Query  759  HGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE-------  601
            H + V+   + G+  +  A+ +   +M++LL+ +GA+ID        P  L E       
Sbjct  356  HVIDVNRPSKDGNIPLHRAVCDGNVEMVELLLRHGADIDKQDSNGWTPRALAEQQGHEEI  415

Query  600  ------VLQKRELGHRIAMPNTILHEAAS-----KWAKDD--HQNSSSMPQ--QCSIRVS  466
                  V+  R+      +   +L   +S     K  ++D   Q S  +PQ  + S   S
Sbjct  416  QNLFRSVVAPRKYTSNGRVTPMLLGRFSSDPSMQKVIREDAEQQPSKVLPQRRKVSFHNS  475

Query  465  IY----RGHPATRRETQ-----------------------------CPEP----GRLIKL  397
            ++      HP  RRET                              CPE     G+L+ L
Sbjct  476  LFGVISSSHP--RRETDHLLSRGLAATGGPSYPQAHHRPLIRVTIGCPEKGNTAGKLVIL  533

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA-DW  247
            P ++ EL+ +  +K  FD   + +   EGA +D +++IRD D L + + DW
Sbjct  534  PGSMKELLQLGAKK--FDMMPTKVLTIEGAEVDEVELIRDGDHLVLASDDW  582



>gb|AAP21250.1| At2g26650 [Arabidopsis thaliana]
Length=752

 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 108/278 (39%), Gaps = 52/278 (19%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D EG+  LW+A+      +  +L    S  D    G   C AA+  +  +++E++ HG 
Sbjct  475  RDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGG  534

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE----------  601
             V      G++A+  A+ E   +M+K L+  GA+++        P DL E          
Sbjct  535  DVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKAL  594

Query  600  -------------------VLQK--RELGHRIAMPNT---------ILHEAASKWAKDDH  511
                               +L+   R LG   + PN           + E  ++   ++ 
Sbjct  595  FREKLHERRVHIETSSSVPILKTGIRFLGRFTSEPNIRPASREVSFRIRETRARRKTNNF  654

Query  510  QNS-------SSMPQQCSIRVSIYRGHPATRRETQCPEP----GRLIKLPETIAELISIA  364
             NS        S+P+     V   R     R    C E     G+L+ LP +  EL+ + 
Sbjct  655  DNSLFGILANQSVPKNGLATVDEGRTGNPVRVTISCAEKDDIAGKLVLLPGSFKELLELG  714

Query  363  GEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              K G  AT   +  +  A ID +DVIRD D L    D
Sbjct  715  SNKFGIVAT-KVMNKDNNAEIDDVDVIRDGDHLIFATD  751



>ref|NP_180233.1| potassium channel AKT1 [Arabidopsis thaliana]
 sp|Q38998.2|AKT1_ARATH RecName: Full=Potassium channel AKT1 [Arabidopsis thaliana]
 gb|AAA96810.1| AKT1 [Arabidopsis thaliana]
 emb|CAA44693.1| Potassium tranporter [Arabidopsis thaliana]
 gb|AAB95299.1| K+ transporter, AKT1 [Arabidopsis thaliana]
 dbj|BAH20386.1| AT2G26650 [Arabidopsis thaliana]
 gb|AEC07870.1| potassium channel AKT1 [Arabidopsis thaliana]
Length=857

 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 108/278 (39%), Gaps = 52/278 (19%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D EG+  LW+A+      +  +L    S  D    G   C AA+  +  +++E++ HG 
Sbjct  580  RDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGG  639

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE----------  601
             V      G++A+  A+ E   +M+K L+  GA+++        P DL E          
Sbjct  640  DVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKAL  699

Query  600  -------------------VLQK--RELGHRIAMPNT---------ILHEAASKWAKDDH  511
                               +L+   R LG   + PN           + E  ++   ++ 
Sbjct  700  FREKLHERRVHIETSSSVPILKTGIRFLGRFTSEPNIRPASREVSFRIRETRARRKTNNF  759

Query  510  QNS-------SSMPQQCSIRVSIYRGHPATRRETQCPEP----GRLIKLPETIAELISIA  364
             NS        S+P+     V   R     R    C E     G+L+ LP +  EL+ + 
Sbjct  760  DNSLFGILANQSVPKNGLATVDEGRTGNPVRVTISCAEKDDIAGKLVLLPGSFKELLELG  819

Query  363  GEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              K G  AT   +  +  A ID +DVIRD D L    D
Sbjct  820  SNKFGIVAT-KVMNKDNNAEIDDVDVIRDGDHLIFATD  856



>ref|XP_010325113.1| PREDICTED: potassium channel AKT1-like [Solanum lycopersicum]
Length=862

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 115/287 (40%), Gaps = 63/287 (22%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            KD EGN  LWDA+  K  ++  +L  + A IS   V G     A +     +++E++K+G
Sbjct  581  KDSEGNVPLWDAMVGKHEAVIKLLVDNGAKISSGDV-GQFASFAVEQGSLDLLKEIIKYG  639

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
              V   +  G+TA+  A+ E  A+++K L+  GA+ID A      P  L E    +E+  
Sbjct  640  GDVTLLNSLGTTALHTAISEENAEIVKFLLEQGADIDKADVHGWTPRALAEFQGHKEIKE  699

Query  573  RI------------------------------AMPNTILHEAASKW--------------  526
                                            A+P  I  E A +               
Sbjct  700  LFNLMQPASKETNVCPPEAPCAPYLMKYQSDPAIPLFIPEETARETGSSNGRLRRRASFF  759

Query  525  ---------AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPG----RLIKLPETI  385
                     A+  H      P   S +++  R    +R   +C E      R + LP++I
Sbjct  760  QNSLIGFVAARQRHHEGGGGPDYSSTKIANSR--IPSRITIRCLEKAHIGKRAVLLPDSI  817

Query  384  AELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWN  244
             EL+ +  EK G     + +  E+GA+I+ I+VIRD D L +    N
Sbjct  818  KELLDMGAEKFGISL--AKVLTEDGALIEDIEVIRDGDHLILATSEN  862



>ref|XP_010049960.1| PREDICTED: potassium channel AKT1 [Eucalyptus grandis]
Length=873

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 115/272 (42%), Gaps = 51/272 (19%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD---LLCKAAKMNDSSVMQELLK  760
            +D EGN  LW+AI      +  +L   A      V+GD     C AA+ N+  +++E+ +
Sbjct  591  RDSEGNVPLWEAIKGGSEPVVKLL---AENGANLVSGDVGQFSCTAAEQNNLDLLKEISR  647

Query  759  HGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKREL  580
            +G  V     +G+TA+  A+ E+  +++K L+  GA+I+        P DL +     E+
Sbjct  648  YGGDVTLPKSNGTTALHVAVSEDNIEIVKFLLDRGADINKPDIHGWTPRDLADQQGHEEI  707

Query  579  G------HRIAMPNTILHE----AASKWAKDDHQNSSSMPQQCS----------------  478
            G          M   I  E     AS+    D     S P++ +                
Sbjct  708  GILFQSIKETEMLPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTSNFHNSLFGIMSAARD  767

Query  477  ----IRVSI---------YRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLG  349
                + +SI         +   PA R    CPE     G+L+ LPE   EL+ +A +K G
Sbjct  768  GEGDVLLSINHNKSANKSFVARPAIRVVVSCPEVGDVEGKLMLLPENFQELLEMARKKFG  827

Query  348  FDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
               T   +  + GA ID + VIRD D L  ++
Sbjct  828  L--TLLKVLTKNGAEIDDVAVIRDGDHLVFLS  857



>ref|XP_006360380.1| PREDICTED: potassium channel SKOR-like [Solanum tuberosum]
Length=824

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 108/227 (48%), Gaps = 11/227 (5%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L++AI      + S+L    +      AG  LC      DS +++ LL +G+ 
Sbjct  606  DNFGNTPLFEAIKNGHDRVASLLVKEGAFLKIENAGSFLCTLVTKGDSDLLRRLLSNGID  665

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             +SKD    T +  A  +    M +LL+  GA +    +    P D   +    +L   I
Sbjct  666  ANSKDYDHRTPLHVAASQGLLAMARLLLGAGASVFSMDRWGNTPFDEARLSGNNQL---I  722

Query  567  AMPNTILHEAASKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
             +         S++    H+ S    P++C    +++  HP   ++ +  + G ++ +P 
Sbjct  723  KLLEDAKSAQTSEFPSVSHEISEKKHPRKC----TVFPVHPWEPKDLR--KHGVVLWVPT  776

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ EL++ A E+L F +    L+++ G I+D ID+I D  KL+++++
Sbjct  777  SMEELVTAASEQLNFPSGSCILSEDAGKILD-IDMISDGQKLYLISE  822



>ref|XP_008460504.1| PREDICTED: potassium channel SKOR [Cucumis melo]
Length=828

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 61/229 (27%), Positives = 113/229 (49%), Gaps = 11/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +AI      + ++L    +       G  LC A    DS +++ LL +G
Sbjct  608  LKDNFGNTPLMEAIKNGNDQVAALLSKEGASLKVDSPGSFLCTAVSRGDSDLVKRLLCYG  667

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A+ E    M KLL+ +GA +    +    PLD     + R  G+
Sbjct  668  IDPNSKDYDSRTPLHIAVSEGLTLMAKLLLESGASVFSKDRWGNTPLD-----EGRICGN  722

Query  573  RIAMPNTILHEA-ASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
            +  +   +L EA AS+ ++  + +     ++ + + +++  HP    E +   PG ++ +
Sbjct  723  KSML--KLLEEAKASQLSESPYSSREFTDKKPTKKCTVFPFHPWDPEENK--RPGIVLWV  778

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P TI ELI  + E+L        L+++ G I+D + ++ ++ KL++V +
Sbjct  779  PLTIEELIKESSEQLQVSGECCILSEDGGKILD-VHMLDESQKLYLVPE  826



>gb|KCW82789.1| hypothetical protein EUGRSUZ_C04163 [Eucalyptus grandis]
Length=892

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 115/272 (42%), Gaps = 51/272 (19%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGD---LLCKAAKMNDSSVMQELLK  760
            +D EGN  LW+AI      +  +L   A      V+GD     C AA+ N+  +++E+ +
Sbjct  610  RDSEGNVPLWEAIKGGSEPVVKLL---AENGANLVSGDVGQFSCTAAEQNNLDLLKEISR  666

Query  759  HGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKREL  580
            +G  V     +G+TA+  A+ E+  +++K L+  GA+I+        P DL +     E+
Sbjct  667  YGGDVTLPKSNGTTALHVAVSEDNIEIVKFLLDRGADINKPDIHGWTPRDLADQQGHEEI  726

Query  579  G------HRIAMPNTILHE----AASKWAKDDHQNSSSMPQQCS----------------  478
            G          M   I  E     AS+    D     S P++ +                
Sbjct  727  GILFQSIKETEMLPAIRSEPNLPPASQEKTVDAAFGQSRPRRRTSNFHNSLFGIMSAARD  786

Query  477  ----IRVSI---------YRGHPATRRETQCPE----PGRLIKLPETIAELISIAGEKLG  349
                + +SI         +   PA R    CPE     G+L+ LPE   EL+ +A +K G
Sbjct  787  GEGDVLLSINHNKSANKSFVARPAIRVVVSCPEVGDVEGKLMLLPENFQELLEMARKKFG  846

Query  348  FDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
               T   +  + GA ID + VIRD D L  ++
Sbjct  847  L--TLLKVLTKNGAEIDDVAVIRDGDHLVFLS  876



>dbj|BAE99592.1| K+ transporter [Arabidopsis thaliana]
Length=779

 Score = 72.8 bits (177),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 108/278 (39%), Gaps = 52/278 (19%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D EG+  LW+A+      +  +L    S  D    G   C AA+  +  +++E++ HG 
Sbjct  502  RDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGG  561

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE----------  601
             V      G++A+  A+ E   +M+K L+  GA+++        P DL E          
Sbjct  562  DVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKAL  621

Query  600  -------------------VLQK--RELGHRIAMPNT---------ILHEAASKWAKDDH  511
                               +L+   R LG   + PN           + E  ++   ++ 
Sbjct  622  FREKLHERRVHIETSSSVPILKTGIRFLGRFTSEPNIRPASREVSFRIRETRARRKTNNF  681

Query  510  QNS-------SSMPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPETIAELISIA  364
             NS        S+P+     V   R     R    C E     G+L+ LP +  EL+ + 
Sbjct  682  DNSLFGILANQSVPKNGLATVDEGRTGNPVRVTISCAEKDDIAGKLVLLPGSFKELLELG  741

Query  363  GEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              K G  AT   +  +  A ID +DVIRD D L    D
Sbjct  742  SNKFGIVAT-KVMNKDNNAEIDDVDVIRDGDHLIFATD  778



>ref|XP_008659052.1| PREDICTED: potassium channel KOR1-like isoform X2 [Zea mays]
 ref|XP_008659053.1| PREDICTED: potassium channel KOR1-like isoform X2 [Zea mays]
Length=846

 Score = 72.8 bits (177),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 106/233 (45%), Gaps = 15/233 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D  GNT L +A+   +  + ++L+   +      AG  LC A    DS  ++  L +G
Sbjct  613  LTDQFGNTPLLEAVKQGQERVAALLFAKGAKLSLKNAGSHLCTAVAKGDSDFIRRTLAYG  672

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
               + +D    T +  A  E    + K+LV  GA +    +    PLD     + R+ G 
Sbjct  673  ADPNCRDYDHRTPLHIAAAEGLYLIAKMLVEAGASVFTTDRWGTTPLD-----EARKCGG  727

Query  573  RIAMPNTILHEA-ASKWAKDDHQNSSSMPQQCSIRVSIYRGHP---ATRRETQCPEPGRL  406
            R+     +L EA A++ A    +      +    R S++  HP   AT  E +    G +
Sbjct  728  RVL--GALLEEARANELAMFPERGEEVRDKMHPRRCSVFPYHPWRAATGEERRIE--GVV  783

Query  405  IKLPETIAELISIAGEKLGFDATDSSLT--DEEGAIIDSIDVIRDNDKLFIVA  253
            + +P TI  L+++A EKLG     S L    E+GA +  +D++ D  KL++V 
Sbjct  784  LWIPHTIESLVALAQEKLGLPGPASRLRLLREDGARVLDVDMVNDGQKLYLVG  836



>ref|XP_010108959.1| Potassium channel SKOR [Morus notabilis]
 gb|EXC20599.1| Potassium channel SKOR [Morus notabilis]
Length=858

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 109/230 (47%), Gaps = 10/230 (4%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KD  GNT L +A+      + S+L    +      AG  LC A    DS  ++ +L +G+
Sbjct  633  KDSFGNTPLLEALKNGHDRVSSLLVKEGASLKIDNAGSFLCTAVSRGDSDFLKRILANGI  692

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
              +SKD    T +  A  E    M KLL+  GA +    +    PLD     + R  G++
Sbjct  693  DPNSKDYDHRTPLHIAASEGLYLMAKLLLEAGASVFSKDRWGNTPLD-----EGRMCGNK  747

Query  570  IAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
              +   +L +A +    D   ++    +    + +++  HP   +E +   PG ++ +P 
Sbjct  748  NLIK--LLEDAKAAQLLDFPYHAGDKEKAHQKKCTVFPFHPWDPKEDR--RPGIVLWVPN  803

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVADWNS  241
            TI +LI  A ++L   +    L+++ G I+D +D+I D  KL++V + +S
Sbjct  804  TIEDLIKKAADQLEISSVSCILSEDAGKILD-VDLINDGQKLYLVGETHS  852



>ref|XP_008659051.1| PREDICTED: potassium channel KOR1-like isoform X1 [Zea mays]
 gb|AFW85147.1| potassium outward rectifying channel [Zea mays]
Length=879

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 106/233 (45%), Gaps = 15/233 (6%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D  GNT L +A+   +  + ++L+   +      AG  LC A    DS  ++  L +G
Sbjct  613  LTDQFGNTPLLEAVKQGQERVAALLFAKGAKLSLKNAGSHLCTAVAKGDSDFIRRTLAYG  672

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
               + +D    T +  A  E    + K+LV  GA +    +    PLD     + R+ G 
Sbjct  673  ADPNCRDYDHRTPLHIAAAEGLYLIAKMLVEAGASVFTTDRWGTTPLD-----EARKCGG  727

Query  573  RIAMPNTILHEA-ASKWAKDDHQNSSSMPQQCSIRVSIYRGHP---ATRRETQCPEPGRL  406
            R+     +L EA A++ A    +      +    R S++  HP   AT  E +    G +
Sbjct  728  RVL--GALLEEARANELAMFPERGEEVRDKMHPRRCSVFPYHPWRAATGEERRIE--GVV  783

Query  405  IKLPETIAELISIAGEKLGFDATDSSLT--DEEGAIIDSIDVIRDNDKLFIVA  253
            + +P TI  L+++A EKLG     S L    E+GA +  +D++ D  KL++V 
Sbjct  784  LWIPHTIESLVALAQEKLGLPGPASRLRLLREDGARVLDVDMVNDGQKLYLVG  836



>ref|XP_010670702.1| PREDICTED: potassium channel AKT1-like [Beta vulgaris subsp. 
vulgaris]
Length=880

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/281 (25%), Positives = 119/281 (42%), Gaps = 59/281 (21%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL---LCKAAKMNDSSVMQELLK  760
            KD EGN  LWDAI  +  ++  +L    +      +GD+    C A + ++  +++++++
Sbjct  597  KDSEGNVPLWDAIMGRHEALIKLLVDQGAT---LASGDVPQYACHAVEEDNFELLKDVVR  653

Query  759  HGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEV------  598
            +G  V +   +G TA+ AA       ++K L+  GA+ID +      P  L ++      
Sbjct  654  YGGDVTAPKSNGFTALHAAASHGNPTIVKFLLKQGADIDKSDLNGWTPRGLADLHGHEEI  713

Query  597  ---------------------------LQKRELGHRIAMPNTILHEAASKWAK---DDHQ  508
                                       L+K ++      P T     A K  +   +  +
Sbjct  714  KALFRSKEEASVQSVITVHGKESGPTFLKKLKVDSMDVTPRTREVTWADKQPRRRVNSFR  773

Query  507  NS------------SSMPQQCSIRVSIYRGHPATRRETQCPEPG---RLIKLPETIAELI  373
            NS            SS  ++ S   S + G    R   +CP  G   +L+ LPETI EL+
Sbjct  774  NSLFGFMSAATRVESSQTERGSFSNSPFSGVQPARVILRCPGKGDATKLVILPETIPELL  833

Query  372  SIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             I  +K G+  T    +D  GA ID I+++RD D L ++ +
Sbjct  834  EIGTKKFGWRCTKVVTSD--GAEIDEIELVRDGDLLCLICE  872



>gb|KHG09220.1| hypothetical protein F383_13482 [Gossypium arboreum]
Length=364

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 108/232 (47%), Gaps = 19/232 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +AI     ++ ++L    +  +   AG  LC A    DS  ++ LL +G
Sbjct  144  LKDKFGNTPLLEAIKNGHDNLAALLIKEGASLNIDDAGSYLCTAVAKGDSDFLRRLLSNG  203

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +S+D    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  204  VDPNSRDYDHRTPLHVAASEGLYIMAKLLIEAGASVFSKDRWGNTPLD-----EARMCGN  258

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L +A S    +    S        P++C    +++  HP   ++ +    G 
Sbjct  259  KNLI--KLLEDAKSTQLSELPHCSKEFTDKIHPKKC----TVFPFHPWDAKDQR--RHGI  310

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            ++ +P T+  L++ A E+L        LT+  G I+D +D+I D +KL+++ 
Sbjct  311  VLWVPHTMEALVTTAAEQLDLAGASCMLTENGGKILD-VDMINDGEKLYLIG  361



>emb|CBI33453.3| unnamed protein product [Vitis vinifera]
Length=794

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 112/233 (48%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            + D  GNT L +AI      + S+L +  ++     AG  LC      DS  ++ +L +G
Sbjct  572  ISDNFGNTPLLEAIKNAHDRVASLLVNKGALLKIDDAGGFLCATIARGDSDFLKRILSNG  631

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+   A +    +    PLD     +  + G+
Sbjct  632  IDPNSKDYDHRTPLHVAASEGLYFMAKLLLEARASVFSKDRWGNTPLD-----EGWKCGN  686

Query  573  RIAMPNTILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  M   +L +A     S++     + +  M P++C    +++  HP   +E +   PG 
Sbjct  687  KNLM--KLLEDAKVAQLSEFPDCSREITDKMHPRKC----TVFPFHPWDPKEHK--RPGI  738

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P+TI ELI  A E L F +    L+++ G I+D +D+I D  KL+++ +
Sbjct  739  MLWVPQTIEELIKTATEGLQFSSESCILSEDGGKILD-VDMISDGQKLYLLCE  790



>ref|XP_012078936.1| PREDICTED: potassium channel AKT1-like [Jatropha curcas]
Length=887

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 119/289 (41%), Gaps = 65/289 (22%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KD EGN  LW+A+     S+  +L    +       G   C AA+ N+ ++++E++++G 
Sbjct  589  KDSEGNVPLWEAMVGGHESVTRLLIENGASLKSGDVGHFACTAAEQNNLNLLKEIVRYGG  648

Query  750  HVD--SKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE--------  601
             V      + G+TA+  A+ E   ++ + L+  GA ID        P DL +        
Sbjct  649  DVTCPCPRKSGTTALHVAVCEENIEIARFLLDQGANIDKPDIHGWTPRDLADQQGHEQIK  708

Query  600  -VLQK-------------------RELGHRIAMPNT--ILHEAA-----SKWAKDDHQNS  502
             + Q                    R LG   + P    + HE +       W+++  +  
Sbjct  709  LIFQNFCKEPKSQSVVAIPERQEPRYLGRFTSEPTIRPLSHEGSFSGTDRSWSQNRPRRR  768

Query  501  SS---------------------MPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKL  397
            ++                      P   SI V  Y  +PA R    CPE     G+L+ L
Sbjct  769  TNNFHNSLFGMMSAANKGDKELPFPVTPSIGVDKYGANPA-RVVISCPERLGIAGKLVLL  827

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P+T+ EL+ I  +K  F+     +  ++ A I+ I+VIRD D +  V+D
Sbjct  828  PKTLQELLEIGAKK--FELNHPKILSKDRAEIEDIEVIRDGDHILFVSD  874



>ref|XP_009609577.1| PREDICTED: potassium channel SKOR-like [Nicotiana tomentosiformis]
Length=827

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 109/227 (48%), Gaps = 19/227 (8%)
 Frame = -3

Query  915  NTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSK  736
            NT L++AI      + S+L    +      AG  LC      DS +++ LL +G+  DSK
Sbjct  613  NTPLFEAIKNGHDRVASLLVKEGAFLKIENAGSFLCVLVAKGDSDLLRRLLSNGIDPDSK  672

Query  735  DRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPN  556
            D    T +  A  +    M +LL+  GA +    +    P D   +    +L        
Sbjct  673  DYDHRTPLHVAASQGLFTMARLLLGAGASVFSKDRWGNTPFDEARLSGNNQL-------T  725

Query  555  TILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
             ++ EA     S++    H+ S  M P++C    +++  HP   ++ +  + G ++ +P+
Sbjct  726  KLMEEAKSTQISEFPIAPHEISEKMHPRKC----TVFHFHPWEPKDLR--KHGVVLWIPK  779

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ EL++ A E+L F +    L+++ G I+D I +I D  KL+++++
Sbjct  780  SMEELVTTASEQLNFPSGSCILSEDAGKILD-IGLISDGQKLYLISE  825



>ref|XP_010660282.1| PREDICTED: shaker-like potassium channel isoform X1 [Vitis vinifera]
Length=821

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 112/233 (48%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            + D  GNT L +AI      + S+L +  ++     AG  LC      DS  ++ +L +G
Sbjct  599  ISDNFGNTPLLEAIKNAHDRVASLLVNKGALLKIDDAGGFLCATIARGDSDFLKRILSNG  658

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    M KLL+   A +    +    PLD     +  + G+
Sbjct  659  IDPNSKDYDHRTPLHVAASEGLYFMAKLLLEARASVFSKDRWGNTPLD-----EGWKCGN  713

Query  573  RIAMPNTILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  M   +L +A     S++     + +  M P++C    +++  HP   +E +   PG 
Sbjct  714  KNLM--KLLEDAKVAQLSEFPDCSREITDKMHPRKC----TVFPFHPWDPKEHK--RPGI  765

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P+TI ELI  A E L F +    L+++ G I+D +D+I D  KL+++ +
Sbjct  766  MLWVPQTIEELIKTATEGLQFSSESCILSEDGGKILD-VDMISDGQKLYLLCE  817



>gb|ABE99810.1| inwardly rectifying potassium channel AKT1 [Hordeum vulgare]
 dbj|BAJ96585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=898

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 74/290 (26%), Positives = 126/290 (43%), Gaps = 71/290 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHW-ASISDPYVAGD---LLCKAAKMNDSSVMQELL  763
            +D EG   LW+A+ AK  ++  +L    A +S    AGD     C A + ND  +++++L
Sbjct  604  RDSEGKVPLWEAVYAKHDTVVQLLIKGGAELS----AGDTSLYACTAVEQNDIELLKQIL  659

Query  762  KHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE------  601
            KH + V+   + G+  +  A+ +   +M++LL+ +GA+ID        P  L E      
Sbjct  660  KHVIDVNRPSKDGNIPLHRAVCDGNVEMVELLLRHGADIDKQDSNGWTPRALAEQQGHEE  719

Query  600  -------VLQKRELGHRIAMPNTILHEAAS-----KWAKDD--HQNSSSMPQQ--CSIRV  469
                   V+  R+      +   +L   +S     K  ++D   Q S  +PQ+   S   
Sbjct  720  IQNLFRSVVAPRKYTSNGRVTPMLLGRFSSDPSMQKVIREDAEQQPSKVLPQRRKVSFHN  779

Query  468  SIY----RGHPATRRETQ-----------------------------CPE----PGRLIK  400
            S++      HP  RRET                              CPE     G+L+ 
Sbjct  780  SLFGVISSSHP--RRETDHLLSRGLAATGGPSYPQAHHRPLIRVTIGCPEKGNTAGKLVI  837

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            LP ++ EL+ +  +K  FD   + +   EGA +D +++IRD D L + +D
Sbjct  838  LPGSMKELLQLGAKK--FDMMPTKVLTIEGAEVDEVELIRDGDHLVLASD  885



>gb|AFO70199.1| potassium channel SKOR, partial [Alternanthera philoxeroides]
Length=849

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 103/227 (45%), Gaps = 11/227 (5%)
 Frame = -3

Query  927  DMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLH  748
            D  GNT L +A+      + + LY   +I D    G  LC      D   ++ ++ +G+ 
Sbjct  631  DNFGNTPLLEAVKNGHDEVAATLYKQGAIIDVKDVGSFLCTVVLRGDVEFLKRIIANGID  690

Query  747  VDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRI  568
             +SKD    T +  A  +    M K+LV  GA +    +    PLD   +   + L    
Sbjct  691  PNSKDYDQRTPLHVACSQGLFLMAKVLVDAGAYVTLKDRWGNTPLDEAWMCGNKHL----  746

Query  567  AMPNTILHEAASKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
                 +L  A S        N   M  ++   + +++  HP   +E +  +PG ++  P 
Sbjct  747  ---IKLLEAAKSAQLSQSSGNIEEMLDKKLHKKCTVFPFHPWGPKENR--KPGIVLWTPH  801

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             I ELI +A EKL F    S L+++ G I+D +D+I +  KL+++++
Sbjct  802  RIDELIKMASEKLNFPRGSSILSEDGGKILD-VDMIDNGQKLYLISE  847



>ref|XP_008394035.1| PREDICTED: potassium channel AKT1-like isoform X1 [Malus domestica]
Length=891

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/293 (21%), Positives = 123/293 (42%), Gaps = 68/293 (23%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D EGN  +W+AI+ K  S+  +L    +  +    G+  C A + N+  ++++++ + 
Sbjct  599  IQDSEGNVPIWEAISGKHESLIKLLLDNGAKINSGNVGNFACAAVEQNNLELLKDIVTYN  658

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPL---------DLTE  601
              V     +G+ A+  A+ E   +M+K L+  GAE D        P          ++ E
Sbjct  659  GDVTLPKSNGTAALHTAVCEGNVEMVKFLLEQGAEADKPDGYGWTPRALAEHQGHEEIME  718

Query  600  VLQKRELGHR-------IAMPNTILHEAASK---------WAKDDHQNSSSMPQQCSIRV  469
            + Q +   ++       + MP  ++     K         +A+D   + S M  + + R+
Sbjct  719  LFQHKWESNKPTKKPTVVPMPKDLIPSRPGKFRSEPTLPPYARDGRPSYSDMTSENTRRM  778

Query  468  -SIYRG-----------------------------------HPATRRETQCPEPG----R  409
              I+R                                    +PA R    CP+ G    +
Sbjct  779  DKIFRNSLFGFMSAANTNTGEKDRDIVASTGSLARSTSRNSYPA-RVTLSCPKKGQTAAK  837

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            L+ LP+++ +L+ +  +K  F AT   +  E+GA ++ ++++RD D L +  D
Sbjct  838  LVLLPDSLQQLLDLGAKKFQFTAT--KVLTEDGAEVEDVELVRDGDHLVLAGD  888



>ref|XP_006427880.1| hypothetical protein CICLE_v10024904mg [Citrus clementina]
 ref|XP_006464550.1| PREDICTED: potassium channel SKOR-like [Citrus sinensis]
 gb|ESR41120.1| hypothetical protein CICLE_v10024904mg [Citrus clementina]
Length=821

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 111/234 (47%), Gaps = 20/234 (9%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +AI        S+L    +  +   AG  LC A    DS +++ +L +G
Sbjct  600  LKDNFGNTPLLEAIKYGNDGAASLLVKEGASLNVEEAGSFLCTAVARGDSDLLKRVLSNG  659

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +++D    T +  A  E    + KLLV  GA +    +    PLD     + R  G+
Sbjct  660  IDPNTRDYDLRTPLHIAASEGLYLIAKLLVEAGASVFPKDRRGNTPLD-----EGRMCGN  714

Query  573  RIAMPNTILHEAASKW------AKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPG  412
            +  +   +L +A S           D  +  +  ++C    +++  HP   +E++    G
Sbjct  715  KNLI--KLLEDAKSTQLLEFPHGFQDIADKRNPTRKC----TVFPFHPWDAKESR--RHG  766

Query  411  RLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             ++ +P+ I +LI  A E+L F   D  L+ E G I+D +D+I D+ KL+++ +
Sbjct  767  IVLWIPQNIKDLIKTAAEQLDFRGGDCILSSEGGKILD-VDMINDDQKLYLIQE  819



>gb|AAF81249.1|AF267753_1 putative potassium channel protein Mkt1p [Mesembryanthemum crystallinum]
Length=870

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 123/279 (44%), Gaps = 57/279 (20%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL---LCKAAKMNDSSVMQELLK  760
            KD EGN  LW+AI  +  S+  +L    +      +GD+    C A + ++  +++++++
Sbjct  587  KDSEGNVPLWEAIMGRHESLIKLLIDQGAT---LASGDVPQYACYAVEQDNLELLKDIVR  643

Query  759  HGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDA-----VKLNLAPL----DL  607
            +G  V     +G+T + AA+    A ++K L+  GA+++           LA      D+
Sbjct  644  YGGDVKLAKTNGTTPLHAAVTSGNAAIVKFLLKQGADMEKGDVHGWTSKGLAEFHGNDDV  703

Query  606  TEVLQKRE---LGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSI-------RVSIYR  457
              + + +E   L   +++P   +  A+ K  + D  + +   ++ +        RV+ +R
Sbjct  704  KALFRSKEETNLQSVVSVPENEVAPASLKKLRTDSMDVTPRVREVTWADKNRRRRVNTFR  763

Query  456  G------HPATRRET---------------------QCPEPGRLIKL---PETIAELISI  367
                     ATR ET                     +CP  G  +KL   PETI EL+ I
Sbjct  764  NSLFGIMSAATRGETAEGSSFTNSPIFGNQSARVILKCPAKGEAVKLVMVPETIQELLDI  823

Query  366  AGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              +K G   T     D  GA +D ++VIRD D L ++ +
Sbjct  824  GAQKFGCVCTKVVTAD--GAEVDEVEVIRDGDHLSLICE  860



>dbj|BAD94501.1| potassium channel - protein [Arabidopsis thaliana]
Length=372

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 120/279 (43%), Gaps = 57/279 (20%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D EG+  LW+AI  +      +L    +       G   C A   N+ + +++++K+G
Sbjct  95   IRDSEGSVPLWEAIIGRHEENAKLLSENGATLSFDTVGYFSCLAVGQNNLNALKDIVKYG  154

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEID---------------------DA  637
              +   D +G+TA+  A+ E   ++++ L+  GA++D                      A
Sbjct  155  GDISLSDVNGTTALHRAVSEGNLEIVQFLLEKGADMDKPDVYGWTARALAEHQGHEDIKA  214

Query  636  VKLNLAPLDLTEVLQ------KRELGH-----------RIAMPNTILHEAASKWAK-DDH  511
            +  N  P++   +L       K  + H           R AMP   L  A S+  K  + 
Sbjct  215  LFYNQRPVERKTILVSGTPEIKPLMKHSSEPVMTHHHSREAMPP--LARAVSQRRKLSNF  272

Query  510  QNS---------SSMPQQCSIRVSIYRG----HPA-TRRETQCPEPGRLIKLPETIAELI  373
            +NS         +      S R  I  G    +PA      +    G+++KLP+++ ELI
Sbjct  273  KNSLFGIMSAAKTGDEGGASTRTGISEGVGGVYPARVTISGEASSSGKVVKLPDSLEELI  332

Query  372  SIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIV  256
             I  +KLGF AT   +   EGA ID I +IRD D L ++
Sbjct  333  EIGEKKLGFVAT--KILSREGAEIDDIRIIRDGDFLLLL  369



>ref|XP_008464999.1| PREDICTED: potassium channel AKT1 isoform X2 [Cucumis melo]
Length=704

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 114/284 (40%), Gaps = 61/284 (21%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D +G   LW+AI     ++  +L    +       G   C AA+ N+  +++E+ ++G 
Sbjct  421  RDSDGVVPLWEAILGGHEAVAQLLMDNGANLRSGDVGHFACTAAEQNNLQLLKEIHRYGG  480

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
             V S   +G+TA+  A+ E+  +++K L+  GA+ID        P DL +  Q+   G +
Sbjct  481  DVTSARNNGTTALHVAVCEDNIEIVKFLLKQGADIDKPDVHGWTPRDLAD--QQGHEGIK  538

Query  570  IAMPNTILHEAASKWAKDDHQNSSSM-----------PQQCSIRVSIYRGHPATRRETQ-  427
                 T   ++ S  A  + Q                PQ        + GH   RR T  
Sbjct  539  NLFQTTKESKSQSVVAIPEKQTGIRFLGRFTSEPMIRPQPQEANDGSWPGHSRPRRRTNN  598

Query  426  -----------------------------------------CPE----PGRLIKLPETIA  382
                                                     CPE     G+L+ LPE+  
Sbjct  599  FHNSLFGIMSAAQSGEKGIPFPDNQTSLENSGTNPARVIVSCPEIGEVGGKLVLLPESYN  658

Query  381  ELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            EL+ I  +K G  AT   + +++GA I+ I+VIRD D L  V+D
Sbjct  659  ELLEIGLKKYGIMAT--KVLNKDGAAIEDIEVIRDGDHLVFVSD  700



>gb|AFW83425.1| potassium channel [Zea mays]
Length=887

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 126/297 (42%), Gaps = 84/297 (28%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYH-WASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D EG   LW+A+  K++ +  +L    A +S   VA    C A + ND  +++ ++++G
Sbjct  591  RDSEGKVPLWEALCEKQNPVVELLVQSGAGLSSGDVA-LYACVAVEENDPELLENIIRYG  649

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD----------------------  640
             +V+S  + G+T +  A+ +    M++LL+ +GA+ID                       
Sbjct  650  GNVNSSMKDGTTPLHRAVCDGNVQMVELLLEHGADIDKQDNNGWSARALADQQGHDDIQS  709

Query  639  ------------AVKLNLAPLDL---------------------TEVLQKRELGHRIAMP  559
                        A K  +AP+ +                      +V+ ++ L  R++  
Sbjct  710  LFRSRKAHRQQHASKGRVAPVPIWRFNSEPTMPKMKHEEDAELRGKVVPQKLLRKRVSFQ  769

Query  558  NTILHEAASKWAKDDHQN------SSSMPQQCS----IRVSIYRGHPATRRETQCPE---  418
            N++    +S  A+ D         + +    CS    +RV+I            CPE   
Sbjct  770  NSLFGVISSSHARQDTGRLLSKGLAGTGSPGCSHGSLVRVTI-----------GCPEKGN  818

Query  417  -PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              G+L+ LP ++ EL+ +   K GF  T    T   GA ID +++IRD D + +V+D
Sbjct  819  AAGKLVLLPRSMTELLELGARKFGFKPTKVLTTG--GAEIDEVELIRDGDHVVLVSD  873



>ref|XP_011656178.1| PREDICTED: potassium channel AKT1 isoform X2 [Cucumis sativus]
Length=704

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/285 (24%), Positives = 113/285 (40%), Gaps = 63/285 (22%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D +G   LWDAI     ++  +L    +       G   C AA+ N   +++E+ ++G 
Sbjct  421  RDSDGVVPLWDAILGGHEAVAQLLIDNGANLRSGDVGHFACTAAEQNKLQLLKEIHRYGG  480

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLT-----------  604
             V S   +G+TA+  A+ E+  +++K L+  GA+ID        P DL            
Sbjct  481  DVTSARNNGTTALHVAVCEDNIEIVKFLLKQGADIDKPDVHGWTPRDLADQQGHEEIKNL  540

Query  603  -EVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQ  427
             + +++ +    +A+P     +   ++           PQ        + GH   RR T 
Sbjct  541  FQTIKESKTQSVVAIPE---KQTGIRFLGRFTSEPMIRPQPQEANDGSWPGHSRPRRRTN  597

Query  426  ------------------------------------------CPE----PGRLIKLPETI  385
                                                      CPE     G+L+ LPE+ 
Sbjct  598  NFHNSLFGIMSAAQSGENGNPFPDSQTSLENSGTNPARVIVSCPEIGEVGGKLVLLPESY  657

Query  384  AELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             EL+ I  +K G  AT   + +++GA I+ I+VIRD D L  V+D
Sbjct  658  NELLEIGLKKYGIMAT--KVLNKDGAAIEDIEVIRDGDHLVFVSD  700



>ref|XP_006494523.1| PREDICTED: potassium channel SKOR-like, partial [Citrus sinensis]
Length=404

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/224 (28%), Positives = 105/224 (47%), Gaps = 19/224 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + S+L    +  +   AG  LC A    DS +++ +L +G
Sbjct  194  IKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCIAVARGDSDLLKRVLSNG  253

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +S+D    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  254  VDPNSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLD-----EGRMCGN  308

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L +A      + H  S  M     P++C    +++  HP   +  +    G 
Sbjct  309  KNLI--KLLEDAKCTQLSEFHYCSQGMIDKKHPRKC----TVFPFHPWDEKVHR--RHGI  360

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRD  277
            ++ +P  I ELI +A +KL F    S L+++ G I+D +D+I D
Sbjct  361  VLWVPHNIEELIKLAVDKLDFPGGHSMLSEDGGKILD-VDMIND  403



>ref|XP_008394036.1| PREDICTED: potassium channel AKT1-like isoform X2 [Malus domestica]
Length=880

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/293 (21%), Positives = 123/293 (42%), Gaps = 68/293 (23%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D EGN  +W+AI+ K  S+  +L    +  +    G+  C A + N+  ++++++ + 
Sbjct  588  IQDSEGNVPIWEAISGKHESLIKLLLDNGAKINSGNVGNFACAAVEQNNLELLKDIVTYN  647

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPL---------DLTE  601
              V     +G+ A+  A+ E   +M+K L+  GAE D        P          ++ E
Sbjct  648  GDVTLPKSNGTAALHTAVCEGNVEMVKFLLEQGAEADKPDGYGWTPRALAEHQGHEEIME  707

Query  600  VLQKRELGHR-------IAMPNTILHEAASK---------WAKDDHQNSSSMPQQCSIRV  469
            + Q +   ++       + MP  ++     K         +A+D   + S M  + + R+
Sbjct  708  LFQHKWESNKPTKKPTVVPMPKDLIPSRPGKFRSEPTLPPYARDGRPSYSDMTSENTRRM  767

Query  468  -SIYRG-----------------------------------HPATRRETQCPEPG----R  409
              I+R                                    +PA R    CP+ G    +
Sbjct  768  DKIFRNSLFGFMSAANTNTGEKDRDIVASTGSLARSTSRNSYPA-RVTLSCPKKGQTAAK  826

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            L+ LP+++ +L+ +  +K  F AT   +  E+GA ++ ++++RD D L +  D
Sbjct  827  LVLLPDSLQQLLDLGAKKFQFTAT--KVLTEDGAEVEDVELVRDGDHLVLAGD  877



>ref|XP_002533481.1| Potassium channel SKOR, putative [Ricinus communis]
 gb|EEF28913.1| Potassium channel SKOR, putative [Ricinus communis]
Length=445

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 107/229 (47%), Gaps = 11/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI +    + S+L    +      AG  LC      DS +++ +L +G
Sbjct  223  IKDKFGNTPLLEAIKSGHDHVASLLVKEGAELRMDDAGSFLCSTVLKGDSDLLRRILSNG  282

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ +SKD    T +  A  E    M KLL+  GA +    +    PLD   +   + L  
Sbjct  283  INPNSKDYDHRTPLHVAASEGLYMMAKLLLEAGASVCSKDRWGKTPLDEGRISGNKNL--  340

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIR-VSIYRGHPATRRETQCPEPGRLIKL  397
                   +L +A S    +   ++  +  +   R  +I+  HP   +E +   PG ++ +
Sbjct  341  -----IKLLEDAKSTQLSEFLPHTQELTDKIQRRKCTIFPFHPWDPKEQK--RPGIVLWV  393

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P+T+ ELI  A E+L        L+ + G I+D +D++ D   L+++++
Sbjct  394  PQTMEELIKAAAEQLNLPDDSFMLSKDGGKILD-VDMVDDGQMLYLISE  441



>gb|AFW83426.1| hypothetical protein ZEAMMB73_660957 [Zea mays]
Length=913

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 126/297 (42%), Gaps = 84/297 (28%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYH-WASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D EG   LW+A+  K++ +  +L    A +S   VA    C A + ND  +++ ++++G
Sbjct  617  RDSEGKVPLWEALCEKQNPVVELLVQSGAGLSSGDVA-LYACVAVEENDPELLENIIRYG  675

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD----------------------  640
             +V+S  + G+T +  A+ +    M++LL+ +GA+ID                       
Sbjct  676  GNVNSSMKDGTTPLHRAVCDGNVQMVELLLEHGADIDKQDNNGWSARALADQQGHDDIQS  735

Query  639  ------------AVKLNLAPLDL---------------------TEVLQKRELGHRIAMP  559
                        A K  +AP+ +                      +V+ ++ L  R++  
Sbjct  736  LFRSRKAHRQQHASKGRVAPVPIWRFNSEPTMPKMKHEEDAELRGKVVPQKLLRKRVSFQ  795

Query  558  NTILHEAASKWAKDDHQN------SSSMPQQCS----IRVSIYRGHPATRRETQCPE---  418
            N++    +S  A+ D         + +    CS    +RV+I            CPE   
Sbjct  796  NSLFGVISSSHARQDTGRLLSKGLAGTGSPGCSHGSLVRVTI-----------GCPEKGN  844

Query  417  -PGRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              G+L+ LP ++ EL+ +   K GF  T    T   GA ID +++IRD D + +V+D
Sbjct  845  AAGKLVLLPRSMTELLELGARKFGFKPTKVLTTG--GAEIDEVELIRDGDHVVLVSD  899



>ref|XP_003549784.1| PREDICTED: potassium channel AKT1-like [Glycine max]
Length=875

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 120/299 (40%), Gaps = 75/299 (25%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+EGN  LW+AI     S+  +L    +       G   C AA+ N  ++++E++++G
Sbjct  575  IRDLEGNVPLWEAIVGGHESMSKLLSENGANLQCGDVGQFACTAAEQNSLNLLKEIMRYG  634

Query  753  --LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDL------TEV  598
              + + +    G+TA+  A+ E   + +K L+ +GA ID   K    P DL      TE+
Sbjct  635  GDITLPNSSNTGTTALHVAVSEGNVETVKFLLDHGASIDMPDKHGWTPRDLADQQAHTEI  694

Query  597  L----------------------QKRELGHRIAMPNTIL------HEAASKWAKDDHQNS  502
                                   + + LG   + P   L      H     W+++  QN 
Sbjct  695  KALFDSIGEPKVHSSVAIPVRNSKIKYLGRFTSEPTMTLPLDGSFHGTDGSWSQNQSQNQ  754

Query  501  SSMPQQCS---------IRVSIYRGHP-----------------------ATRRETQCPE  418
            S  P++ S         I  + + G                          TR    CPE
Sbjct  755  SR-PRRRSNNYHNSLFGILSAAHNGEKYLLSAVDMNNNARNGMKSSSAVGPTRVIISCPE  813

Query  417  P----GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
                 G+L+ LP +  EL+ I  +K GF    + +  ++G  I+ I++IRD D L  + 
Sbjct  814  KGEVVGKLVLLPGSFQELVEIGAKKFGF--YPNKVVCKDGGEIEDIEIIRDGDHLVFLG  870



>ref|XP_007013335.1| K+ transporter 1 [Theobroma cacao]
 gb|EOY30954.1| K+ transporter 1 [Theobroma cacao]
Length=885

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 118/286 (41%), Gaps = 66/286 (23%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KD EG   LW+A++A  +    +L    +  +    G   C AA+ N+  +++E+L++G 
Sbjct  589  KDSEGIVPLWEAMSAGHNKATKLLKENGANINTGDVGHYACTAAEQNNIVLLKEILRYGG  648

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLT-----------  604
             V     +G TA+  A+ E   +++K L+ +GA+ID        P DL            
Sbjct  649  DVTRPRHNGYTALHVAVCEGNTEIVKFLLEHGADIDKPDIHGWTPRDLAEQQGHDEIKMI  708

Query  603  ----------------EVLQKRELGHRIAMPNTILHEAASK-----WAKDDHQNSSS---  496
                            E  + R LG   + P  ++  AA +     W++   +  +S   
Sbjct  709  FESTKEMNTQSIMSIPEKQETRYLGRFTSEP--VIRPAAQEGTDGSWSQSRPRRKTSNFH  766

Query  495  --------------------MPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPET  388
                                + Q   ++ S+     + R    CPE     G+L+ LP +
Sbjct  767  NSLFGIMSAAQNGEKDLLLSIHQPNGVKGSVVN---SARVVISCPEKGETTGKLVVLPGS  823

Query  387  IAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
              EL+ I  +K G  A  + +  + GA ID I+V+RD D L  V+D
Sbjct  824  FQELLDIGAKKFGISA--AKVLSKGGAEIDDIEVVRDGDHLVFVSD  867



>ref|XP_009147314.1| PREDICTED: potassium channel SKOR isoform X1 [Brassica rapa]
Length=829

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 107/233 (46%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + ++L    +      AG  LC      DS  ++ LL +G
Sbjct  610  IKDKLGNTPLLEAIKNGNDRVAALLVKEGATLSIENAGTFLCTVVAKGDSDFLKRLLNNG  669

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKREL--  580
            +  +SKD    T +  A  E    + + LV  GA +    +    PLD   V   + L  
Sbjct  670  IDPNSKDYDQRTPLHVASSEGLYLLARQLVEAGANVLKKDRWGNTPLDEALVCGNKMLIK  729

Query  579  ---GHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
                 + +  +T L+  +SK  KD         ++C    ++Y  HP   +E +    G 
Sbjct  730  LLEDAKTSQMSTFLN--SSKEIKD-----KVYKKKC----TVYSSHPNDSKEKR--RRGI  776

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P++I EL+  A E+L F      L+++EG IID +++I D  KL++  +
Sbjct  777  VLWVPKSIEELVRSAAEQLNFPEASCVLSEDEGKIID-VELISDGQKLYLTVE  828



>ref|XP_002282398.2| PREDICTED: potassium channel SKOR [Vitis vinifera]
 emb|CBI28247.3| unnamed protein product [Vitis vinifera]
Length=836

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/229 (27%), Positives = 110/229 (48%), Gaps = 10/229 (4%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            L D  GNT L +AI      + S+L    ++     AG  LC      D + ++ LL +G
Sbjct  615  LSDNHGNTPLLEAIKNGHDGVTSLLVKAGALLTVEDAGGCLCMTVVRRDLNFLKRLLANG  674

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            ++ ++K+    T +  A  E    M  LL+  GA +    +    PLD   +   + L  
Sbjct  675  INPNAKNYDSRTPLHLAASEGLYSMTNLLLEAGASVLAKDRWGNTPLDEARIGGNKNL--  732

Query  573  RIAMPNTILHEAASKWAKDDHQ-NSSSMPQQCSIRVSIYRGHPATRRETQCPEPGRLIKL  397
             I +    +    S+++    +  +  M Q+   + +++  HP   +E +  + G ++ +
Sbjct  733  -IKLLEEAMSAQLSEFSSCSQEIRADKMRQR---KCTVFPFHPWDSKEER--KQGVVLWI  786

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P+TI ELI  A ++L   ++ S +  E GA I +ID+I D +KLF+VA+
Sbjct  787  PKTIEELIETAMDQLKC-SSGSCILSENGAKITNIDMISDEEKLFLVAE  834



>gb|KHN15126.1| Potassium channel AKT1 [Glycine soja]
Length=871

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 120/299 (40%), Gaps = 75/299 (25%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+EGN  LW+AI     S+  +L    +       G   C AA+ N  ++++E++++G
Sbjct  571  IRDLEGNVPLWEAIVGGHESMSKLLSENGANLQCGDVGQFACTAAEQNSLNLLKEIMRYG  630

Query  753  --LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDL------TEV  598
              + + +    G+TA+  A+ E   + +K L+ +GA ID   K    P DL      TE+
Sbjct  631  GDITLPNSSNTGTTALHVAVSEGNVETVKFLLDHGASIDMPDKHGWTPRDLADQQAHTEI  690

Query  597  L----------------------QKRELGHRIAMPNTIL------HEAASKWAKDDHQNS  502
                                   + + LG   + P   L      H     W+++  QN 
Sbjct  691  KALFDSIGEPKVHSSVAIPVRNSKIKYLGRFTSEPTMTLPLDGSFHGTDGSWSQNQSQNQ  750

Query  501  SSMPQQCS---------IRVSIYRGHP-----------------------ATRRETQCPE  418
            S  P++ S         I  + + G                          TR    CPE
Sbjct  751  SR-PRRRSNNYHNSLFGILSAAHNGEKYLLSAVDMNNNARNGMKSSSAVGPTRVIISCPE  809

Query  417  P----GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
                 G+L+ LP +  EL+ I  +K GF    + +  ++G  I+ I++IRD D L  + 
Sbjct  810  KGEVVGKLVLLPGSFQELVEIGAKKFGF--YPNKVVCKDGGEIEDIEIIRDGDHLVFLG  866



>gb|AIY55349.1| potassium channel AKT1-like protein [Glycine max]
Length=875

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 120/299 (40%), Gaps = 75/299 (25%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D+EGN  LW+AI     S+  +L    +       G   C AA+ N  ++++E++++G
Sbjct  575  IRDLEGNVPLWEAIVGGHESMSKLLSENGANLQCGDVGQFACTAAEQNSLNLLKEIMRYG  634

Query  753  --LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDL------TEV  598
              + + +    G+TA+  A+ E   + +K L+ +GA ID   K    P DL      TE+
Sbjct  635  GDITLPNSSNTGTTALHVAVSEGNVETVKFLLDHGASIDMPDKHGWTPRDLADQQAHTEI  694

Query  597  L----------------------QKRELGHRIAMPNTIL------HEAASKWAKDDHQNS  502
                                   + + LG   + P   L      H     W+++  QN 
Sbjct  695  KALFDSIGEPKVHSSVAIPVRNSKIKYLGRFTSEPTMTLPLDGSFHGTDGSWSQNQSQNQ  754

Query  501  SSMPQQCS---------IRVSIYRGHP-----------------------ATRRETQCPE  418
            S  P++ S         I  + + G                          TR    CPE
Sbjct  755  SR-PRRRSNNYHNSLFGILSAAHNGEKYLLSAVDMNNNARNGMKSSSAVGPTRVIISCPE  813

Query  417  P----GRLIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
                 G+L+ LP +  EL+ I  +K GF    + +  ++G  I+ I++IRD D L  + 
Sbjct  814  KGEVVGKLVLLPGSFQELVEIGAKKFGF--YPNKVVCKDGGEIEDIEIIRDGDHLVFLG  870



>ref|XP_010047932.1| PREDICTED: potassium channel AKT1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW79958.1| hypothetical protein EUGRSUZ_C01286 [Eucalyptus grandis]
Length=885

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 70/283 (25%), Positives = 115/283 (41%), Gaps = 60/283 (21%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILY-HWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +D EG+  LW+A+      +  +L  + A+IS   V G   C AA+ N+  +++E++ +G
Sbjct  591  RDSEGSVPLWEAMLGGHDPVVKLLAENGANISSGDV-GQFACTAAEQNNLYLLKEIMHYG  649

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
              V      G+TA+  A+ E+  +++K L+  GA++D        P DL +     E+  
Sbjct  650  GDVTLPSSRGNTALHIAVSEDNLEIVKFLLEQGADMDKPDTYGWTPRDLADQQGHEEIKL  709

Query  573  RI-----AMPNTIL------HEAAS---------------------KWA-------KDDH  511
                   A P +++      HEA S                      W         ++ 
Sbjct  710  LFQSSEDAKPQSVIAIPEKHHEARSLGRFTSEPMIRPASRENNLEGSWGHSRPRRRSNNF  769

Query  510  QNS-------------SSMPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPETIA  382
             NS               MP       S+  G    R    CPE     G+L+ LP ++ 
Sbjct  770  HNSLFGVMSAAHNGKKREMPFPVDQVHSVKSGVDPARVTVSCPEIGDSAGKLVLLPGSLE  829

Query  381  ELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            EL+    +K GF    + +  + GA +D I+VIRD D L  V 
Sbjct  830  ELLETGAKKFGF--MPAKILMKNGAEVDDIEVIRDGDHLIFVG  870



>ref|XP_004149890.1| PREDICTED: potassium channel AKT1 isoform X1 [Cucumis sativus]
 gb|KGN65294.1| hypothetical protein Csa_1G303700 [Cucumis sativus]
Length=873

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 67/285 (24%), Positives = 113/285 (40%), Gaps = 63/285 (22%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D +G   LWDAI     ++  +L    +       G   C AA+ N   +++E+ ++G 
Sbjct  590  RDSDGVVPLWDAILGGHEAVAQLLIDNGANLRSGDVGHFACTAAEQNKLQLLKEIHRYGG  649

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLT-----------  604
             V S   +G+TA+  A+ E+  +++K L+  GA+ID        P DL            
Sbjct  650  DVTSARNNGTTALHVAVCEDNIEIVKFLLKQGADIDKPDVHGWTPRDLADQQGHEEIKNL  709

Query  603  -EVLQKRELGHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQ  427
             + +++ +    +A+P     +   ++           PQ        + GH   RR T 
Sbjct  710  FQTIKESKTQSVVAIPE---KQTGIRFLGRFTSEPMIRPQPQEANDGSWPGHSRPRRRTN  766

Query  426  ------------------------------------------CPE----PGRLIKLPETI  385
                                                      CPE     G+L+ LPE+ 
Sbjct  767  NFHNSLFGIMSAAQSGENGNPFPDSQTSLENSGTNPARVIVSCPEIGEVGGKLVLLPESY  826

Query  384  AELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
             EL+ I  +K G  AT   + +++GA I+ I+VIRD D L  V+D
Sbjct  827  NELLEIGLKKYGIMAT--KVLNKDGAAIEDIEVIRDGDHLVFVSD  869



>ref|XP_008464998.1| PREDICTED: potassium channel AKT1 isoform X1 [Cucumis melo]
Length=873

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 114/284 (40%), Gaps = 61/284 (21%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D +G   LW+AI     ++  +L    +       G   C AA+ N+  +++E+ ++G 
Sbjct  590  RDSDGVVPLWEAILGGHEAVAQLLMDNGANLRSGDVGHFACTAAEQNNLQLLKEIHRYGG  649

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
             V S   +G+TA+  A+ E+  +++K L+  GA+ID        P DL +  Q+   G +
Sbjct  650  DVTSARNNGTTALHVAVCEDNIEIVKFLLKQGADIDKPDVHGWTPRDLAD--QQGHEGIK  707

Query  570  IAMPNTILHEAASKWAKDDHQNSSSM-----------PQQCSIRVSIYRGHPATRRETQ-  427
                 T   ++ S  A  + Q                PQ        + GH   RR T  
Sbjct  708  NLFQTTKESKSQSVVAIPEKQTGIRFLGRFTSEPMIRPQPQEANDGSWPGHSRPRRRTNN  767

Query  426  -----------------------------------------CPE----PGRLIKLPETIA  382
                                                     CPE     G+L+ LPE+  
Sbjct  768  FHNSLFGIMSAAQSGEKGIPFPDNQTSLENSGTNPARVIVSCPEIGEVGGKLVLLPESYN  827

Query  381  ELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            EL+ I  +K G  AT   + +++GA I+ I+VIRD D L  V+D
Sbjct  828  ELLEIGLKKYGIMAT--KVLNKDGAAIEDIEVIRDGDHLVFVSD  869



>gb|KJB53297.1| hypothetical protein B456_009G114200 [Gossypium raimondii]
Length=856

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 108/232 (47%), Gaps = 19/232 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +AI     ++ ++L    +  +   AG  LC A    DS  ++ LL +G
Sbjct  636  LKDKFGNTPLLEAIKNGHDNLAALLIKEGASLNIDDAGSYLCTAVAKGDSDFLRRLLSNG  695

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +S+D    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  696  VDPNSRDYDHRTPLHVAASEGLYIMAKLLIEAGASVFSKDRWGNTPLD-----EARMCGN  750

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L +A S    +    S        P++C    +++  HP   ++ +    G 
Sbjct  751  KNLIK--LLEDAKSTQLSELAHCSKEFTDKIHPKKC----TVFPFHPWDAKDQR--RHGI  802

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            ++ +P T+  L++ A E+L        LT+  G I+D +D+I D +KL+++ 
Sbjct  803  VLWIPHTMEALVTTAAEQLDLAGASCMLTENGGKILD-VDMINDGEKLYLIG  853



>emb|CDY28715.1| BnaCnng06010D [Brassica napus]
Length=830

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 102/229 (45%), Gaps = 11/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + ++L    +      AG  LC      DS  ++ LL +G
Sbjct  611  IKDKLGNTPLLEAIKNGNDRVATLLVKEGATLSIENAGTFLCTVVAKGDSDFLKRLLNNG  670

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    + + LV  GA +    +    PLD   V   +    
Sbjct  671  IDPNSKDYDQRTPLHVASSEGLYLLARQLVEAGANVLKKDRWGNTPLDEALVCGNK----  726

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQC-SIRVSIYRGHPATRRETQCPEPGRLIKL  397
               M   +L +A +        +S  +  +    + ++Y  HP   +E +    G ++ +
Sbjct  727  ---MLIKLLEDAKTSQMSSFLNSSKEIKDKVYKKKCTVYSSHPNDSKEKR--RRGIVLWV  781

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P +I EL+  A E+L F      L+++EG IID +++I D  KL++  +
Sbjct  782  PRSIEELVRTAAEQLNFPEASCVLSEDEGKIID-VELISDGQKLYLTIE  829



>ref|XP_009134714.1| PREDICTED: potassium channel SKOR [Brassica rapa]
Length=829

 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 102/229 (45%), Gaps = 11/229 (5%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + ++L    +      AG  LC      DS  ++ LL +G
Sbjct  610  IKDKLGNTPLLEAIKNGNDRVAALLVKEGATLSIENAGTFLCTVVAKRDSDFLKRLLNNG  669

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +SKD    T +  A  E    +   LV  GA +    +    PLD         LG 
Sbjct  670  IDPNSKDYDHRTPLHVAASEGLYLLAMQLVEAGANVLKKDRWGNTPLD-------EALGC  722

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSMPQQC-SIRVSIYRGHPATRRETQCPEPGRLIKL  397
               M   +L +A S        +S  +  +    + ++Y  HP   +ET+    G ++ +
Sbjct  723  GNKMLIKLLEDAKSSQMSSLPSSSKELKDRVYKKKCTVYSSHPNDAKETR--RHGIVLWV  780

Query  396  PETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            P +I EL+  A E+L      S L+++EG IID +D+I D  KL++  +
Sbjct  781  PRSIEELVRTAAEQLNVSEASSVLSEDEGKIID-VDLISDGQKLYLTVE  828



>gb|KJB53298.1| hypothetical protein B456_009G114200 [Gossypium raimondii]
Length=830

 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 108/232 (47%), Gaps = 19/232 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            LKD  GNT L +AI     ++ ++L    +  +   AG  LC A    DS  ++ LL +G
Sbjct  610  LKDKFGNTPLLEAIKNGHDNLAALLIKEGASLNIDDAGSYLCTAVAKGDSDFLRRLLSNG  669

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGH  574
            +  +S+D    T +  A  E    M KLL+  GA +    +    PLD     + R  G+
Sbjct  670  VDPNSRDYDHRTPLHVAASEGLYIMAKLLIEAGASVFSKDRWGNTPLD-----EARMCGN  724

Query  573  RIAMPNTILHEAASKWAKDDHQNSSSM-----PQQCSIRVSIYRGHPATRRETQCPEPGR  409
            +  +   +L +A S    +    S        P++C    +++  HP   ++ +    G 
Sbjct  725  KNLIK--LLEDAKSTQLSELAHCSKEFTDKIHPKKC----TVFPFHPWDAKDQR--RHGI  776

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            ++ +P T+  L++ A E+L        LT+  G I+D +D+I D +KL+++ 
Sbjct  777  VLWIPHTMEALVTTAAEQLDLAGASCMLTENGGKILD-VDMINDGEKLYLIG  827



>emb|CDY51528.1| BnaA05g33280D [Brassica napus]
Length=829

 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 107/233 (46%), Gaps = 19/233 (8%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            +KD  GNT L +AI      + ++L    +      AG  LC      DS  ++ LL +G
Sbjct  610  IKDKLGNTPLLEAIKNGNDRVAALLVKEGATLSIENAGTFLCTVVAKGDSDFLKRLLNNG  669

Query  753  LHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKREL--  580
            +  +SKD    T +  A  E    + + LV  GA +    +    PLD   V   + L  
Sbjct  670  IDPNSKDYDQRTPLHVASSEGLYLLARQLVEAGANVLKKDRWGNTPLDEALVCGNKMLIK  729

Query  579  ---GHRIAMPNTILHEAASKWAKDDHQNSSSMPQQCSIRVSIYRGHPATRRETQCPEPGR  409
                 + +  +T L+  +SK  KD         ++C    ++Y  HP   +E +    G 
Sbjct  730  LLEDAKTSQMSTFLN--SSKEIKD-----KVYKKKC----TVYSSHPNDSKEKR--RRGI  776

Query  408  LIKLPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ +P++I EL+  A E+L F      L+++EG IID +++I D  KL++  +
Sbjct  777  VLWVPKSIEELVRSAAEQLNFPEASCVLSEDEGKIID-VELISDGQKLYLTIE  828



>ref|XP_010670705.1| PREDICTED: potassium channel AKT1 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=871

 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 69/279 (25%), Positives = 119/279 (43%), Gaps = 57/279 (20%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL---LCKAAKMNDSSVMQELL  763
            +KD EGN  LWDAI  K  S+  +L    +       GD+      A + ++  ++++++
Sbjct  589  VKDSEGNIPLWDAILGKHDSLIKLLRDRGA---DLALGDVPRYASHAIEQDNLQLLKDIV  645

Query  762  KHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD-------------------  640
            ++G  + + +  GST +  A+     ++++ ++  G +ID                    
Sbjct  646  RYGGDLTTSNSDGSTPLHFAVSSGNMNIVQFILEQGGDIDKPDVDKWTPRSLADFQGNEE  705

Query  639  ---------------AVKLN-LAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAK---D  517
                           AVK +  A    + +++    G     PNT+      K  +   D
Sbjct  706  IKALFDSKKKAGLDPAVKFSGTATGPASRIMKYPSTGTINVPPNTVQMTQVEKNPRRQVD  765

Query  516  DHQNSSSMPQQCSIR--------VSIYRGHPATRRETQCPEPG---RLIKLPETIAELIS  370
              QNS       + R        +S   G+ ATR   +CPE     +L+ LP+T+ EL+ 
Sbjct  766  TFQNSLFGFVSAATRGESVDLNNLSNTSGNQATRVTLRCPEKSEVTKLVMLPKTMQELLE  825

Query  369  IAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            I G+K G     S +   EGA ID ID+IRD D+L ++ 
Sbjct  826  IGGKKFGCHC--SKVVTAEGAEIDEIDLIRDGDQLSLIC  862



>dbj|BAD81036.1| potassium channel TORK1 [Nicotiana tabacum]
Length=827

 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/227 (26%), Positives = 108/227 (48%), Gaps = 19/227 (8%)
 Frame = -3

Query  915  NTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSK  736
             T L++AI      + S+L    +      AG  LC      DS +++ LL +G+  +SK
Sbjct  613  TTPLFEAIKNGHDRVASLLVKEGAFLKIENAGSFLCMLVAKGDSDLLRRLLSNGIDPNSK  672

Query  735  DRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPN  556
            D    T +  A  +    M +LL+  GA +    +    P D   +    +L        
Sbjct  673  DYDHRTPLHVAASQGLFAMARLLLGAGASVFSKDRWGNTPFDEARLSGNNQLA-------  725

Query  555  TILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
             +L EA     S++    H+ S  M PQ+C    +++  HP   ++ +  + G ++ +P+
Sbjct  726  KLLEEAKSAQISEFPIAPHEISEKMHPQKC----TVFPFHPWEPKDLR--KHGVVLWIPK  779

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ ELI+ A E+L F +    L+++ G I+D I +I D  KL+++++
Sbjct  780  SMEELITTASEQLNFPSGSCILSEDAGKILD-IGLISDGQKLYLISE  825



>ref|XP_009762658.1| PREDICTED: potassium channel SKOR-like [Nicotiana sylvestris]
Length=827

 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/227 (26%), Positives = 108/227 (48%), Gaps = 19/227 (8%)
 Frame = -3

Query  915  NTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGLHVDSK  736
             T L++AI      + S+L    +      AG  LC      DS +++ LL +G+  +SK
Sbjct  613  TTPLFEAIKNGHDRVASLLVKEGAFLKIENAGSFLCMLVAKGDSDLLRRLLSNGIDPNSK  672

Query  735  DRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHRIAMPN  556
            D    T +  A  +    M +LL+  GA +    +    P D   +    +L        
Sbjct  673  DYDHRTPLHVAASQGLFAMARLLLGAGASVFSKDRWGNTPFDEARLSGNNQL-------T  725

Query  555  TILHEAA----SKWAKDDHQNSSSM-PQQCSIRVSIYRGHPATRRETQCPEPGRLIKLPE  391
             +L EA     S++    H+ S  M PQ+C    +++  HP   ++ +  + G ++ +P+
Sbjct  726  KLLEEAKSAQISEFPIAPHEISEKMHPQKC----TVFPFHPWEPKDLR--KHGVVLWIPK  779

Query  390  TIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            ++ ELI+ A E+L F +    L+++ G I+D I +I D  KL+++++
Sbjct  780  SMEELITTASEQLNFPSGSCILSEDAGKILD-IGLISDGQKLYLISE  825



>ref|XP_010670706.1| PREDICTED: potassium channel AKT1 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=867

 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 69/279 (25%), Positives = 119/279 (43%), Gaps = 57/279 (20%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDL---LCKAAKMNDSSVMQELL  763
            +KD EGN  LWDAI  K  S+  +L    +       GD+      A + ++  ++++++
Sbjct  585  VKDSEGNIPLWDAILGKHDSLIKLLRDRGA---DLALGDVPRYASHAIEQDNLQLLKDIV  641

Query  762  KHGLHVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDD-------------------  640
            ++G  + + +  GST +  A+     ++++ ++  G +ID                    
Sbjct  642  RYGGDLTTSNSDGSTPLHFAVSSGNMNIVQFILEQGGDIDKPDVDKWTPRSLADFQGNEE  701

Query  639  ---------------AVKLN-LAPLDLTEVLQKRELGHRIAMPNTILHEAASKWAK---D  517
                           AVK +  A    + +++    G     PNT+      K  +   D
Sbjct  702  IKALFDSKKKAGLDPAVKFSGTATGPASRIMKYPSTGTINVPPNTVQMTQVEKNPRRQVD  761

Query  516  DHQNSSSMPQQCSIR--------VSIYRGHPATRRETQCPEPG---RLIKLPETIAELIS  370
              QNS       + R        +S   G+ ATR   +CPE     +L+ LP+T+ EL+ 
Sbjct  762  TFQNSLFGFVSAATRGESVDLNNLSNTSGNQATRVTLRCPEKSEVTKLVMLPKTMQELLE  821

Query  369  IAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVA  253
            I G+K G     S +   EGA ID ID+IRD D+L ++ 
Sbjct  822  IGGKKFGCHC--SKVVTAEGAEIDEIDLIRDGDQLSLIC  858



>emb|CDX71184.1| BnaC07g04630D [Brassica napus]
Length=734

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 60/231 (26%), Positives = 104/231 (45%), Gaps = 15/231 (6%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            KD  GNT L +A+ A +  +  +L    +  D   AG+ LC      DS  ++ LL  G+
Sbjct  509  KDKFGNTPLLEAVKAGQDRVIDLLVKEGASFDLEDAGNFLCTVVVKGDSDFLKRLLSSGM  568

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTEVLQKRELGHR  571
              +++D    T +  A  E    M K+LV  GA +    +   +PLD   +   ++L   
Sbjct  569  DPNTEDYDHRTPLHVAASEGLFLMAKMLVEAGASVVAKDRWGNSPLDEARMCGNKKLIKL  628

Query  570  IAMPNTILHEAASKWAKDDHQNSSSMPQQCSI---RVSIYRGHPATRRETQCPEPGRLIK  400
            +   NT     A  + +    +S   PQ       + +++  HP    E    + G ++ 
Sbjct  629  LEDANT-----AQPYIR---PSSFHEPQDEKFERRKCTVFPFHP---HEEPSRKHGVMVW  677

Query  399  LPETIAELISIAGEKLGF-DATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            LP  + +L+  A ++LG  +     +  EEG  I  ID+I D  KL++++D
Sbjct  678  LPRDLQKLVETAAQELGISNEVPFVILSEEGGRITDIDMISDGQKLYLISD  728



>gb|AAF36832.1|AF207745_1 AKT1-like potassium channel [Triticum aestivum]
Length=897

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 121/290 (42%), Gaps = 71/290 (24%)
 Frame = -3

Query  930  KDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHGL  751
            +D EG   LW+A+ AK  ++  +L    +           C A + N+  +++++LKH +
Sbjct  603  RDSEGKVPLWEAVYAKHDTVVQLLVKGGAELSSGDTSLYACTAVEQNNIELLKQILKHVI  662

Query  750  HVDSKDRHGSTAIQAAMEENQADMIKLLVMNGAEIDDAVKLNLAPLDLTE----------  601
             V+   + G+  +  A+ +   +M++LL+ +GA+ID        P  L E          
Sbjct  663  DVNRPSKDGNIPLHRAVCDGNVEMVELLLRHGADIDKQDSNGWTPRALAEQQGHEEIQNL  722

Query  600  ---VLQKRE-----------LGHRIAMPNT--ILHEAASKWAKDDHQNSSSMPQQ--CSI  475
               V+  R+           LG   + P+   ++HE        + Q S  +PQ+   S 
Sbjct  723  FRSVIAPRKYTSNGRVTPMLLGRFSSDPSMQKVIHEDV------EQQPSKVLPQRRKVSF  776

Query  474  RVSIY-----------------RG--------------HPATRRETQCPE----PGRLIK  400
              S++                 RG              +P  R    CPE     G+L+ 
Sbjct  777  HNSLFGVISSAHPRRETDHLLSRGLAATGGPTYPQAHHNPLIRVTISCPEMGNTAGKLVI  836

Query  399  LPETIAELISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            LP +I EL+ +  +K  FD   + +   EGA +D +++IRD D L + +D
Sbjct  837  LPGSIKELLQLGAKK--FDMMPTKVLTIEGAEVDEVELIRDGDHLVLASD  884



>ref|XP_006450501.1| hypothetical protein CICLE_v10007406mg [Citrus clementina]
 gb|ESR63741.1| hypothetical protein CICLE_v10007406mg [Citrus clementina]
Length=887

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 116/283 (41%), Gaps = 58/283 (20%)
 Frame = -3

Query  933  LKDMEGNTALWDAIAAKEHSIFSILYHWASISDPYVAGDLLCKAAKMNDSSVMQELLKHG  754
            ++D EG+  LW+A+  K   +  IL    ++      G   C A + ND  ++++++ +G
Sbjct  603  IRDSEGSVPLWEAMLGKHEPVVRILAENGALISSSDVGHFACTAIEQNDLLLLEKIVHYG  662

Query  753  -------------LHV--------------------DSKDRHGSTAIQAAMEENQADMIK  673
                         LHV                    D  D HG T    A  + Q D+  
Sbjct  663  GDVTQLTSNGTTPLHVAISEGNIEIVKFLIDQGSDIDKPDIHGWTPRALADHQGQEDIQI  722

Query  672  LLVMN----GAEIDDAVKLNLAPLDLTEVLQKRELGHRI--------AMPNTILHEAASK  529
            LL M      A +    K   AP     +++      +         A+P   L    S+
Sbjct  723  LLQMKPEPKKAPVLTVPKKQQAPNPRKHLVKYSSEPSKPPYTPEVVSAVPEINLLNRHSR  782

Query  528  WAKDDHQNS------SSMPQQCSIRVSIYRGHPATRRETQCPE----PGRLIKLPETIAE  379
               +   NS      ++   + SI       +P  R    CPE     G+L+ LP+++ E
Sbjct  783  RRPNTFHNSLFGIVSAANTGEHSINFPTVSSYPP-RVTISCPEKGQVSGKLVLLPKSLQE  841

Query  378  LISIAGEKLGFDATDSSLTDEEGAIIDSIDVIRDNDKLFIVAD  250
            L+SIA  K GF  T S +  +EGA ID + +IRD+D LFIV+D
Sbjct  842  LLSIASTKFGF--TPSKILSKEGAEIDDVGLIRDDDHLFIVSD  882



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2461769758271