BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11147

Length=850
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        253   4e-75   Nicotiana tomentosiformis
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        250   3e-74   Nicotiana sylvestris
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        242   3e-71   Solanum tuberosum [potatoes]
ref|XP_002527509.1|  zinc finger protein, putative                      241   1e-70   Ricinus communis
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             240   2e-70   Solanum lycopersicum
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             240   2e-70   Citrus clementina [clementine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   238   9e-70   Citrus sinensis [apfelsine]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        238   9e-70   Citrus sinensis [apfelsine]
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   238   1e-69   Citrus sinensis [apfelsine]
gb|KJB32252.1|  hypothetical protein B456_005G231800                    238   1e-69   Gossypium raimondii
ref|XP_012093114.1|  PREDICTED: vacuolar-sorting receptor 3             237   2e-69   Jatropha curcas
gb|AAF22842.1|AF209910_1  vacuolar sorting receptor protein             221   1e-68   Prunus dulcis [sweet almond]
gb|KHG15071.1|  Vacuolar-sorting receptor 3 -like protein               230   2e-68   Gossypium arboreum [tree cotton]
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        234   3e-68   Nelumbo nucifera [Indian lotus]
emb|CDO97275.1|  unnamed protein product                                233   6e-68   Coffea canephora [robusta coffee]
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               233   1e-67   Gossypium arboreum [tree cotton]
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             234   1e-67   
emb|CBI22461.3|  unnamed protein product                                233   1e-67   Vitis vinifera
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             233   1e-67   Vitis vinifera
gb|KJB79450.1|  hypothetical protein B456_013G050300                    232   2e-67   Gossypium raimondii
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             232   2e-67   Theobroma cacao [chocolate]
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                232   3e-67   Erythranthe guttata [common monkey flower]
ref|NP_179081.1|  vacuolar-sorting receptor 3                           230   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        230   1e-66   Sesamum indicum [beniseed]
emb|CDX81459.1|  BnaC09g08700D                                          230   1e-66   
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        229   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             229   3e-66   
emb|CDX93144.1|  BnaA03g38660D                                          228   3e-66   
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             229   4e-66   Eutrema salsugineum [saltwater cress]
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             228   5e-66   Brassica rapa
emb|CDY65441.1|  BnaCnng47180D                                          228   5e-66   Brassica napus [oilseed rape]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    228   5e-66   Arabis alpina [alpine rockcress]
emb|CDY37219.1|  BnaA09g08400D                                          228   6e-66   Brassica napus [oilseed rape]
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             228   7e-66   Populus euphratica
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             228   7e-66   Prunus mume [ume]
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        228   8e-66   Sesamum indicum [beniseed]
ref|NP_179079.1|  vacuolar-sorting receptor 4                           228   8e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        227   2e-65   Cucumis sativus [cucumbers]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             226   2e-65   Capsella rubella
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        226   2e-65   Cucumis melo [Oriental melon]
gb|AAB72112.1|  vacuolar sorting receptor homolog                       226   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        226   4e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        225   6e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             225   7e-65   Camelina sativa [gold-of-pleasure]
gb|KJB12291.1|  hypothetical protein B456_002G010300                    225   7e-65   Gossypium raimondii
gb|KJB12292.1|  hypothetical protein B456_002G010300                    225   7e-65   Gossypium raimondii
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        225   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             225   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        225   9e-65   Brassica rapa
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            225   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             224   1e-64   Eutrema salsugineum [saltwater cress]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             224   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002489188.1|  hypothetical protein SORBIDRAFT_0013s004010        211   3e-64   
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        224   3e-64   Populus euphratica
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        223   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             223   5e-64   Prunus persica
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        223   5e-64   
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        223   5e-64   Pyrus x bretschneideri [bai li]
ref|XP_002885935.1|  VSR-2                                              223   6e-64   
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    223   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    223   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        223   7e-64   
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        222   2e-63   Glycine max [soybeans]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             221   2e-63   Glycine soja [wild soybean]
gb|AGV54776.1|  vacuolar-sorting receptor                               221   2e-63   Phaseolus vulgaris [French bean]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             221   3e-63   Phaseolus vulgaris [French bean]
gb|AEZ00905.1|  putative BP-80 vacuolar sorting receptor protein        211   3e-63   Elaeis guineensis
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    221   3e-63   Glycine max [soybeans]
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             221   3e-63   Glycine soja [wild soybean]
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             221   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_003610620.1|  Vacuolar-sorting receptor                          221   3e-63   
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             221   4e-63   Phaseolus vulgaris [French bean]
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        221   4e-63   Cicer arietinum [garbanzo]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        221   6e-63   Eucalyptus grandis [rose gum]
gb|EAY78120.1|  hypothetical protein OsI_33166                          209   6e-63   Oryza sativa Indica Group [Indian rice]
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    220   7e-63   Arabis alpina [alpine rockcress]
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             219   2e-62   Glycine soja [wild soybean]
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    219   2e-62   Glycine max [soybeans]
gb|ERN10922.1|  hypothetical protein AMTR_s00164p00059220               218   3e-62   Amborella trichopoda
ref|XP_006849341.2|  PREDICTED: vacuolar-sorting receptor 3 isofo...    218   3e-62   Amborella trichopoda
ref|XP_003592523.1|  Vacuolar-sorting receptor                          216   2e-61   
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  216   2e-61   Medicago truncatula
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    216   2e-61   Cicer arietinum [garbanzo]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             216   2e-61   Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    216   3e-61   Glycine max [soybeans]
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    216   3e-61   
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        215   4e-61   Morus notabilis
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        215   6e-61   
ref|NP_001064400.1|  Os10g0346600                                       215   7e-61   
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    214   9e-61   Pisum sativum [garden pea]
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        214   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008779827.1|  PREDICTED: vacuolar-sorting receptor 4-like        200   3e-60   
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             213   3e-60   Fragaria vesca subsp. vesca
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        213   4e-60   Phoenix dactylifera
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        212   5e-60   Elaeis guineensis
gb|ABR17683.1|  unknown                                                 210   4e-59   Picea sitchensis
ref|XP_011625221.1|  PREDICTED: vacuolar-sorting receptor 3 isofo...    210   4e-59   
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        209   8e-59   Elaeis guineensis
ref|XP_011652916.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    209   1e-58   Cucumis sativus [cucumbers]
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    209   1e-58   Cucumis sativus [cucumbers]
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              206   1e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    206   1e-57   Cucumis melo [Oriental melon]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    206   1e-57   Cucumis melo [Oriental melon]
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        201   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        201   1e-55   Fragaria vesca subsp. vesca
dbj|BAJ85815.1|  predicted protein                                      196   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN30885.1|  unknown                                                 199   5e-55   Zea mays [maize]
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     199   5e-55   Zea mays [maize]
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        198   8e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        198   1e-54   Brachypodium distachyon [annual false brome]
gb|ACS91931.1|  vacuolar sorting receptor protein                       196   2e-54   Lilium longiflorum [Easter lily]
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        197   2e-54   
gb|EPS57970.1|  hypothetical protein M569_16845                         196   3e-54   Genlisea aurea
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    196   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    196   4e-54   Tarenaya hassleriana [spider flower]
gb|EPS72755.1|  hypothetical protein M569_02000                         194   4e-54   Genlisea aurea
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    196   5e-54   Ricinus communis
ref|XP_011001696.1|  PREDICTED: vacuolar-sorting receptor 1-like        194   1e-53   Populus euphratica
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        195   1e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002309184.1|  vacuolar sorting receptor family protein           194   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    194   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        194   3e-53   Populus euphratica
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             194   4e-53   Prunus persica
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             193   4e-53   Brachypodium distachyon [annual false brome]
emb|CDP06387.1|  unnamed protein product                                194   4e-53   Coffea canephora [robusta coffee]
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             193   5e-53   Vitis vinifera
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        193   5e-53   Setaria italica
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        192   8e-53   Sesamum indicum [beniseed]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    192   9e-53   Nicotiana sylvestris
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        192   1e-52   Oryza brachyantha
ref|XP_006842496.1|  PREDICTED: vacuolar-sorting receptor 1             192   1e-52   Amborella trichopoda
ref|XP_006374052.1|  hypothetical protein POPTR_0016s14430g             191   2e-52   
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    190   7e-52   Nicotiana sylvestris
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        189   1e-51   Eucalyptus grandis [rose gum]
ref|XP_012091044.1|  PREDICTED: vacuolar-sorting receptor 1-like        189   2e-51   Jatropha curcas
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        188   3e-51   Sesamum indicum [beniseed]
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    188   4e-51   Nicotiana tomentosiformis
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        188   4e-51   Populus euphratica
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    188   5e-51   
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        188   5e-51   
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             187   7e-51   Selaginella moellendorffii
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             187   8e-51   
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    187   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        187   1e-50   Elaeis guineensis
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        187   1e-50   Phoenix dactylifera
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1             186   2e-50   Cucumis sativus [cucumbers]
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    186   2e-50   Solanum lycopersicum
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    186   3e-50   Nicotiana tomentosiformis
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                186   3e-50   Erythranthe guttata [common monkey flower]
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    186   3e-50   Solanum lycopersicum
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        186   3e-50   Solanum tuberosum [potatoes]
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             185   4e-50   
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               185   6e-50   Gossypium arboreum [tree cotton]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             184   8e-50   Eutrema salsugineum [saltwater cress]
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        184   8e-50   
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        184   8e-50   Morus notabilis
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             184   9e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    184   9e-50   
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        184   1e-49   Eucalyptus grandis [rose gum]
gb|ACN25155.1|  unknown                                                 177   1e-49   Zea mays [maize]
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                184   1e-49   
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    184   1e-49   
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          184   2e-49   Sorghum bicolor [broomcorn]
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        183   2e-49   Phoenix dactylifera
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             186   2e-49   Triticum urartu
ref|NP_190853.1|  vacuolar-sorting receptor 1                           183   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82551.1|  AT3g52850/F8J2_20                                       183   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                       183   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|EMS68621.1|  Vacuolar-sorting receptor 4                             175   3e-49   Triticum urartu
dbj|BAK03786.1|  predicted protein                                      183   5e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB71519.1|  hypothetical protein B456_011G126800                    182   6e-49   Gossypium raimondii
gb|EEE52644.1|  hypothetical protein OsJ_35003                          182   6e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        182   6e-49   Oryza brachyantha
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    182   7e-49
gb|EEC68730.1|  hypothetical protein OsI_37233                          182   7e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        182   8e-49   Oryza brachyantha
gb|EEE51529.1|  hypothetical protein OsJ_32728                          182   8e-49   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                          182   9e-49   Oryza sativa Indica Group [Indian rice]
gb|EMS63262.1|  Vacuolar-sorting receptor 1                             183   1e-48   Triticum urartu
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    181   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             181   1e-48   Eutrema salsugineum [saltwater cress]
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             181   1e-48   Capsella rubella
ref|NP_001060643.1|  Os07g0680000                                       181   1e-48   
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    181   1e-48   Arabis alpina [alpine rockcress]
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             181   1e-48   
gb|EEC82690.1|  hypothetical protein OsI_27347                          181   2e-48   Oryza sativa Indica Group [Indian rice]
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               181   2e-48   Gossypium arboreum [tree cotton]
ref|NP_001065992.1|  Os12g0116000                                       181   2e-48   
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        180   3e-48   Nicotiana sylvestris
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        180   3e-48   Prunus mume [ume]
emb|CDX78128.1|  BnaA09g33230D                                          180   3e-48   
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        180   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        179   5e-48   Zea mays [maize]
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              179   5e-48   
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        179   5e-48   Brassica rapa
emb|CDX67539.1|  BnaA07g15790D                                          179   6e-48   
emb|CDY13344.1|  BnaC06g14130D                                          179   6e-48   Brassica napus [oilseed rape]
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        179   6e-48   
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                179   9e-48   Erythranthe guttata [common monkey flower]
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             179   9e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        178   1e-47   Nicotiana tomentosiformis
gb|ACR34782.1|  unknown                                                 172   1e-47   Zea mays [maize]
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             178   1e-47   Cucumis melo [Oriental melon]
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        178   2e-47   Oryza brachyantha
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    177   3e-47   
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             177   3e-47   Brassica rapa
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          177   3e-47   Sorghum bicolor [broomcorn]
emb|CDX73599.1|  BnaC08g24040D                                          177   3e-47   
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        177   4e-47   Brassica rapa
emb|CDY60753.1|  BnaA05g34780D                                          177   4e-47   Brassica napus [oilseed rape]
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             177   4e-47   Citrus clementina [clementine]
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        177   4e-47   Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             177   5e-47   Glycine soja [wild soybean]
ref|XP_010252052.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    175   7e-47   
dbj|BAK00302.1|  predicted protein                                      176   7e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001050034.1|  Os03g0335300                                       176   8e-47   
gb|KJB32254.1|  hypothetical protein B456_005G231800                    176   9e-47   Gossypium raimondii
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        176   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        176   1e-46   Oryza brachyantha
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             176   1e-46   
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             176   1e-46   Selaginella moellendorffii
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    176   1e-46   Solanum tuberosum [potatoes]
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    175   2e-46   Nelumbo nucifera [Indian lotus]
emb|CDX91478.1|  BnaC04g06720D                                          175   2e-46   
gb|KJB29888.1|  hypothetical protein B456_005G122400                    175   2e-46   Gossypium raimondii
emb|CDY38158.1|  BnaA07g02250D                                          169   3e-46   Brassica napus [oilseed rape]
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    174   3e-46   Setaria italica
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    174   4e-46   
ref|XP_001777810.1|  predicted protein                                  174   4e-46   
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             173   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        173   8e-46   Brachypodium distachyon [annual false brome]
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        173   9e-46   Glycine max [soybeans]
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             173   1e-45   Phaseolus vulgaris [French bean]
gb|EPS73119.1|  hypothetical protein M569_01632                         173   1e-45   Genlisea aurea
ref|XP_003626680.1|  Vacuolar sorting receptor                          172   2e-45   Medicago truncatula
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        172   2e-45   Solanum lycopersicum
ref|NP_001292791.1|  vacuolar sorting receptor homolog1 precursor       172   3e-45   Zea mays [maize]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        172   3e-45   Glycine max [soybeans]
emb|CDY04821.1|  BnaAnng00030D                                          172   3e-45   
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             171   4e-45   Glycine soja [wild soybean]
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             171   4e-45   
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             171   5e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7             171   7e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        171   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             171   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        171   8e-45   Camelina sativa [gold-of-pleasure]
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    170   1e-44   Arabis alpina [alpine rockcress]
gb|KGN58685.1|  hypothetical protein Csa_3G728020                       160   1e-44   Cucumis sativus [cucumbers]
gb|KJB29887.1|  hypothetical protein B456_005G122400                    170   1e-44   Gossypium raimondii
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             170   1e-44   Phaseolus vulgaris [French bean]
gb|KJB29886.1|  hypothetical protein B456_005G122400                    170   1e-44   Gossypium raimondii
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          170   1e-44   Sorghum bicolor [broomcorn]
ref|NP_001169232.1|  hypothetical protein precursor                     170   1e-44   Zea mays [maize]
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like        169   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             169   2e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like        169   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             168   5e-44   
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        168   8e-44   Brachypodium distachyon [annual false brome]
gb|KJB12294.1|  hypothetical protein B456_002G010300                    167   9e-44   Gossypium raimondii
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like        167   9e-44   Pyrus x bretschneideri [bai li]
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        167   9e-44   Cicer arietinum [garbanzo]
dbj|BAB64531.1|  vacuolar sorting receptor                              167   1e-43   Vigna mungo [urad dal]
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like        167   1e-43   Malus domestica [apple tree]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        167   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180588.1|  vacuolar-sorting receptor 2                           167   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EMT02959.1|  Vacuolar-sorting receptor 4                             166   2e-43   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like        166   2e-43   Pyrus x bretschneideri [bai li]
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             166   3e-43   Triticum urartu
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   4e-43   Cicer arietinum [garbanzo]
dbj|BAK05589.1|  predicted protein                                      166   5e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003623631.1|  Vacuolar sorting receptor                          165   6e-43   Medicago truncatula
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6             165   6e-43   Elaeis guineensis
gb|AAB72113.1|  vacuolar sorting receptor homolog                       155   7e-43   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like        165   9e-43   Nicotiana tomentosiformis
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6             164   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg             164   2e-42   Prunus persica
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7             164   2e-42   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like        163   3e-42   
ref|XP_001759820.1|  predicted protein                                  163   3e-42   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like        163   3e-42   
emb|CAN66483.1|  hypothetical protein VITISV_015390                     163   3e-42   
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        163   4e-42   
gb|ABR17707.1|  unknown                                                 163   4e-42   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6             163   4e-42   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6             162   5e-42   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                        162   6e-42   
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    162   6e-42   
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    162   1e-41   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    162   1e-41   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like        162   1e-41   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like        162   1e-41   
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             161   1e-41   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180          161   1e-41   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7             161   2e-41   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like        161   2e-41   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like        160   2e-41   
emb|CBI27239.3|  unnamed protein product                                164   2e-41   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    160   3e-41   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like        160   4e-41   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like        159   8e-41   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like        159   9e-41   
gb|AAG60258.1|  EGF receptor-like protein                               155   9e-41   
gb|KEH37345.1|  vacuolar-sorting receptor                               159   9e-41   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg             159   1e-40   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g             159   1e-40   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like        159   1e-40   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg             159   1e-40   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7             158   1e-40   
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    158   2e-40   
gb|EEE61664.1|  hypothetical protein OsJ_16123                          158   2e-40   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like        157   3e-40   
ref|XP_001785165.1|  predicted protein                                  157   3e-40   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    157   3e-40   
emb|CAE03573.2|  OSJNBa0085I10.18                                       157   3e-40   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    157   3e-40   
ref|NP_001053838.1|  Os04g0611400                                       157   3e-40   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    157   3e-40   
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   157   3e-40   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg             157   5e-40   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like        157   5e-40   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6             157   5e-40   
ref|XP_012065972.1|  PREDICTED: vacuolar-sorting receptor 6-like        157   6e-40   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6             156   7e-40   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6             156   7e-40   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5             156   8e-40   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like        156   8e-40   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    156   8e-40   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg             156   1e-39   
emb|CDY62642.1|  BnaCnng40690D                                          146   1e-39   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7             155   1e-39   
ref|XP_006853456.1|  PREDICTED: vacuolar-sorting receptor 6             155   1e-39   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210             155   1e-39   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5             155   1e-39   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg             155   2e-39   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like        155   2e-39   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7             155   2e-39   
ref|NP_174375.1|  vacuolar sorting receptor 6                           155   2e-39   
emb|CDY50060.1|  BnaCnng18670D                                          155   2e-39   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like        155   2e-39   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                        155   2e-39   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    155   2e-39   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                  155   2e-39   
ref|NP_193744.1|  vacuolar-sorting receptor 7                           155   2e-39   
gb|KHN26599.1|  Vacuolar-sorting receptor 6                             154   3e-39   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6             154   4e-39   
emb|CDY02347.1|  BnaA09g25550D                                          154   4e-39   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like        154   4e-39   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857             154   5e-39   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein               154   5e-39   
emb|CDX78975.1|  BnaA01g10420D                                          154   5e-39   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    154   6e-39   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                    154   6e-39   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    154   6e-39   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                    154   6e-39   
ref|XP_002304606.1|  vacuolar sorting receptor family protein           154   6e-39   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    153   8e-39   
emb|CDY43178.1|  BnaCnng11060D                                          153   8e-39   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733             153   9e-39   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6             153   1e-38   
ref|XP_001765481.1|  predicted protein                                  153   1e-38   
gb|ACN28195.1|  unknown                                                 152   1e-38   
gb|AFW87686.1|  vacuolar sorting receptor 7                             152   1e-38   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor              152   1e-38   
gb|EEC81131.1|  hypothetical protein OsI_24020                          152   2e-38   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg             152   2e-38   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg             152   2e-38   
ref|NP_001058298.1|  Os06g0664300                                       152   2e-38   
gb|KJB48040.1|  hypothetical protein B456_008G051500                    152   2e-38   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like        152   2e-38   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg             152   3e-38   
ref|XP_001776090.1|  predicted protein                                  152   3e-38   
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    151   5e-38   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like        151   6e-38   
emb|CDP18160.1|  unnamed protein product                                151   6e-38   
dbj|BAJ97179.1|  predicted protein                                      151   6e-38   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg                151   7e-38   
dbj|BAJ91572.1|  predicted protein                                      151   8e-38   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg             150   9e-38   
ref|XP_001759928.1|  predicted protein                                  150   9e-38   
emb|CAA16619.1|  vacuolar sorting receptor-like protein                 150   9e-38   
emb|CDY64650.1|  BnaAnng19540D                                          150   1e-37   
emb|CDY43647.1|  BnaA04g20440D                                          149   2e-37   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                        149   2e-37   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like        149   3e-37   
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             149   5e-37   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544          148   7e-37   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like        147   9e-37   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g             147   1e-36   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    150   1e-36   
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             145   3e-36   
ref|NP_181040.1|  vacuolar-sorting receptor 5                           146   3e-36   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                    145   7e-36   
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    145   8e-36   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6             144   1e-35   
dbj|BAJ91429.1|  predicted protein                                      135   9e-35   
gb|EMS55782.1|  Vacuolar-sorting receptor 7                             140   4e-34   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                     139   7e-34   
ref|XP_001751750.1|  predicted protein                                  137   5e-33   
gb|KDO64104.1|  hypothetical protein CISIN_1g0100102mg                  126   2e-32   
dbj|BAJ88964.1|  predicted protein                                      135   3e-32   
ref|XP_002528135.1|  hypothetical protein RCOM_1195900                  128   3e-32   
gb|AAF98196.1|AC000107_19  F17F8.23                                     134   8e-32   
gb|EYU23259.1|  hypothetical protein MIMGU_mgv1a0227551mg               125   3e-31   
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        130   8e-31   
gb|KJB71518.1|  hypothetical protein B456_011G126800                    129   2e-30   
gb|EPS72005.1|  hypothetical protein M569_02753                         126   2e-29   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                  116   1e-25   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    116   1e-25   
gb|KJB48041.1|  hypothetical protein B456_008G051500                    115   3e-25   
emb|CDP17487.1|  unnamed protein product                                113   6e-25   
emb|CDY12449.1|  BnaC08g09380D                                          109   3e-24   
dbj|BAD94353.1|  putative vacuolar sorting receptor                     103   4e-24   
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...  99.4    8e-20   
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)        93.2    1e-17   
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site     93.2    1e-17   
gb|KDO64105.1|  hypothetical protein CISIN_1g0100102mg                85.5    2e-17   
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                 74.7    2e-17   
ref|XP_001419041.1|  predicted protein                                89.4    2e-16   
gb|EMT15960.1|  hypothetical protein F775_17906                       88.6    2e-16   
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...  86.3    2e-15   
ref|XP_002501193.1|  predicted protein                                82.8    2e-14   
ref|XP_002501531.1|  predicted protein                                82.4    4e-14   
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                   57.8    7e-13   
gb|AFW64624.1|  hypothetical protein ZEAMMB73_291086                  70.5    3e-12   
gb|KJB32253.1|  hypothetical protein B456_005G231800                  70.1    3e-10   
ref|XP_003064631.1|  predicted protein                                69.7    5e-10   
gb|KJB12290.1|  hypothetical protein B456_002G010300                  69.3    5e-10   
gb|AFW68896.1|  hypothetical protein ZEAMMB73_054159                  64.7    2e-08   
gb|EHB10201.1|  Nidogen-2                                             63.2    1e-07   
ref|XP_006632548.1|  PREDICTED: nidogen-2-like                        62.4    2e-07   
ref|XP_004835594.1|  PREDICTED: nidogen-2 isoform X2                  62.0    2e-07   
ref|XP_004896014.1|  PREDICTED: nidogen-2 isoform X2                  62.0    2e-07   
ref|XP_004896013.1|  PREDICTED: nidogen-2 isoform X1                  62.0    2e-07   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100           61.6    3e-07   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335            61.6    3e-07   
ref|XP_005367660.1|  PREDICTED: nidogen-2                             61.6    3e-07   
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                61.2    3e-07   
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3              60.1    7e-07   
ref|XP_001750392.1|  hypothetical protein                             60.5    7e-07   
ref|XP_003227637.2|  PREDICTED: nidogen-2                             60.1    1e-06   
ref|XP_008300391.1|  PREDICTED: nidogen-1-like                        59.7    1e-06   
ref|XP_007885762.1|  PREDICTED: signal peptide, CUB and EGF-like ...  58.9    3e-06   
ref|XP_007885758.1|  PREDICTED: signal peptide, CUB and EGF-like ...  58.5    3e-06   
ref|XP_007885760.1|  PREDICTED: signal peptide, CUB and EGF-like ...  58.5    3e-06   
ref|XP_007885759.1|  PREDICTED: signal peptide, CUB and EGF-like ...  58.5    3e-06   
ref|XP_007885761.1|  PREDICTED: signal peptide, CUB and EGF-like ...  58.5    3e-06   
ref|XP_007885765.1|  PREDICTED: signal peptide, CUB and EGF-like ...  58.5    3e-06   
ref|XP_007885763.1|  PREDICTED: signal peptide, CUB and EGF-like ...  58.2    3e-06   
ref|XP_003282370.2|  PREDICTED: uncharacterized protein LOC100592646  58.5    4e-06   
ref|XP_006872431.1|  PREDICTED: nidogen-2                             57.8    6e-06   
ref|XP_004896015.1|  PREDICTED: nidogen-2 isoform X3                  57.4    7e-06   
ref|XP_004896016.1|  PREDICTED: nidogen-2 isoform X4                  57.4    7e-06   
ref|XP_005461388.1|  PREDICTED: nidogen-1-like isoform X1             57.0    9e-06   
ref|XP_005753342.1|  PREDICTED: nidogen-1-like                        57.0    1e-05   
gb|EKC20122.1|  Fibrillin-3                                           57.0    1e-05   
ref|XP_004572433.1|  PREDICTED: nidogen-1-like                        57.0    1e-05   
ref|XP_005950478.1|  PREDICTED: nidogen-1-like                        57.0    1e-05   
ref|XP_007502851.1|  PREDICTED: signal peptide, CUB domain, EGF-l...  56.6    1e-05   
ref|XP_005808219.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    1e-05   
gb|KFW70704.1|  Nidogen-1                                             56.6    1e-05   
ref|XP_011417761.1|  PREDICTED: fibrillin-1-like                      56.6    1e-05   
ref|XP_007083259.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    1e-05   
ref|XP_006937146.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    1e-05   
ref|XP_005958543.1|  PREDICTED: signal peptide, CUB and EGF-like ...  53.9    1e-05   
ref|XP_008052766.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.6    1e-05   
gb|EYF00643.1|  Fibrillin-1 precursor protein                         56.2    1e-05   
ref|XP_009995902.1|  PREDICTED: nidogen-1                             56.6    1e-05   
gb|KFU89549.1|  Nidogen-1                                             56.6    2e-05   
ref|XP_003781560.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    2e-05   
ref|XP_005326918.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    2e-05   
ref|XP_009327495.1|  PREDICTED: nidogen-1                             56.2    2e-05   
ref|XP_004470346.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    2e-05   
ref|XP_006937147.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    2e-05   
ref|XP_007444806.1|  PREDICTED: uncharacterized protein LOC103052886  55.8    2e-05   
ref|XP_006633159.1|  PREDICTED: signal peptide, CUB and EGF-like ...  56.2    2e-05   
ref|XP_007233666.1|  PREDICTED: signal peptide, CUB and EGF-like ...  53.1    2e-05   
ref|XP_008955770.1|  PREDICTED: growth arrest-specific protein 6 ...  55.8    2e-05   
ref|XP_005936562.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    2e-05   
dbj|BAG64249.1|  unnamed protein product                              55.5    2e-05   
ref|XP_966993.2|  PREDICTED: fibulin-2-like                           55.8    2e-05   
ref|XP_006780244.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    2e-05   
ref|XP_006998028.1|  PREDICTED: nidogen-2                             55.8    2e-05   
gb|EFA11450.1|  hypothetical protein TcasGA2_TC013635                 55.8    2e-05   
ref|XP_005467054.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    2e-05   
ref|NP_000811.1|  growth arrest-specific protein 6 precursor          55.8    2e-05   
ref|XP_005083640.1|  PREDICTED: nidogen-2                             55.8    2e-05   
ref|XP_005936559.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_006780242.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
dbj|BAC86580.1|  unnamed protein product                              55.5    3e-05   
ref|XP_005936560.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_005724384.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_006780243.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_005936561.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_004543223.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_004543222.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_005936563.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.8    3e-05   
ref|XP_011834809.1|  PREDICTED: growth arrest-specific protein 6      55.5    3e-05   
ref|XP_005586382.1|  PREDICTED: growth arrest-specific protein 6 ...  55.5    3e-05   
ref|XP_005936564.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.5    3e-05   
ref|XP_005936565.1|  PREDICTED: signal peptide, CUB and EGF-like ...  55.5    3e-05   



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +LNNGGCWH+TR+GHTYSACV +EEGKC+CPPGFKGDG KSCED+DECKDK ACQCPECS
Sbjct  477  KLNNGGCWHDTRDGHTYSACVDNEEGKCSCPPGFKGDGFKSCEDVDECKDKKACQCPECS  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKY
Sbjct  537  CKNTWGSYECSCSGDLLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHVSD RA
Sbjct  597  RLRSYMDSEIRAIMAQYMPLDSQNEVPNHVSDERA  631



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +LNNGGCWH+TR+GHTYSACV +EEGKC+CPPGFKGDG KSC+DIDECK+K ACQCPECS
Sbjct  477  KLNNGGCWHDTRDGHTYSACVDNEEGKCSCPPGFKGDGVKSCDDIDECKEKKACQCPECS  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKY
Sbjct  537  CKNTWGSYECSCSGDLLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHVSD RA
Sbjct  597  RLRSYMDSEIRAIMAQYMPLDSQNEVPNHVSDERA  631



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +LNNGGCWH+TR+GHT+SACV +EEGKC+CPPGFKGDG KSCEDIDEC++K ACQCPECS
Sbjct  476  KLNNGGCWHDTRDGHTFSACVDNEEGKCSCPPGFKGDGVKSCEDIDECREKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKY
Sbjct  536  CKNTWGSYECSCSGELLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+QSE+ NHV++  A
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQSEVQNHVNEDHA  630



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH++RNGHT+SAC  +  GKC CPPGFKGDG KSCEDIDECK+K ACQCP+CS
Sbjct  479  KINNGGCWHDSRNGHTFSACSDANGGKCECPPGFKGDGVKSCEDIDECKEKKACQCPDCS  538

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDCTCS  LLYIRDHDTCISKR T+V+SAWAA WVILIGL + AGGAYLVYKY
Sbjct  539  CKNTWGSYDCTCSGDLLYIRDHDTCISKRGTEVRSAWAAFWVILIGLAMAAGGAYLVYKY  598

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  599  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA  633



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +LNNGGCWH+TR+GHT+SACV +EEGKCTCPPGFKGDG KSCEDIDEC++K ACQCPECS
Sbjct  476  KLNNGGCWHDTRDGHTFSACVDNEEGKCTCPPGFKGDGVKSCEDIDECREKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHDTCISKRA +VKSAWAAVW ILIGL +  GGAYLVYKY
Sbjct  536  CKNTWGSYECSCSGELLYIRDHDTCISKRAREVKSAWAAVWAILIGLAMAGGGAYLVYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+ +HV++  A
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQNEVQSHVNEGHA  630



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECS
Sbjct  477  KINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECS  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKY
Sbjct  537  CKNTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  597  RLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA  631



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECS
Sbjct  477  KINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECS  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+CTCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKY
Sbjct  537  CKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  597  RLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA  631



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECS
Sbjct  477  KINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECS  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+CTCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKY
Sbjct  537  CKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  597  RLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA  631



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+++GHTYSAC+ SE GKC CPPGFKGDG KSC DIDECK++ ACQC ECS
Sbjct  475  KINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECS  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+CTCS  LLYIRDHDTCISK AT+V+SAWAAVWVILIGL +  GGAYLVYKY
Sbjct  535  CKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKY  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+QSE+PNHV+D RA
Sbjct  595  RLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA  629



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ R+GH YSAC+    GKC CPPGFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  476  KINNGGCWHDARDGHAYSACLDDGNGKCQCPPGFKGDGVKNCEDIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIRDHDTCISK  T+V+S+WAAVWVILIGL + +GGAYL+YKY
Sbjct  536  CKNTWGSYECTCSGDLLYIRDHDTCISKSGTEVRSSWAAVWVILIGLAMASGGAYLIYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHVSDSRA
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVSDSRA  630



>ref|XP_012093114.1| PREDICTED: vacuolar-sorting receptor 3 [Jatropha curcas]
 gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECS  673
            +LNNGGCWHE+RNGHT+SAC   E  KC CP GFKGDG + CEDIDECKD+TACQCPEC+
Sbjct  476  KLNNGGCWHESRNGHTFSACSDVEGTKCQCPTGFKGDGTTKCEDIDECKDRTACQCPECN  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDCTCS  LLYIRDHDTCISKR T+V+SAWAA WVILIGLG+ AGG YL+YKY
Sbjct  536  CKNTWGSYDCTCSGDLLYIRDHDTCISKRGTEVRSAWAAFWVILIGLGMAAGGGYLIYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA  630



>gb|AAF22842.1|AF209910_1 vacuolar sorting receptor protein [Prunus dulcis]
Length=159

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ R+GH +SAC  + E +C CP GFKGDG KSCED+DECK+K ACQCPEC+
Sbjct  5    KVNNGGCWHDARDGHAFSACTDNGEVQCQCPHGFKGDGVKSCEDVDECKEKKACQCPECT  64

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKY
Sbjct  65   CKNTWGSYDCSCSGNLLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKY  124

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  125  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA  159



>gb|KHG15071.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=418

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+RNG  YSAC+ + + KC CPPGFKGDG KSCEDIDECK+K ACQCPECS
Sbjct  264  KINNGGCWHESRNGRAYSACLDNGDVKCQCPPGFKGDGVKSCEDIDECKEKRACQCPECS  323

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTC+  LLYIRDHDTCISK  T+V+SAWAA+WVILIGL +  GGAYLVYKY
Sbjct  324  CKNTWGSYECTCNGDLLYIRDHDTCISKSGTEVRSAWAAMWVILIGLAMAGGGAYLVYKY  383

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNHVS+ RA
Sbjct  384  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHVSNDRA  418



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHETR+G T+SACV  E  KC CPPGF+GDG KSCEDIDECK+K  CQCPECS
Sbjct  481  KVNNGGCWHETRDGKTFSACVDVEGSKCKCPPGFRGDGVKSCEDIDECKEKKRCQCPECS  540

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDCTCS  LLYIRDHDTCISKRA +VK+AWAAVWVILIGL + AGGAYLVYKY
Sbjct  541  CKNTWGSYDCTCSGELLYIRDHDTCISKRAGEVKTAWAAVWVILIGLAIAAGGAYLVYKY  600

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV   R
Sbjct  601  RLRSYMDSEIRAIMAQYMPLDSQTEVPNHVGHDR  634



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   233 bits (595),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +TR+G ++SAC+  E GKC CPPGFKGDG KSCED+DECK+K ACQC ECS
Sbjct  476  KINNGGCWQDTRDGRSFSACMDHEGGKCACPPGFKGDGVKSCEDVDECKEKKACQCAECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYIRDHDTCISKRAT+VKS WAAVWVILIGLG+  GGAYLVYKY
Sbjct  536  CKNTWGSYDCSCSGDLLYIRDHDTCISKRATEVKSGWAAVWVILIGLGMAGGGAYLVYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R RSYMD+EIRAIMAQYMPLD+Q+E+PNHVSD RA
Sbjct  596  RWRSYMDSEIRAIMAQYMPLDSQNEVPNHVSDDRA  630



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWH++++GHTYSACV + + KC CPPGF+GDG  SC+DIDECK+K ACQCPECSC
Sbjct  475  INNGGCWHKSQDGHTYSACVDTGDVKCQCPPGFRGDGINSCDDIDECKEKKACQCPECSC  534

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWGSY+CTCS  LLYIRDHDTCISK  T+VKSAWAAVWVILIGL + +GGAYLVYKYR
Sbjct  535  KDTWGSYECTCSGDLLYIRDHDTCISKSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYR  594

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LRSYMD+EIRAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  595  LRSYMDSEIRAIMAQYMPLDSQSEVPNHVSEDRA  628



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  545  INNGGCWHEERDGHAFSACVDKDIVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSC  604

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS GLLYIRDHDTCISK   QVKSAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  605  KNTWGSYECSCSGGLLYIRDHDTCISKTGAQVKSAWAAVWLIMLSLGLAAGGAYLVYKYR  664

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q EIPNHV+D RA
Sbjct  665  LRQYMDSEIRAIMAQYMPLDSQPEIPNHVNDERA  698



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH++++G ++SAC+  + GKC CPPGFKGDG KSC+D+DECK+K ACQCPECS
Sbjct  477  KINNGGCWHDSQDGQSFSACLDIDGGKCECPPGFKGDGVKSCKDVDECKEKKACQCPECS  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIRDHDTCISKRAT+VKSAWAAVWVILIGL +   GAYLVYKY
Sbjct  537  CKNTWGSYECTCSGDLLYIRDHDTCISKRATEVKSAWAAVWVILIGLAMAGTGAYLVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+RSYMD+EIRAIMAQYMPLD+Q+E+PNHVS+  A
Sbjct  597  RIRSYMDSEIRAIMAQYMPLDSQTEVPNHVSEDHA  631



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH++++G ++SAC+  + GKC CPPGFKGDG KSC+D+DECK+K ACQCPECS
Sbjct  482  KINNGGCWHDSQDGQSFSACLDIDGGKCECPPGFKGDGVKSCKDVDECKEKKACQCPECS  541

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIRDHDTCISKRAT+VKSAWAAVWVILIGL +   GAYLVYKY
Sbjct  542  CKNTWGSYECTCSGDLLYIRDHDTCISKRATEVKSAWAAVWVILIGLAMAGTGAYLVYKY  601

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+RSYMD+EIRAIMAQYMPLD+Q+E+PNHVS+  A
Sbjct  602  RIRSYMDSEIRAIMAQYMPLDSQTEVPNHVSEDHA  636



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWH++++GHTYSACV + + KC CPPGF+GDG  +CEDIDECK+K ACQCPECSC
Sbjct  475  INNGGCWHKSQDGHTYSACVDTGDVKCQCPPGFRGDGINNCEDIDECKEKKACQCPECSC  534

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWGSY+CTCS  LLYIRDHDTCISK  T+VKSAWAAVWVILIGL + +GGAYLVYKYR
Sbjct  535  KDTWGSYECTCSGDLLYIRDHDTCISKSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYR  594

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LRSYMD+EIRAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  595  LRSYMDSEIRAIMAQYMPLDSQSEVPNHVSEDRA  628



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH +R+GH YSAC+   + KC CPPGFKGDG KSCED+DEC +K ACQCPECS
Sbjct  472  KINNGGCWHGSRDGHAYSACLGIGDSKCQCPPGFKGDGVKSCEDVDECNEKKACQCPECS  531

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIRDHDTCISK  T+V+SAWAAVWVI+IGL + AGGAYLVYKY
Sbjct  532  CKNTWGSYECTCSGDLLYIRDHDTCISKSGTEVRSAWAAVWVIVIGLAMAAGGAYLVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHVS+ RA
Sbjct  592  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVSEDRA  626



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 142/156 (91%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGD--GKSCEDIDECKDKTACQCPEC  676
            +++NGGCWHET++G T+SACV +EEGKC CPPGFKGD   KSCEDIDECK+K ACQCP+C
Sbjct  476  KISNGGCWHETKDGITFSACVDNEEGKCQCPPGFKGDDGAKSCEDIDECKEKKACQCPDC  535

Query  675  SCKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            SCKNTWGSY+CTC   LLYIRDHDTCISKRA++VKSAW AVW+IL+GLG+ AGGAYLVYK
Sbjct  536  SCKNTWGSYECTCGGDLLYIRDHDTCISKRASEVKSAWTAVWIILLGLGMAAGGAYLVYK  595

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            +RLRSYMD+EIRAIMAQYMPLD+Q+E+ NHV+D RA
Sbjct  596  HRLRSYMDSEIRAIMAQYMPLDSQNEVQNHVNDERA  631



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  475  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGTKKCEDINECKEKKACQCPECSC  534

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYR
Sbjct  535  KNTWGSYECSCSGDLLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYR  594

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q EIPNHV+D RA
Sbjct  595  LRQYMDSEIRAIMAQYMPLDSQPEIPNHVNDERA  628



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++++GGCWHE RNG T+SACV +EEGKCTCPPGF+GDG KSC DIDECK+K ACQCPECS
Sbjct  476  KISHGGCWHENRNGITFSACVDNEEGKCTCPPGFRGDGVKSCVDIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS  LLYIR+HDTCISK   +VKSAW AVW+ILIGL + AGGAYLVYKY
Sbjct  536  CKNTWGSYECACSGDLLYIREHDTCISKTTAEVKSAWTAVWIILIGLAMAAGGAYLVYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV + RA
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQNEVPNHVHEDRA  630



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  471  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGFKKCEDINECKEKKACQCPECSC  530

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSYDC+CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  531  KNTWGSYDCSCSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D RA
Sbjct  591  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDERA  624



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHETR+G T+SACV  E  KC CPPGF GDG KSCEDIDECK+K ACQCPECS
Sbjct  480  KINNGGCWHETRDGKTFSACVDVENSKCQCPPGFIGDGVKSCEDIDECKEKKACQCPECS  539

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            C N WGSY+CTCS  LLYIRDHDTCISKRA++ K+AW AVWVI IGL + AGGAYLVYKY
Sbjct  540  CNNIWGSYECTCSGELLYIRDHDTCISKRASETKTAWTAVWVIFIGLAMAAGGAYLVYKY  599

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+++PNH S+ RA
Sbjct  600  RLRSYMDSEIRAIMAQYMPLDSQTDVPNHASEDRA  634



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  474  INNGGCWHEERDGHAFSACVDKDSVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  534  KNTWGSYECSCSGDLLYIRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  593

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D RA
Sbjct  594  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDERA  627



>emb|CDX93144.1| BnaA03g38660D [Brassica napus]
Length=610

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  457  INNGGCWHEERDGHVFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  516

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+R
Sbjct  517  KNTWGSYECSCSGDLLYIRDHDTCISKIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHR  576

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLDNQ E+PNHV+D RA
Sbjct  577  LRQYMDSEIRAIMAQYMPLDNQPEVPNHVNDERA  610



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGF+GDG K CEDI+ECK+K ACQCPECSC
Sbjct  473  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFRGDGIKKCEDINECKEKKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  533  KNTWGSYECSCSGDLLYIRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q EIPNHV+D RA
Sbjct  593  LRRYMDSEIRAIMAQYMPLDSQPEIPNHVNDERA  626



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  478  INNGGCWHEERDGHVFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  537

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+R
Sbjct  538  KNTWGSYECSCSGDLLYIRDHDTCISKIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHR  597

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLDNQ E+PNHV+D RA
Sbjct  598  LRQYMDSEIRAIMAQYMPLDNQPEVPNHVNDERA  631



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  478  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  537

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK  +QVKSAW AVW+I++ LG+ AGGAYLVYK+R
Sbjct  538  KNTWGSYECSCSGDLLYIRDHDTCISKTGSQVKSAWTAVWLIVLSLGLAAGGAYLVYKHR  597

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLDNQ E+PNHV+D RA
Sbjct  598  LRQYMDSEIRAIMAQYMPLDNQPEVPNHVNDERA  631



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  474  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGIKKCEDINECKEKKACQCPECSC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK   QV+SAWAA+W+I++ LG+ AGGAYLVYKYR
Sbjct  534  KNTWGSYECSCSGDLLYIRDHDTCISKTGAQVRSAWAAIWLIMLSLGLAAGGAYLVYKYR  593

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D RA
Sbjct  594  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDERA  627



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  471  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGFKKCEDINECKEKKACQCPECSC  530

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  531  KNTWGSYECSCSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D RA
Sbjct  591  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDERA  624



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+R+GH +SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQCP CS
Sbjct  476  KINNGGCWHESRDGHAFSACLDVDGGKCQCPPGFKGDGVKSCVDVDECKERKACQCPACS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHDTCISK  T+V+SAWAAVWVIL+GL +  GG YL+YKY
Sbjct  536  CKNTWGSYECSCSGDLLYIRDHDTCISKSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV D R
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVHDER  629



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ ++GH +SAC  + E +C CPPGFKGDG KSCED+DECK+K ACQCPECS
Sbjct  475  KVNNGGCWHKAQDGHAFSACTDTGEVQCQCPPGFKGDGVKSCEDVDECKEKKACQCPECS  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKY
Sbjct  535  CKNTWGSYDCSCSGNLLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKY  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  595  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA  629



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   228 bits (581),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 136/155 (88%), Gaps = 2/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+RNG  +SACV +EEGKCTCPPGFKGDG  SCEDIDECK K ACQCPECS
Sbjct  476  RINNGGCWHESRNGVAFSACVDNEEGKCTCPPGFKGDGVNSCEDIDECKQKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTC   LLYIRDHDTCISK  T+VKSAW AVW+ILI L + AGGAY+VYK 
Sbjct  536  CKNTWGSYECTCGGDLLYIRDHDTCISK-TTEVKSAWTAVWIILIALALAAGGAYVVYKR  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV + RA
Sbjct  595  RLRSYMDSEIRAIMAQYMPLDSQNEVPNHVDEDRA  629



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   228 bits (581),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  475  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  534

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK  +QVKSAWAAVW+I++ LG+ A GAYLVYKYR
Sbjct  535  KNTWGSYECSCSGDLLYMRDHDTCISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYR  594

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNH +D RA
Sbjct  595  LRQYMDSEIRAIMAQYMPLDSQPEVPNHTNDERA  628



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHETRNGHT+SAC      KC+CPPGFKGDG KSCEDIDEC++K ACQCPECS
Sbjct  478  KINNGGCWHETRNGHTFSACTDDGNVKCSCPPGFKGDGVKSCEDIDECQEKKACQCPECS  537

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKY
Sbjct  538  CKNTWGSYDCSCSGDLLYIRDHDTCISK-ASSGRSAWTAVWVILIGLTMAAGGAYLVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PN+V+++RA
Sbjct  597  RLRSYMDSEIRAIMAQYMPLDSQAEVPNYVNENRA  631



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE ++GH +SACV  +  KC CPPGFKGDG K CEDIDECK+K ACQCPECSC
Sbjct  476  INNGGCWHEEKDGHAFSACVDKDSVKCECPPGFKGDGTKKCEDIDECKEKKACQCPECSC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYR
Sbjct  536  KNTWGSYECSCSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYR  595

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D  A
Sbjct  596  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDEHA  629



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHETRNGHT+SAC      KC+CPPGFKGDG KSCEDIDEC++K ACQCPECS
Sbjct  477  KINNGGCWHETRNGHTFSACTDDGNVKCSCPPGFKGDGVKSCEDIDECQEKKACQCPECS  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYIRDHDTCISK A+  +SAW AVWVILIGL + AGGAYLVYKY
Sbjct  537  CKNTWGSYDCSCSGDLLYIRDHDTCISK-ASSGRSAWTAVWVILIGLVMAAGGAYLVYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PN+V+++RA
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQAEVPNYVNENRA  630



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  477  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  536

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK  +QVKSAWA VW+I++ LG+ A GAYLVYKYR
Sbjct  537  KNTWGSYECSCSGDLLYMRDHDTCISKTGSQVKSAWAGVWLIMLSLGLAAAGAYLVYKYR  596

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNH +D RA
Sbjct  597  LRQYMDSEIRAIMAQYMPLDSQPEVPNHTNDERA  630



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  473  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYR
Sbjct  533  KNTWGSYECSCSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D  A
Sbjct  593  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDEHA  626



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  473  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYR
Sbjct  533  KNTWGSYECSCSGDLLYMRDHDTCISKTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D  A
Sbjct  593  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDEHA  626



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  473  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ A GAYLVYKYR
Sbjct  533  KNTWGSYECSCSGDLLYMRDHDTCISKTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D  A
Sbjct  593  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDEHA  626



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE++NG  YSAC+ + + KC CPPGFKGDG KSCEDIDECK+K ACQCPECS
Sbjct  470  KINNGGCWHESQNGSAYSACLDNGDVKCQCPPGFKGDGVKSCEDIDECKEKRACQCPECS  529

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTC+  LLYIRDHDTCISK  T+V+SAWAA+ VILIGL +  GGAYLVYKY
Sbjct  530  CKNTWGSYECTCNGDLLYIRDHDTCISKSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNHVS+ RA
Sbjct  590  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHVSNDRA  624



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE++NG  YSAC+ + + KC CPPGFKGDG KSCEDIDECK+K ACQCPECS
Sbjct  475  KINNGGCWHESQNGSAYSACLDNGDVKCQCPPGFKGDGVKSCEDIDECKEKRACQCPECS  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTC+  LLYIRDHDTCISK  T+V+SAWAA+ VILIGL +  GGAYLVYKY
Sbjct  535  CKNTWGSYECTCNGDLLYIRDHDTCISKSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKY  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNHVS+ RA
Sbjct  595  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHVSNDRA  629



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   225 bits (574),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE RNGH +SACV  +  KC CPPGFKGDG   CEDIDECK+K ACQCPECSC
Sbjct  482  INNGGCWHEERNGHAFSACVGKDSAKCQCPPGFKGDGVNKCEDIDECKEKKACQCPECSC  541

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK  +QV+SAWAAVW+IL+ L + A GAYLVYKYR
Sbjct  542  KNTWGSYECSCSGDLLYIRDHDTCISKTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYR  601

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+ NH+ D RA
Sbjct  602  LRQYMDSEIRAIMAQYMPLDSQPEVHNHLDDDRA  635



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   225 bits (574),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE RNGH +SACV  +  KC CPPGFKGDG   CEDIDECK+K ACQCPECSC
Sbjct  482  INNGGCWHEERNGHAFSACVGKDSAKCQCPPGFKGDGVNKCEDIDECKEKKACQCPECSC  541

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIRDHDTCISK  +QV+SAWAAVW+IL+ L + A GAYLVYKYR
Sbjct  542  KNTWGSYECSCSGDLLYIRDHDTCISKTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYR  601

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+ NH+ D RA
Sbjct  602  LRQYMDSEIRAIMAQYMPLDSQPEVHNHLDDERA  635



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+ H +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  471  INNGGCWHEERDRHAFSACVDKDSVKCECPPGFKGDGFKKCEDINECKEKKACQCPECSC  530

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  531  KNTWGSYECSCSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+PNHV+D RA
Sbjct  591  LRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDERA  624



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH++R+GHT+SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQC  CS
Sbjct  476  KINNGGCWHKSRDGHTFSACLDVDGGKCQCPPGFKGDGVKSCVDVDECKERKACQCSACS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHDTCISK  T+V+SAWAAVWVIL+GL +  GG YL+YKY
Sbjct  536  CKNTWGSYECSCSGDLLYIRDHDTCISKSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV D R
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVHDER  629



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  478  INNGGCWHEERDGHAFSACVDKDSVKCQCPPGFKGDGVKKCEDINECKEKKACQCPECSC  537

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK  +QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  538  KNTWGSYECSCSGDLLYMRDHDTCISKTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  597

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+ NHV+D RA
Sbjct  598  LRQYMDSEIRAIMAQYMPLDSQPEVANHVNDERA  631



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  473  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGIKKCEDINECKEKKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  533  KNTWGSYECSCSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+ NHV+D RA
Sbjct  593  LRQYMDSEIRAIMAQYMPLDSQPEVQNHVNDERA  626



>ref|XP_002489188.1| hypothetical protein SORBIDRAFT_0013s004010 [Sorghum bicolor]
 gb|EES20283.1| hypothetical protein SORBIDRAFT_0013s004010, partial [Sorghum 
bicolor]
Length=165

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S +GKC CP GF+GDG K CEDIDECK++ ACQC EC+C
Sbjct  11   INHGGCWHETRNGKTFSACQESGDGKCRCPAGFRGDGVKQCEDIDECKERKACQCSECNC  70

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            ++TWG YDCTCS  LLYIR+HDTCISK   Q K+AWAAVW ILI + VVA G+Y+VYKYR
Sbjct  71   RDTWGGYDCTCSGDLLYIREHDTCISKTTVQAKAAWAAVWGILIVVAVVAVGSYVVYKYR  130

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            LRSYMD+EIRAIMAQYMPLDNQ ++PNH  D
Sbjct  131  LRSYMDSEIRAIMAQYMPLDNQGDVPNHTHD  161



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+R+GHT SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQCP CS
Sbjct  476  KINNGGCWHESRDGHTLSACLDVDGGKCHCPPGFKGDGVKSCVDVDECKERKACQCPACS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHDTCISK  T+VKSAW  VWVI IGL + AGG YLVYK+
Sbjct  536  CKNTWGSYECSCSGDLLYIRDHDTCISKSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKH  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            +LRSYMD+EIRAIMAQYMPLD+Q+E+PNHV + RA
Sbjct  596  KLRSYMDSEIRAIMAQYMPLDSQAEVPNHVHEERA  630



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K C+DI+ECK+K ACQCPECSC
Sbjct  476  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGIKKCDDINECKEKKACQCPECSC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  536  KNTWGSYECSCSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  595

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+ NHV+D RA
Sbjct  596  LRQYMDSEIRAIMAQYMPLDSQPEVQNHVNDERA  629



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ ++GH +SAC  + E +C CP GFKGDG KSCED+DECK+K ACQCPEC+
Sbjct  475  KVNNGGCWHDAQDGHAFSACTDNGEVQCQCPHGFKGDGVKSCEDVDECKEKKACQCPECT  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYI+DHDTCISK A+  KSAWAAVWVILIGL +  GGAYLVYKY
Sbjct  535  CKNTWGSYDCSCSGNLLYIKDHDTCISKAASGGKSAWAAVWVILIGLAMAGGGAYLVYKY  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  595  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA  629



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE R+GH ++AC  + E +C CPPGFKGDG KSCEDIDECK++ ACQCPECS
Sbjct  474  KVNNGGCWHEARDGHAFTACTDNGEVQCQCPPGFKGDGVKSCEDIDECKERKACQCPECS  533

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+C   LLYIRDHDTCISK +   KSAW AVWVIL+GL + AGGAYLVYKY
Sbjct  534  CKNTWGSYDCSCGGNLLYIRDHDTCISKASGGGKSAWVAVWVILLGLAMAAGGAYLVYKY  593

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV++ R
Sbjct  594  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNEER  627



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE R+GH ++AC  + E +C CPPGFKGDG KSCEDIDECK++ ACQCPECS
Sbjct  474  KVNNGGCWHEARDGHAFTACTENGEVQCQCPPGFKGDGVKSCEDIDECKERKACQCPECS  533

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+C+CS  LLYIRDHDTCISK +   KSAW AVW+IL+GL + AGGAYLVYKY
Sbjct  534  CKDTWGSYECSCSGNLLYIRDHDTCISKASGGGKSAWVAVWIILLGLAMAAGGAYLVYKY  593

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV++ RA
Sbjct  594  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNEERA  628



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K  CQCPECSC
Sbjct  474  INNGGCWHEERDGHAFSACVDKDSVKCECPPGFKGDGVKKCEDINECKEKKTCQCPECSC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHD CISK  +QVKSAWAAVW+I++ LG+ A GAYLVYKYR
Sbjct  534  KNTWGSYECSCSGDLLYMRDHDACISKTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYR  593

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q EIPNH +D  A
Sbjct  594  LRQYMDSEIRAIMAQYMPLDSQPEIPNHANDEHA  627



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  473  INNGGCWHEERDGHAFSACVDKDIVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGS++C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  533  KNTWGSFECSCSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+ NHV+D RA
Sbjct  593  LRQYMDSEIRAIMAQYMPLDSQPEVQNHVNDERA  626



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDI+ECK+K ACQCPECSC
Sbjct  473  INNGGCWHEERDGHAFSACVDKDIVKCQCPPGFKGDGIKKCEDINECKEKKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGS++C+CS  LLY+RDHDTCISK   QV+SAWAAVW+I++ LG+ AGGAYLVYKYR
Sbjct  533  KNTWGSFECSCSGDLLYMRDHDTCISKTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q E+ NHV+D RA
Sbjct  593  LRQYMDSEIRAIMAQYMPLDSQPEVQNHVNDERA  626



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE R+GH ++AC  + E +C CPPGFKGDG KSCEDIDECK++ ACQCPECS
Sbjct  474  KVNNGGCWHEARDGHAFTACTDNGEVQCQCPPGFKGDGVKSCEDIDECKERKACQCPECS  533

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+C+CS  LLYIRDHDTCISK +   KSAW AVW+IL+GL + AGGAYLVYKY
Sbjct  534  CKDTWGSYECSCSGNLLYIRDHDTCISKASGGGKSAWVAVWIILLGLAMAAGGAYLVYKY  593

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV++ RA
Sbjct  594  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNEERA  628



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+TRNGH +SAC+ +   KC CP GF+GDG K+CEDIDECK+K ACQCPECS
Sbjct  474  KINNGGCWHDTRNGHAFSACLDNGGVKCQCPTGFRGDGVKNCEDIDECKEKKACQCPECS  533

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKY
Sbjct  534  CKNTWGSYDCSCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKY  593

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  594  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNDQRA  628



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+TRNGH +SAC+ +   KC CP GF+GDG K+CEDIDECK+K ACQCPECS
Sbjct  474  KINNGGCWHDTRNGHAFSACLDNGGVKCQCPTGFRGDGVKNCEDIDECKEKKACQCPECS  533

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKY
Sbjct  534  CKNTWGSYDCSCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKY  593

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  594  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNDQRA  628



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+RNGH +SAC+ +   KC CP GFKGDG K+CEDIDECK+K ACQCP+CS
Sbjct  471  KINNGGCWHESRNGHAFSACLDNGGVKCQCPTGFKGDGVKNCEDIDECKEKKACQCPDCS  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKY
Sbjct  531  CKNTWGSYDCSCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKY  590

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  591  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNDQRA  625



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+RNGH +SAC+ +   KC CP GFKGDG K+CEDIDECK+K ACQCP+CS
Sbjct  472  KINNGGCWHESRNGHAFSACLDNGGVKCQCPTGFKGDGVKNCEDIDECKEKKACQCPDCS  531

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKY
Sbjct  532  CKNTWGSYDCSCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  592  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNDQRA  626



>gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein, partial [Elaeis 
guineensis]
Length=243

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T NG T+SAC  + + KC CP GFKGDG K+C DIDECK+KTACQCPECS
Sbjct  88   RINNGGCWQDTHNGKTFSACQDTGDSKCKCPLGFKGDGIKTCADIDECKEKTACQCPECS  147

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS GLLY+R+HDTCISK A++ K+ W A+W+IL  L   A GA++VYKY
Sbjct  148  CKNTWGSYECTCSGGLLYMREHDTCISKTASEAKATWTALWLILGLLAFAAFGAFIVYKY  207

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNH ++
Sbjct  208  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHANE  239



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  476  KINNGGCWHEARNGHAYSACSDDGGVKCKCPAGFKGDGVKNCEDIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDCTCS  LLYIRDHDTCISK A+Q  +SAWAA WVILIGL V A GAYLVYK
Sbjct  536  CKNTWGSYDCTCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILIGLVVAAAGAYLVYK  595

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YR+RSYMD+EIRAIMAQYMPLD+Q EI NHVS+ RA
Sbjct  596  YRIRSYMDSEIRAIMAQYMPLDSQGEIVNHVSEERA  631



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  476  KINNGGCWHEARNGHAYSACSDDGGVKCKCPAGFKGDGVKNCEDIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDCTCS  LLYIRDHDTCISK A+Q  +SAWAA WVILIGL V A GAYLVYK
Sbjct  536  CKNTWGSYDCTCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILIGLVVAAAGAYLVYK  595

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YR+RSYMD+EIRAIMAQYMPLD+Q EI NHVS+ RA
Sbjct  596  YRIRSYMDSEIRAIMAQYMPLDSQGEIVNHVSEERA  631



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+++GHT+SAC+  + GKC CPPGFKGDG KSC D+DECK++ ACQCP CS
Sbjct  476  KINNGGCWHESQDGHTFSACLDVDGGKCQCPPGFKGDGVKSCLDVDECKERKACQCPACS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+C+CS  LLY+RDHDTCISK  T+VKSAW  VWVI IGL + AGG YLVYK+
Sbjct  536  CKDTWGSYECSCSGDLLYMRDHDTCISKSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKH  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            +LRSYMD+EIRAIMAQYMPLD+Q+E+PNHV + RA
Sbjct  596  KLRSYMDSEIRAIMAQYMPLDSQAEVPNHVHEERA  630



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ RNGH +SAC+     KC CP GFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  468  KINNGGCWHDARNGHAFSACLDDGGVKCQCPTGFKGDGVKNCEDIDECKEKKACQCPECS  527

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYI+DHDTCISK A+Q KS WAA WVILIGLG++AGG +LVYKY
Sbjct  528  CKNTWGSYDCSCSGDLLYIKDHDTCISKTASQAKSTWAAFWVILIGLGMIAGGGFLVYKY  587

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+  RA
Sbjct  588  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNHQRA  622



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH YSAC+     KC CP GFKGDG K+CEDIDEC++K ACQCPECS
Sbjct  475  KINNGGCWHEARNGHAYSACLDDGGVKCKCPAGFKGDGVKNCEDIDECREKKACQCPECS  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDCTCS  LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V AGGAYLVYK
Sbjct  535  CKNTWGSYDCTCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAGGAYLVYK  594

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YR+RSYMD+EIRAIMAQYMPLD+QSE+ NH +D RA
Sbjct  595  YRIRSYMDSEIRAIMAQYMPLDSQSEVVNHANDERA  630



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH +SAC+ +   KC CP GFKGDG K+CEDIDECKDK ACQCPECS
Sbjct  475  KINNGGCWHEARNGHAFSACLDNGGVKCVCPAGFKGDGVKNCEDIDECKDKKACQCPECS  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+CS  LLYIRDHD CISK A+Q  KSAWAA WVI+IGL + A GAYLVYK
Sbjct  535  CKNTWGSYNCSCSGDLLYIRDHDACISKTASQEGKSAWAAFWVIVIGLVLAASGAYLVYK  594

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YR+RSYMD+EIRAIMAQYMPLD+Q+E+ NHV+D RA
Sbjct  595  YRIRSYMDSEIRAIMAQYMPLDSQAEVVNHVNDERA  630



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW++++NG +YSAC+     KC CP GFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  490  KINNGGCWNDSQNGQSYSACLDFGNSKCQCPRGFKGDGVKTCEDIDECKEKKACQCPECS  549

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIRDHDTCISK +T+ KSAWAAVWVI+IGL +  GG YLVYKY
Sbjct  550  CKNTWGSYECTCSGDLLYIRDHDTCISKSSTETKSAWAAVWVIVIGLAMAGGGGYLVYKY  609

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV++  A
Sbjct  610  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNEVHA  644



>gb|EAY78120.1| hypothetical protein OsI_33166 [Oryza sativa Indica Group]
Length=215

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S  GKC CP GF+GDG K CEDI+ECK+K ACQC ECSC
Sbjct  61   INHGGCWHETRNGKTFSACQESGNGKCQCPAGFRGDGVKKCEDINECKEKKACQCRECSC  120

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            ++TWG Y+CTCS  LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYR
Sbjct  121  RDTWGDYECTCSGDLLYIKEHDTCISKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYR  180

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            LRSYMD+EIRAIMAQYMPLD+Q E+PNH +D
Sbjct  181  LRSYMDSEIRAIMAQYMPLDSQGEVPNHTND  211



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCWHE R+GH +SACV  +  KC CPPGFKGDG K CEDIDECK+K ACQCPECSC
Sbjct  474  INNGGCWHEERDGHAFSACVDKDSVKCQCPPGFKGDGVKKCEDIDECKEKKACQCPECSC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+RDHDTCISK   QVKSAWAAVW+I++ LG+ AGGAYL+YK+R
Sbjct  534  KNTWGSYECSCSGDLLYMRDHDTCISKTGAQVKSAWAAVWLIMLSLGLAAGGAYLLYKHR  593

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            LR YMD+EIRAIMAQYMPLD+Q+E+ NH +D RA
Sbjct  594  LRQYMDSEIRAIMAQYMPLDSQAEV-NHANDERA  626



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  476  KINNGGCWHEARNGHAYSACSDDGGVKCQCPAGFKGDGVKNCEDIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDCTCS  LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V A GAYLVYK
Sbjct  536  CKNTWGSYDCTCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAAGAYLVYK  595

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YR+RSYMD+EIRAIMAQYMPLD+Q E+ NHV + RA
Sbjct  596  YRIRSYMDSEIRAIMAQYMPLDSQGEVVNHVHEERA  631



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH YSAC      KC CP GFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  476  KINNGGCWHEARNGHAYSACSDDGGVKCQCPAGFKGDGVKNCEDIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV-KSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDCTCS  LLYIRDHDTCISK A+Q  +SAWAA WVIL+GL V A GAYLVYK
Sbjct  536  CKNTWGSYDCTCSGDLLYIRDHDTCISKTASQEGRSAWAAFWVILVGLVVAAAGAYLVYK  595

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YR+RSYMD+EIRAIMAQYMPLD+Q E+ NHV + RA
Sbjct  596  YRIRSYMDSEIRAIMAQYMPLDSQGEVVNHVHEERA  631



>gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNG CWHETR G  +SAC+ + +  C CP GF+GDG KSCEDIDECK+K ACQCPECSC
Sbjct  458  INNGDCWHETRKGKAFSACMETLDKGCQCPAGFRGDGIKSCEDIDECKEKRACQCPECSC  517

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWG Y+CTCS  LLYI DHDTCISK A QVK+AWAA+WVI IGL V A GAY+VYKYR
Sbjct  518  KDTWGGYECTCSGDLLYITDHDTCISKSAQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYR  577

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            L+SYMD+EIRAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  578  LKSYMDSEIRAIMAQYMPLDSQSEVPNHVSEERA  611



>ref|XP_006849341.2| PREDICTED: vacuolar-sorting receptor 3 isoform X1 [Amborella 
trichopoda]
Length=629

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNG CWHETR G  +SAC+ + +  C CP GF+GDG KSCEDIDECK+K ACQCPECSC
Sbjct  476  INNGDCWHETRKGKAFSACMETLDKGCQCPAGFRGDGIKSCEDIDECKEKRACQCPECSC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWG Y+CTCS  LLYI DHDTCISK A QVK+AWAA+WVI IGL V A GAY+VYKYR
Sbjct  536  KDTWGGYECTCSGDLLYITDHDTCISKSAQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYR  595

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            L+SYMD+EIRAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  596  LKSYMDSEIRAIMAQYMPLDSQSEVPNHVSEERA  629



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 132/157 (84%), Gaps = 3/157 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH +SAC  +   KC CP GFKGDG K+C DIDECK+K ACQCPECS
Sbjct  445  KINNGGCWHEARNGHAFSACSDNGAVKCECPAGFKGDGVKNCADIDECKEKKACQCPECS  504

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV--KSAWAAVWviliglgvvaggaylvY  499
            CKNTWGSY+C+CS  LLYIRDHD CISK A+Q   KSAWAA WVI++GL + A GAYLVY
Sbjct  505  CKNTWGSYNCSCSGDLLYIRDHDACISKTASQEGGKSAWAAFWVIVVGLVLAASGAYLVY  564

Query  498  KYRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            KYR+RSYMD+EIRAIMAQYMPLD+QSE+ NHV+D RA
Sbjct  565  KYRIRSYMDSEIRAIMAQYMPLDSQSEVVNHVNDERA  601



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 132/157 (84%), Gaps = 3/157 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH +SAC  +   KC CP GFKGDG K+C DIDECK+K ACQCPECS
Sbjct  476  KINNGGCWHEARNGHAFSACSDNGAVKCECPAGFKGDGVKNCADIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQV--KSAWAAVWviliglgvvaggaylvY  499
            CKNTWGSY+C+CS  LLYIRDHD CISK A+Q   KSAWAA WVI++GL + A GAYLVY
Sbjct  536  CKNTWGSYNCSCSGDLLYIRDHDACISKTASQEGGKSAWAAFWVIVVGLVLAASGAYLVY  595

Query  498  KYRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            KYR+RSYMD+EIRAIMAQYMPLD+QSE+ NHV+D RA
Sbjct  596  KYRIRSYMDSEIRAIMAQYMPLDSQSEVVNHVNDERA  632



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ RNGH YSAC+     KC CP GFKGDG K+CEDIDECKDK ACQCPECS
Sbjct  469  KINNGGCWHDARNGHAYSACLDDGGVKCQCPTGFKGDGVKNCEDIDECKDKKACQCPECS  528

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C   LLYI+D DTCISK A+Q +S WAA WVILIGL +++GGA+LVYKY
Sbjct  529  CKNTWGSYNCSCRGDLLYIKDQDTCISKTASQGRSTWAAFWVILIGLVMISGGAFLVYKY  588

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+  RA
Sbjct  589  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNHQRA  623



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ +NGH +SAC+ +   KC CP GF+GDG K+C+DIDECK+K ACQCP+CS
Sbjct  489  KINNGGCWHDAQNGHAFSACLDNGGVKCQCPTGFRGDGVKNCQDIDECKEKKACQCPDCS  548

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKY
Sbjct  549  CKNTWGSYDCSCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKY  608

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  609  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNDQRA  643



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ +NGH +SAC+ +   KC CP GF+GDG K+C+DIDECK+K ACQCP+CS
Sbjct  489  KINNGGCWHDAQNGHAFSACLDNGGVKCQCPTGFRGDGVKNCQDIDECKEKKACQCPDCS  548

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+RDHDTCISK  +Q +S WAA W+IL+G+ ++AGGA+LVYKY
Sbjct  549  CKNTWGSYDCSCSGDLLYMRDHDTCISKTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKY  608

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  609  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNDQRA  643



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ RNGH YSAC+     KC CP GFKGDG K+CEDIDECKDK ACQCPECS
Sbjct  500  KINNGGCWHDARNGHAYSACLDDGGVKCQCPTGFKGDGVKNCEDIDECKDKKACQCPECS  559

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C   LLYI+D DTCISK A+Q +S WAA WVILIGL +++GGA+LVYKY
Sbjct  560  CKNTWGSYNCSCRGDLLYIKDQDTCISKTASQGRSTWAAFWVILIGLVMISGGAFLVYKY  619

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+E+PNHV+  RA
Sbjct  620  RIRQYMDSEIRAIMAQYMPLDSQAEVPNHVNHQRA  654



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE RNGH +SAC    E KC CPPGFKGDG  SC DIDECK++ ACQC ECS
Sbjct  478  KINNGGCWHEARNGHAFSACTDDGEVKCKCPPGFKGDGVHSCTDIDECKERKACQCSECS  537

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C+  LLYIRDHDTCISK A++ +SAWA VW +++ +G+ AGGAY VYKY
Sbjct  538  CKNTWGSYECSCNGDLLYIRDHDTCISKTASETRSAWAIVW-VILIVGMAAGGAYRVYKY  596

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            RLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV++  A
Sbjct  597  RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNEEHA  631



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE R+GH ++AC  + + +C CPPGFKG+G KSCEDIDECKD+ ACQCPECS
Sbjct  474  KVNNGGCWHEARDGHVFTACTDNGKVQCQCPPGFKGBGVKSCEDIDECKDRKACQCPECS  533

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDC+CS  LLYIRDHDTCI         SAW AVWVILIGL + AGGAYLVYK
Sbjct  534  CKNTWGSYDCSCSGNLLYIRDHDTCISKSSGGGKSSAWVAVWVILIGLAMAAGGAYLVYK  593

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YRLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV++ RA
Sbjct  594  YRLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNEERA  629



>ref|NP_001064400.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa 
Japonica Group]
 gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group]
Length=631

 Score =   215 bits (547),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S  GKC CP GF+GDG K CEDI+ECK+K ACQCPECSC
Sbjct  477  INHGGCWHETRNGKTFSACQESGNGKCQCPAGFRGDGVKKCEDINECKEKKACQCPECSC  536

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            ++TWG Y+CTCS  LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYR
Sbjct  537  RDTWGDYECTCSGDLLYIKEHDTCISKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYR  596

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            LRSYMD+EIRAIMAQYMPLD+Q E+PNH +D
Sbjct  597  LRSYMDSEIRAIMAQYMPLDSQGEVPNHTND  627



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ RNGH +SAC+     KC CP GFKGDG K+CEDIDECKDK ACQCPECS
Sbjct  469  KINNGGCWHDARNGHAFSACLDDGGVKCQCPAGFKGDGVKNCEDIDECKDKKACQCPECS  528

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYI+D DTCISK A+Q KS WAA WV+LI L ++AGG +LVYKY
Sbjct  529  CKNTWGSYNCSCSGDLLYIKDQDTCISKTASQAKSTWAAFWVVLIALAMIAGGGFLVYKY  588

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q E PNHV+  R 
Sbjct  589  RIRQYMDSEIRAIMAQYMPLDSQEEGPNHVNHQRG  623



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW E+R+G TYSAC  S +GKC CP GF+GDG K+CEDI+ECK KTACQCP+CS
Sbjct  478  RINNGGCWQESRDGKTYSACQESGDGKCQCPAGFEGDGVKACEDINECKKKTACQCPDCS  537

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSYDCTCS  LLYI++HDTCISK+A++ K  WAAVWV+LI L V A GAY +YKY
Sbjct  538  CKDTWGSYDCTCSGDLLYIKEHDTCISKKASEAKVTWAAVWVLLIVLAVAAFGAYAIYKY  597

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNH
Sbjct  598  RLRSYMDSEIRAIMAQYMPLDSQGEVPNH  626



>ref|XP_008779827.1| PREDICTED: vacuolar-sorting receptor 4-like, partial [Phoenix 
dactylifera]
Length=162

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETR G T SAC  + + KC CP GFKG+G K+CEDIDECK+KTACQC ECS
Sbjct  7    RINNGGCWQETREGKTISACQDAGDSKCKCPTGFKGNGTKTCEDIDECKEKTACQCLECS  66

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS+GLLY+R+ D CIS  A+  K+ W A WVILI     A GAY+VYKY
Sbjct  67   CKNTWGSYECTCSDGLLYMREQDICISDSASMAKATWIAFWVILILSAFAALGAYIVYKY  126

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNH  +
Sbjct  127  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHTHE  158



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE ++GH ++AC      +C CPPGFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  475  KVNNGGCWHEAKDGHAFTACTDDGGLQCKCPPGFKGDGVKTCEDIDECKEKKACQCPECS  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDC+CS  LLYIRDHDTCI         SAWAAVWVILIGL + +GGAYLVYK
Sbjct  535  CKNTWGSYDCSCSANLLYIRDHDTCISKTSGGSKSSAWAAVWVILIGLAMASGGAYLVYK  594

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            YRLRSYMD+EIRAIMAQYMPLD+Q+E+PNHV+D RA
Sbjct  595  YRLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA  630



>ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=633

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCW  TR+G T+SAC  + + KCTCPPGFKGDG K+CEDIDECK+KTACQCPECS
Sbjct  478  KISNGGCWQVTRDGKTFSACQDTGDSKCTCPPGFKGDGIKTCEDIDECKEKTACQCPECS  537

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIR+HDTCISK A + K+  AAVWVIL  L   A GAY++YKY
Sbjct  538  CKNTWGSYECTCSGDLLYIREHDTCISKSAGEAKATQAAVWVILGVLAFAAFGAYILYKY  597

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNH  +
Sbjct  598  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHAHE  629



>ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=631

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T NG T+SAC  + + KC CP GFKGDG K+C DIDECK+KTACQCPECS
Sbjct  476  RINNGGCWQDTHNGKTFSACQDTGDSKCKCPLGFKGDGIKTCADIDECKEKTACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS GLLY+R+HDTCISK A++ K+ W A+W+IL  L   A GA++VYKY
Sbjct  536  CKNTWGSYECTCSGGLLYMREHDTCISKTASEAKATWTALWLILGLLAFAAFGAFIVYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNH ++
Sbjct  596  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHANE  627



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   210 bits (535),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH T++G  +SAC+ ++   C CPPGF+GDG   CEDI+ECK+K ACQC ECS
Sbjct  481  KINNGGCWHSTQDGQMFSACLDTQTTGCKCPPGFRGDGVDKCEDINECKEKVACQCSECS  540

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+C   LLY+RDHDTCISK+A Q K  WAAVWV+L+GL     GAY+VYKY
Sbjct  541  CKNTWGSYDCSCKGDLLYMRDHDTCISKKAEQGKVGWAAVWVVLLGLAAAGVGAYVVYKY  600

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            RLRSYMD+EIRAIMAQYMPLD+Q EIPNHV+
Sbjct  601  RLRSYMDSEIRAIMAQYMPLDSQGEIPNHVN  631



>ref|XP_011625221.1| PREDICTED: vacuolar-sorting receptor 3 isoform X2 [Amborella 
trichopoda]
Length=627

 Score =   210 bits (534),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 3/154 (2%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNG CWHETR G  +SAC+ + +  C CP GF+GDG KSCEDIDECK+K ACQCPECSC
Sbjct  476  INNGDCWHETRKGKAFSACMETLDKGCQCPAGFRGDGIKSCEDIDECKEKRACQCPECSC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWG Y+CTCS  LLYI DHDTC  K A QVK+AWAA+WVI IGL V A GAY+VYKYR
Sbjct  536  KDTWGGYECTCSGDLLYITDHDTC--KSAQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYR  593

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            L+SYMD+EIRAIMAQYMPLD+QSE+PNHVS+ RA
Sbjct  594  LKSYMDSEIRAIMAQYMPLDSQSEVPNHVSEERA  627



>ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis]
Length=633

 Score =   209 bits (532),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  TR G T+SAC  + + KC CP GFKGDG K+CEDIDECK+KTACQCPECS
Sbjct  478  RINNGGCWQVTRGGTTFSACQDTGDNKCVCPSGFKGDGIKTCEDIDECKEKTACQCPECS  537

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+CTCS  LLYIR+HD CISK A++ K+ W AVWVIL+ L   A GAY+VYKY
Sbjct  538  CKDTWGSYECTCSRDLLYIREHDICISKSASEAKATWTAVWVILVVLIFAAFGAYIVYKY  597

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+Q E+PNH  +
Sbjct  598  RLRSYMDSEIRAIMAQYMPLDSQGEVPNHAHE  629



>ref|XP_011652916.1| PREDICTED: vacuolar-sorting receptor 4 isoform X1 [Cucumis sativus]
Length=633

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+RNG + SACV + E KC CPPGFKGDG K+CEDI+ECK+K ACQC ECSC
Sbjct  477  VNNGGCWQESRNGLSMSACVDNGEVKCKCPPGFKGDGVKTCEDINECKEKKACQCSECSC  536

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
             NTWGSYDC+CS  LLY+RDHDTCISK A+  KS+W+  WVILIGL + AGGAY+VYKYR
Sbjct  537  TNTWGSYDCSCSGDLLYMRDHDTCISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYR  596

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            LR+YMD+EIRAIMAQYMPLD+Q E+PNHV   R
Sbjct  597  LRAYMDSEIRAIMAQYMPLDSQGEVPNHVHGDR  629



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 4 isoform X2 [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+RNG + SACV + E KC CPPGFKGDG K+CEDI+ECK+K ACQC ECSC
Sbjct  476  VNNGGCWQESRNGLSMSACVDNGEVKCKCPPGFKGDGVKTCEDINECKEKKACQCSECSC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
             NTWGSYDC+CS  LLY+RDHDTCISK A+  KS+W+  WVILIGL + AGGAY+VYKYR
Sbjct  536  TNTWGSYDCSCSGDLLYMRDHDTCISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYR  595

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            LR+YMD+EIRAIMAQYMPLD+Q E+PNHV   R
Sbjct  596  LRAYMDSEIRAIMAQYMPLDSQGEVPNHVHGDR  628



>gb|AAN05373.1| Putative vacuolar sorting receptor protein [Oryza sativa Japonica 
Group]
Length=643

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 129/163 (79%), Gaps = 13/163 (8%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S  GKC CP GF+GDG K CEDI+ECK+K ACQCPECSC
Sbjct  477  INHGGCWHETRNGKTFSACQESGNGKCQCPAGFRGDGVKKCEDINECKEKKACQCPECSC  536

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCIS------------KRATQVKSAWAAVWviliglgv  526
            ++TWG Y+CTCS  LLYI++HDTCIS            K A Q K+AWAAVW ILI L V
Sbjct  537  RDTWGDYECTCSGDLLYIKEHDTCISHLIYYLFDQSAGKTAVQGKAAWAAVWGILIVLVV  596

Query  525  vaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            VA G+Y+VYKYRLRSYMD+EIRAIMAQYMPLD+Q E+PNH +D
Sbjct  597  VAAGSYVVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVPNHTND  639



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+RNG + SACV + E KC CPPGF+GDG K+CEDI+ECK++ ACQC ECSC
Sbjct  477  VNNGGCWQESRNGLSMSACVDNGEVKCKCPPGFRGDGVKTCEDINECKERKACQCSECSC  536

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
             NTWGSYDC+CS  LLY+RDHD CISK A+  KS+W+  WVILIGL + AGGAY+VYKYR
Sbjct  537  TNTWGSYDCSCSGDLLYMRDHDICISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYR  596

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            LR+YMD+EIRAIMAQYMPLD+Q E+PNHV+  R
Sbjct  597  LRAYMDSEIRAIMAQYMPLDSQGEVPNHVNGDR  629



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+RNG + SACV + E KC CPPGF+GDG K+CEDI+ECK++ ACQC ECSC
Sbjct  476  VNNGGCWQESRNGLSMSACVDNGEVKCKCPPGFRGDGVKTCEDINECKERKACQCSECSC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
             NTWGSYDC+CS  LLY+RDHD CISK A+  KS+W+  WVILIGL + AGGAY+VYKYR
Sbjct  536  TNTWGSYDCSCSGDLLYMRDHDICISKNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYR  595

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSR  391
            LR+YMD+EIRAIMAQYMPLD+Q E+PNHV+  R
Sbjct  596  LRAYMDSEIRAIMAQYMPLDSQGEVPNHVNGDR  628



>ref|XP_009421105.1| PREDICTED: vacuolar-sorting receptor 3-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETR+G T SAC  S +GKC CP GF+GD  K CE+I+EC+ KTACQCPECS
Sbjct  478  RINNGGCWQETRDGKTVSACQESGDGKCQCPLGFEGDAVKVCENINECEKKTACQCPECS  537

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGSY+CTCS  LLYI++ DTCISK+A++ K+ WAA WV+L+ L + + GAY++YKY
Sbjct  538  CKDTWGSYECTCSGDLLYIKEQDTCISKKASEAKATWAAAWVLLMVLAIASFGAYVIYKY  597

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            RLRSYMD+EIRAIMAQYMPLD Q E+PNH
Sbjct  598  RLRSYMDSEIRAIMAQYMPLDGQGELPNH  626



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSAC       CTCPPGFKGDG K+CED+DECK+K ACQC +C 
Sbjct  471  EINNGGCWRKTKNGKTYSACRDDHTKGCTCPPGFKGDGEKTCEDVDECKEKVACQCSQCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C  GLLY+R+HD CI K A   + +W+ +WVI++ LG V  G Y VYKY
Sbjct  531  CKNTWGSYECSCGGGLLYMREHDACIGKNARNTEYSWSFIWVIILCLGAVGVGGYAVYKY  590

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ EIPNHVS
Sbjct  591  RIRRYMDSEIRAIMAQYMPLDNQGEIPNHVS  621



>dbj|BAJ85815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRN  T+SAC  S E  C CP GF+GDG K C DIDECK++ ACQCPECSC
Sbjct  291  INHGGCWHETRNRKTFSACQESGERNCKCPAGFRGDGVKKCHDIDECKERKACQCPECSC  350

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            ++TWG YDCTCS  LLYI++HDTCISK A + K AWAAV  IL+ L +VA G Y+VYKYR
Sbjct  351  RDTWGGYDCTCSGDLLYIKEHDTCISKTAVKAKEAWAAVCGILVALVIVAAGGYVVYKYR  410

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPN  409
            LRSYMD+EIRAIMAQYMPLD+Q E+PN
Sbjct  411  LRSYMDSEIRAIMAQYMPLDSQGEVPN  437



>gb|ACN30885.1| unknown [Zea mays]
Length=625

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S +GKC CP GF+GDG K CEDIDECK+K ACQCPEC+C
Sbjct  471  INHGGCWHETRNGKTFSACQESGDGKCLCPAGFRGDGVKKCEDIDECKEKKACQCPECNC  530

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWG YDCTCS  LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYR
Sbjct  531  KDTWGGYDCTCSGDLLYIREHDTCISKTAVQAKAAWAAVWGILIVVAVVAAGSYVVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            LRSYMD+EIRAIMAQYMPLDNQ E+PNH  D
Sbjct  591  LRSYMDSEIRAIMAQYMPLDNQGEVPNHTHD  621



>ref|NP_001130741.1| uncharacterized protein LOC100191845 precursor [Zea mays]
 gb|ACF79081.1| unknown [Zea mays]
Length=632

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S +GKC CP GF+GDG K CEDIDECK+K ACQCPEC+C
Sbjct  478  INHGGCWHETRNGKTFSACQESGDGKCLCPAGFRGDGVKKCEDIDECKEKKACQCPECNC  537

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWG YDCTCS  LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYR
Sbjct  538  KDTWGGYDCTCSGDLLYIREHDTCISKTAVQAKAAWAAVWGILIVVAVVAAGSYVVYKYR  597

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            LRSYMD+EIRAIMAQYMPLDNQ E+PNH  D
Sbjct  598  LRSYMDSEIRAIMAQYMPLDNQGEVPNHTHD  628



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGKSCEDIDECKDKTACQCPECSC  670
             +NNGGCW +TR G TYSACV  +   C CPPGFKGDG  CEDIDECK+K ACQCPECSC
Sbjct  475  HVNNGGCWKDTRGGRTYSACVDEQTHGCKCPPGFKGDGIHCEDIDECKEKLACQCPECSC  534

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSYDC+CSNGLLY+++HDTCIS     V   WA+ ++I++ LG V  G Y  YKYR
Sbjct  535  KNTWGSYDCSCSNGLLYMQEHDTCISNGGGGV--GWASAFMIILVLGAVGTGGYAFYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            +R YMD+EIRAIMAQYMPLDNQ EI  H+
Sbjct  593  IRRYMDSEIRAIMAQYMPLDNQVEITTHI  621



>ref|XP_003573873.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=629

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S +G+CTCP GF+GDG K C+DIDECK+K ACQC ECSC
Sbjct  476  INHGGCWHETRNGKTFSACQESGDGECTCPAGFQGDGVKKCQDIDECKEKKACQCLECSC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            ++TWG Y+CTCS  LLYI++HDTCISK   Q K+AWAAV  +L+ L V+A G+YLVYKYR
Sbjct  536  RDTWGGYECTCSQDLLYIKEHDTCISKTTVQAKAAWAAVCGVLVALVVLAVGSYLVYKYR  595

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            LRSYMD+EIRAIMAQYMPLD Q+E+ N+
Sbjct  596  LRSYMDSEIRAIMAQYMPLDGQAEVSNY  623



>gb|ACS91931.1| vacuolar sorting receptor protein [Lilium longiflorum]
Length=567

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T  G TYSACV  +   C CPPGFKGDG  SCED+DECK+K ACQC +C 
Sbjct  414  EVNNGGCWTKTHQGKTYSACVDDQSKGCKCPPGFKGDGVNSCEDVDECKEKVACQCSQCK  473

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+++HDTCISK+ T  +  W  +W+I +GL V     Y VYKY
Sbjct  474  CKNTWGSYDCSCSGDLLYMKEHDTCISKKPT-TEVGWNFLWIIFLGLAVAGISGYAVYKY  532

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+RSYMD+EIRAIMAQYMPLDNQ E+PNHVS
Sbjct  533  RIRSYMDSEIRAIMAQYMPLDNQGEVPNHVS  563



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G TYSACV   +  C CPPGFKGDG K+CEDIDECK++TACQC  C 
Sbjct  470  EINNGGCWKKTKDGKTYSACV---DDGCKCPPGFKGDGVKTCEDIDECKERTACQCSACK  526

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLYI++HDTCISKRAT  +  W+ +WVI  GL V   GAY VYKY
Sbjct  527  CKNTWGSYDCSCSGDLLYIKEHDTCISKRAT-TEVGWSFLWVIFFGLAVAGVGAYAVYKY  585

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+RSYMD+EIRAIMAQYMPLDNQ E PNH+
Sbjct  586  RIRSYMDSEIRAIMAQYMPLDNQGEAPNHI  615



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 124/150 (83%), Gaps = 2/150 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCWHE RNG ++SAC+ + +GKCTCPPGFKGDG  SCEDIDEC++K  C+CPECS
Sbjct  449  KISNGGCWHENRNGISFSACLDTVDGKCTCPPGFKGDGVNSCEDIDECEEKKVCRCPECS  508

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAV-WviliglgvvaggaylvYK  496
            CK+TWGS++CTC N LLY+RD D CISK A   KS+W A+  V++      AGGAYL+YK
Sbjct  509  CKDTWGSFECTCGNDLLYMRDQDACISKGAAAGKSSWVAISIVLIALAVAAAGGAYLLYK  568

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            Y LRSYMD+EIRAIM+QYMPL+NQSE+PNH
Sbjct  569  YSLRSYMDSEIRAIMSQYMPLENQSEVPNH  598



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETRNGHTYSAC+      C CPPGFKGDG K CED+DECK+K ACQCPEC C
Sbjct  472  INNGGCWRETRNGHTYSACIDDHSKDCKCPPGFKGDGVKKCEDVDECKEKVACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS+GLLY+R+HDTCI K     K +W+ +W+++  L   +   Y +YKYR
Sbjct  532  KNTWGSYECSCSSGLLYMREHDTCIGKVGA-TKLSWSMLWILIFALAAASLSGYALYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +RSYMD+EIRAIMAQYMPLD+Q   PN  S
Sbjct  591  IRSYMDSEIRAIMAQYMPLDSQ---PNTAS  617



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETRNGHTYSAC+      C CPPGFKGDG K CED+DECK+K ACQCPEC C
Sbjct  472  INNGGCWRETRNGHTYSACIDDHSKDCKCPPGFKGDGVKKCEDVDECKEKVACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+CS+GLLY+R+HDTCI S +    K +W+ +W+++  L   +   Y +YKY
Sbjct  532  KNTWGSYECSCSSGLLYMREHDTCIGSGKVGATKLSWSMLWILIFALAAASLSGYALYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+RSYMD+EIRAIMAQYMPLD+Q   PN  S
Sbjct  592  RIRSYMDSEIRAIMAQYMPLDSQ---PNTAS  619



>gb|EPS72755.1| hypothetical protein M569_02000, partial [Genlisea aurea]
Length=514

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++++GGCW+E RNG  +SACV  ++GKCTCP GF GDG KSCED+DECK+K ACQCPEC+
Sbjct  372  KISHGGCWNENRNGIAFSACVDDDDGKCTCPEGFTGDGVKSCEDVDECKEKKACQCPECN  431

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLYIRDHD CISK + +V+SAW+  W+I++GL + A GAYLVYKY
Sbjct  432  CKNTWGSYECSCSGDLLYIRDHDACISKSSGRVRSAWSVFWIIILGLAIAAAGAYLVYKY  491

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD+EIRAIMAQYMPLD+Q
Sbjct  492  RIRSYMDSEIRAIMAQYMPLDSQ  514



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G T+SACV      C CPPGFKGDG  SCED+DECK+K+ACQCPEC 
Sbjct  471  EINNGGCWKKTQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKEKSACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWG YDC+CS+GLLYI++HDTCISK A   +  W+ +W+I++ L       Y  YKY
Sbjct  531  CKNTWGGYDCSCSSGLLYIQEHDTCISK-AANTEVGWSFIWIIILALAAAGVAGYATYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ EIP H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGEIPVH  618



>ref|XP_011001696.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=532

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQC EC 
Sbjct  378  EINNGGCWKRTQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECK  437

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS GLLY+R+HD CISK A   K +W+ VW+I++GL       Y +YKY
Sbjct  438  CKNTWGSYDCSCSGGLLYMREHDACISK-AADTKYSWSFVWIIILGLAAAGVAGYAIYKY  496

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLD+Q++IP H
Sbjct  497  RIRRYMDSEIRAIMAQYMPLDSQADIPVH  525



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWHE+R+G T++AC+  E+  C CPPGFKGDG  SCEDIDECK+K ACQC +C+
Sbjct  481  KMNNGGCWHESRHGQTFTACMDPED-TCKCPPGFKGDGVNSCEDIDECKEKKACQCSDCN  539

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLY++DHDTCISK A Q KSAWAAVW+ LIGL +VA G YL YKY
Sbjct  540  CKNTWGSYECTCSGDLLYMKDHDTCISKSAAQAKSAWAAVWLSLIGLAMVAAGGYLFYKY  599

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLD+Q+EIPNH SD RA
Sbjct  600  RIRQYMDSEIRAIMAQYMPLDSQTEIPNH-SDDRA  633



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQCPEC 
Sbjct  471  EINNGGCWKKTQDGTTFSACVEDRSQGCKCPPGFKGDGVNSCEDVDECKDKVACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS GLLY+R+HDTCIS  A + + +W+ VW+I++GL       Y +YKY
Sbjct  531  CKNTWGSYECSCSGGLLYMREHDTCIS-NAARAEYSWSFVWIIILGLATAGVAGYAIYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLD+Q++IP H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDSQADIPVH  618



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G T+SAC+      C CPPGFKGDG  SCED+DECK+K ACQCPEC 
Sbjct  470  EINNGGCWKKTQDGKTFSACIEDHSKGCKCPPGFKGDGVNSCEDVDECKEKLACQCPECK  529

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLY+++HDTCISK  T   S W  VWV+++ L  V    Y VYKY
Sbjct  530  CKNTWGSYECSCSGNLLYMQEHDTCISKEGTSTVS-WNFVWVMVLALAGVGVIGYGVYKY  588

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLD+Q E+PNH+
Sbjct  589  RIRRYMDSEIRAIMAQYMPLDSQGEVPNHI  618



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQC EC 
Sbjct  471  EINNGGCWKRTQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS GLLY+R+HD CISK A   K +W+ VW+I++GL       Y +YKY
Sbjct  531  CKNTWGSYDCSCSGGLLYMREHDACISK-AADTKYSWSFVWIIILGLAAAGVAGYAIYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLD+Q++IP H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDSQADIPVH  618



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSAC       C CPPGFKGDG K+CED+DECK+K  CQC +C 
Sbjct  471  EINNGGCWTKTQNGRTYSACRDDHTNGCKCPPGFKGDGEKTCEDVDECKEKVNCQCAQCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C  GLLY+R+HD CISK A+  +  W  +WVI++ LG V  G Y VYKY
Sbjct  531  CKNTWGSYECSCGGGLLYMREHDACISKNASVSEFNWGFMWVIILCLGAVGVGGYAVYKY  590

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLDNQ EIPNHV
Sbjct  591  RIRRYMDSEIRAIMAQYMPLDNQGEIPNHV  620



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 113/149 (76%), Gaps = 6/149 (4%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETRNG TYSAC    +G C CP GFKGDG   CED+DECK+KTACQC EC 
Sbjct  474  EINNGGCWKETRNGRTYSACT---DGGCKCPDGFKGDGVHKCEDVDECKEKTACQCKECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C C  G+LY+++HDTCISK A Q  + W  +WV L  L       Y VYKY
Sbjct  531  CKNTWGSYECGCGGGMLYMKEHDTCISKSAGQ--AGWNFLWVTLFALATAGLAGYAVYKY  588

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+RSYMD+EIRAIMAQYMPLDNQ EIPNH
Sbjct  589  RIRSYMDSEIRAIMAQYMPLDNQGEIPNH  617



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +LNNGGCW  T++G TYSAC+  +   CTCPPGF+GDG KSCEDIDECK++ ACQCPEC 
Sbjct  475  ELNNGGCWKGTKDGKTYSACIDGQTKGCTCPPGFRGDGVKSCEDIDECKERAACQCPECR  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+C   LLY+ +HDTCISK   +   +W+ +WVI++ +  V  G Y +YKY
Sbjct  535  CKNTWGSYDCSCRGNLLYMHEHDTCISKD-VKTDFSWSFIWVIILAVAAVGAGGYAMYKY  593

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ E+P H
Sbjct  594  RIRRYMDSEIRAIMAQYMPLDNQGEVPLH  622



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G TYSACV      C CP GFKGDG K+CED++ECKDK AC CPEC 
Sbjct  471  EINNGGCWKDTKDGSTYSACVDDNSKGCQCPQGFKGDGVKTCEDVNECKDKVACNCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS  LLY+R+HD CISK   + + +W+ +WVI++GL     G Y +YKY
Sbjct  531  CKNTWGSYECSCSGNLLYMREHDACISKH-VKTEVSWSFIWVIILGLAAAGVGGYALYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLDNQ EIPNHV
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGEIPNHV  619



>ref|XP_004983263.1| PREDICTED: vacuolar-sorting receptor 3-like [Setaria italica]
Length=631

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S +GKC CP GF+GDG K CEDI+ECK++ ACQCPEC+C
Sbjct  477  INHGGCWHETRNGKTFSACQESGDGKCQCPAGFRGDGVKKCEDINECKERKACQCPECNC  536

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            ++TWG YDCTCS  LLYIR+HDTCISK A Q K+AWAAVW ILI + VVA G+Y+VYKYR
Sbjct  537  RDTWGGYDCTCSGDLLYIREHDTCISKTAVQAKAAWAAVWGILIVIVVVAAGSYIVYKYR  596

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            LRSYMD+EIRAIMAQYMPLDNQ E+PNH  +
Sbjct  597  LRSYMDSEIRAIMAQYMPLDNQGEVPNHTHE  627



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T++G TYSAC+      C CPPGF+GDG  SCEDIDECK+  ACQCPEC 
Sbjct  471  EINNGGCWKGTKDGRTYSACIDDHTKGCKCPPGFRGDGVNSCEDIDECKENLACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS+  LYI +HDTCISK A+  + +W+ VWV+ +GL V     Y +YKY
Sbjct  531  CKNTWGSYECSCSSNALYIHEHDTCISKDAS-TEYSWSFVWVVFLGLAVAGAAGYALYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ E+PNH++
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGEVPNHMT  620



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  T++G T+SAC+      C CPPGFKGDG  SCEDIDECK++ ACQCPEC C
Sbjct  472  INNGGCWKGTKDGRTFSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKERLACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWG YDC+C++ LLY+ +HDTCISK   + + +W  VWVI++GL     GAY VYKYR
Sbjct  532  KNTWGGYDCSCNSNLLYMHEHDTCISKD-VKTEFSWGLVWVIILGLAAAGVGAYAVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLDNQ E+PNHVS
Sbjct  591  IRRYMDSEIRAIMAQYMPLDNQGEVPNHVS  620



>ref|XP_006661708.1| PREDICTED: vacuolar-sorting receptor 3-like [Oryza brachyantha]
Length=627

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +N+GGCWHETRNG T+SAC  S  GKC CP GF GDG K CEDIDECK + ACQCPECSC
Sbjct  473  INHGGCWHETRNGKTFSACQESGNGKCQCPAGFHGDGVKKCEDIDECKQRKACQCPECSC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            +NTWG Y+CTCS  LLYI++HDTCISK A Q K+AWAAVW ILI L VVA G+Y+VYKYR
Sbjct  533  RNTWGDYECTCSGDLLYIKEHDTCISKTAVQAKAAWAAVWGILIVLVVVAAGSYVVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            LRSYMD+EIRAIMAQYMPLD+Q E+PNH  D
Sbjct  593  LRSYMDSEIRAIMAQYMPLDSQGEVPNHTQD  623



>ref|XP_006842496.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 ref|XP_011622665.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW +T +  TYSAC+ +E   C CPPGFKG+G  SCED+DECK+K ACQCPEC C
Sbjct  471  INNGGCWEKTHDSRTYSACIENESKGCKCPPGFKGNGVDSCEDVDECKEKLACQCPECKC  530

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNT+GSY+C C+  LLY+R+HDTCISK+AT  +  W  VWVI +GL     G Y +YKYR
Sbjct  531  KNTFGSYECNCNGDLLYMREHDTCISKKAT-TEVGWNFVWVIFLGLAAAGIGGYAIYKYR  589

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            +R YMD+EIRAIMAQYMPLDNQ EIPNH+
Sbjct  590  IRRYMDSEIRAIMAQYMPLDNQGEIPNHM  618



>ref|XP_006374052.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
 gb|ERP51849.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
Length=551

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G T+SACV      C CPPGFKGDG  SCED+DECKDK ACQC EC 
Sbjct  397  EINNGGCWKKTQDGRTFSACVEDHSQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECK  456

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+C  GLLY+++HDTCISK A     +W+ VW+I++GL       Y +YKY
Sbjct  457  CKNTWGSYDCSCGGGLLYMQEHDTCISK-AANTNYSWSFVWIIILGLAAAGVAGYAIYKY  515

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLD+Q++IP H
Sbjct  516  RIRRYMDSEIRAIMAQYMPLDSQADIPVH  544



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  T++G T+SAC+      C CPPGFKGDG  SCEDIDECK++ ACQCPEC C
Sbjct  472  INNGGCWKGTKDGRTFSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKERLACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWG YDC+C++ LLY+ +HDTCI + +  + + +W  VWVI++GL     GAY VYKY
Sbjct  532  KNTWGGYDCSCNSNLLYMHEHDTCINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ E+PNHVS
Sbjct  592  RIRRYMDSEIRAIMAQYMPLDNQGEVPNHVS  622



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW E+RNG TYSAC+      C CP GF+GDG  SC+D+DECK+K ACQCPEC 
Sbjct  477  EINNGGCWKESRNGKTYSACIDDHTKGCKCPHGFRGDGVNSCDDVDECKEKLACQCPECK  536

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+ WGSY+C+CS GLLY+++HD CI+K  T+ + +W  +W I++GL       Y VYKY
Sbjct  537  CKDVWGSYECSCSGGLLYMQEHDMCINKN-TRTEYSWGFIWTIILGLAAAGVAGYAVYKY  595

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLDNQ EIP+H   SR 
Sbjct  596  RIRRYMDSEIRAIMAQYMPLDNQGEIPSHTHASRG  630



>ref|XP_012091044.1| PREDICTED: vacuolar-sorting receptor 1-like [Jatropha curcas]
 gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 118/149 (79%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G T+SAC   +   C CPPGF+GDG  SCEDIDECKDKTACQC +C 
Sbjct  471  EINNGGCWKKTQDGKTFSAC---DSQGCKCPPGFRGDGVNSCEDIDECKDKTACQCSDCK  527

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+C +GLLY+R+HDTCISK A+  + +W+ +W I++GL       Y +YKY
Sbjct  528  CKNTWGSYDCSCGSGLLYMREHDTCISKDAS-AEVSWSFIWTIILGLAAAGIAGYAIYKY  586

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ EIP H
Sbjct  587  RIRRYMDSEIRAIMAQYMPLDNQGEIPVH  615



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  +++G TYSAC+   +  C CPPGF+GDG K CEDIDECK+KTACQC  CSC
Sbjct  479  INNGGCWKGSKDGRTYSACIDDHKNGCKCPPGFRGDGVKECEDIDECKEKTACQCQHCSC  538

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            +NTWGSY+C+CS  LLYI +HDTCISK + + + +W  +WVI++G  +     Y +YKYR
Sbjct  539  RNTWGSYECSCSGNLLYIHEHDTCISKDSNR-EVSWGIMWVIVLGFALAGVAGYAIYKYR  597

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            +R YMD+EIRAIMAQYMPLDNQ ++PNH+
Sbjct  598  IRRYMDSEIRAIMAQYMPLDNQGDVPNHL  626



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  T++G T+SAC+      C CP GFKGDG  SCEDIDECK++ ACQCPEC C
Sbjct  472  INNGGCWKGTKDGMTFSACIDDHTKGCKCPLGFKGDGVNSCEDIDECKERLACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWG YDC+C   LLY+ +HDTCISK   + + +W  VWVI++GL     GAY VYKYR
Sbjct  532  KNTWGGYDCSCKGNLLYMHEHDTCISKD-VKTEFSWGLVWVIILGLAAAGVGAYAVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLDNQ E+PNHVS
Sbjct  591  IRRYMDSEIRAIMAQYMPLDNQGEVPNHVS  620



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NN GCW +T++G T+SACV      C CPPGFKGDG  SC+D+DECKDK ACQCPEC 
Sbjct  471  EINNRGCWKKTQDGTTFSACVEDHSQGCKCPPGFKGDGVNSCDDVDECKDKVACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS GLLY+R+HD CIS  A + + +W+ VW+I++GL       Y +YKY
Sbjct  531  CKNTWGSYECSCSGGLLYMREHDACIS-NAARAEYSWSFVWIIILGLATAGVAGYAIYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLD+Q++IP H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDSQADIPVH  618



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR+G TYSAC       C+CPPGFKGDG K+CED+DECK+KTACQC +C C
Sbjct  472  INNGGCWKETRSGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCSQCKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+C  GLLY+R++D CI K  +   S+W  +WVI++ LG V  G + VYKYR
Sbjct  532  KNTWGSYECSCGGGLLYMRENDACIGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYR  591

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLDNQ E+P+HV+
Sbjct  592  IRRYMDSEIRAIMAQYMPLDNQGEVPSHVA  621



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score =   188 bits (477),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR G TYSAC       C+CPPGFKGDG K+CED+DECK+KTACQC  C C
Sbjct  473  INNGGCWKETRTGSTYSACRDDLTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCAHCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSYDC+C  GLLY+R +D CI K A+   S+   +W+I++ LG V  G Y+VYKYR
Sbjct  533  KNTWGSYDCSCGGGLLYMRGYDACIGKNASGSGSSRGLIWIIILCLGAVGVGGYIVYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLDN+  +P HVS
Sbjct  593  IRRYMDSEIRAIMAQYMPLDNEGAVPGHVS  622



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +LNNGGCW  TRNG T++AC   +   C CP GFKGDG  +CEDIDEC+++ ACQCP+C+
Sbjct  471  KLNNGGCWQHTRNGVTHTACSDRQLKGCQCPAGFKGDGFNTCEDIDECRERVACQCPDCT  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNT+GSYDC+CS  LLY+R+HDTCISK+ +  K  W  ++ +L GL   A   Y+VYKY
Sbjct  531  CKNTYGSYDCSCSGDLLYMREHDTCISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKY  590

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+Q+++ +H+ +
Sbjct  591  RLRSYMDSEIRAIMAQYMPLDSQNDVHHHLQE  622



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +LNNGGCW  TRNG T++AC   +   C CP GFKGDG  +CEDIDEC+++ ACQCP+C+
Sbjct  471  KLNNGGCWQHTRNGVTHTACSDRQLKGCQCPSGFKGDGFNTCEDIDECRERVACQCPDCT  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNT+GSYDC+CS  LLY+R+HDTCISK+ +  K  W  ++ +L GL   A   Y+VYKY
Sbjct  531  CKNTYGSYDCSCSGDLLYMREHDTCISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKY  590

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+Q+++ +H+ +
Sbjct  591  RLRSYMDSEIRAIMAQYMPLDSQNDVHHHLQE  622



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ET+ G TYSAC       C+CPPGFKGDG K+CED+DECK+KT CQC  C C
Sbjct  472  INNGGCWKETQLGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTVCQCAHCKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSYDC+C  GLLY++ +D CISK A+   S+W  +W+I++ LG V  G Y VYKYR
Sbjct  532  KNTWGSYDCSCGGGLLYMQAYDACISKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKYR  591

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPL N+ E P HVS
Sbjct  592  IRRYMDSEIRAIMAQYMPLGNEGEAPGHVS  621



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G TYSACV   +  C CPPGFKGDG K+CED+DECK+K ACQC  C 
Sbjct  470  EINNGGCWKKTKDGKTYSACV---DDGCKCPPGFKGDGVKTCEDVDECKEKIACQCSACK  526

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWG YDC+CS  LLY+++HD CISK+AT  +  W+ +WVI  GL V   GAY+VYKY
Sbjct  527  CKNTWGGYDCSCSGDLLYMQEHDACISKKAT-TEVGWSFLWVIFFGLAVAGIGAYVVYKY  585

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+RSYMD+EIRAIMAQYMPLDNQ E  NHV
Sbjct  586  RIRSYMDSEIRAIMAQYMPLDNQGEAANHV  615



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G T+SACV   +  C CPPGFKGDG  +CEDIDECK++ ACQC  C 
Sbjct  474  EINNGGCWKKTKDGKTFSACV---DDGCKCPPGFKGDGVNTCEDIDECKERIACQCSACK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGS++C+CS  LLYI++HDTCISK+A   +  W+ +WVI  GL V   GAY+VYKY
Sbjct  531  CKNTWGSFECSCSGDLLYIKEHDTCISKKAA-AEIGWSFLWVIFFGLAVAGVGAYMVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+RSYMD+EIRAIMAQYMPLDNQ E PNH+
Sbjct  590  RIRSYMDSEIRAIMAQYMPLDNQGEAPNHI  619



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis sativus]
Length=624

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T++G TYSAC       C CPPGFKGDG + CED+DECK+K ACQCPEC 
Sbjct  471  EINNGGCWKGTQDGRTYSACSDDHTKGCKCPPGFKGDGVRKCEDVDECKEKLACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            C+NTWGSYDC+C NGLLY+ +HDTCI    + V S W+ V + ++ L +     + VYKY
Sbjct  531  CRNTWGSYDCSCRNGLLYMHEHDTCIGNIGSTVTS-WSVVKITILVLAITGITGFAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ E  NHV+
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGETSNHVA  620



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECSC  670
            LNNGGCW  T++G TYSAC+      C CPPGFKGDG + CEDIDECK++ ACQCP+C C
Sbjct  472  LNNGGCWKGTKDGRTYSACIDDHTKGCKCPPGFKGDGVNLCEDIDECKERLACQCPDCKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWG Y C+CS  LLY+++HDTCI        S W  VWVI++GL V   GAY VYKYR
Sbjct  532  KNTWGGYQCSCSGNLLYMQEHDTCIGNDGKAAFS-WGLVWVIILGLAVAGAGAYAVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLDNQ E+PNH+S
Sbjct  591  IRRYMDSEIRAIMAQYMPLDNQGEVPNHIS  620



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 115/151 (76%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  T++G T+SAC+      C CP GFKGDG  SCEDIDECK++ ACQCPEC C
Sbjct  472  INNGGCWKGTKDGMTFSACIDDHTKGCKCPLGFKGDGVNSCEDIDECKERLACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWG YDC+C   LLY+ +HDTCI + +  + + +W  VWVI++GL     GAY VYKY
Sbjct  532  KNTWGGYDCSCKGNLLYMHEHDTCINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ E+PNHVS
Sbjct  592  RIRRYMDSEIRAIMAQYMPLDNQGEVPNHVS  622



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T+ G TYSAC+      C CP GFKGDG  SCEDIDECK+KTACQC +C 
Sbjct  471  EINNGGCWKGTQGGRTYSACIDDHTKGCKCPAGFKGDGTNSCEDIDECKEKTACQCSDCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C    LYI +HDTCISK  +  + +W+ VWV+++GL V     Y +YKY
Sbjct  531  CKNTWGSYECSCGGNSLYIHEHDTCISKD-SNTEYSWSFVWVVILGLAVSGVAGYALYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSDSRA  388
            R+R YMD+EIRAIMAQYMPLDNQ E+P+H+S  R 
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGEVPDHMSHGRV  624



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECSC  670
            LNNGGCW  T++G TYSAC+      C CPPGFKGDG + CEDIDECK++ ACQCP+C C
Sbjct  472  LNNGGCWKGTKDGRTYSACIDDHTKGCKCPPGFKGDGVNLCEDIDECKERLACQCPDCKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISK-RATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWG Y C+CS  LLY+++HDTCI+     +   +W  VWVI++GL V   GAY VYKY
Sbjct  532  KNTWGGYQCSCSGNLLYMQEHDTCIAAGNDGKAAFSWGLVWVIILGLAVAGAGAYAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ E+PNH+S
Sbjct  592  RIRRYMDSEIRAIMAQYMPLDNQGEVPNHIS  622



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGKS-CEDIDECKDKTACQCPECSC  670
            LNNGGCW  T++G T+SAC+      C CPPGFKGDG + C+DIDECK++ ACQCP+C C
Sbjct  472  LNNGGCWKGTKDGRTFSACIDDHTKGCKCPPGFKGDGVNVCDDIDECKERLACQCPDCKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWG Y C+CS  LLY+++HDTCI        S W  VWVI++GL V   GAY VYKYR
Sbjct  532  KNTWGGYQCSCSGNLLYMQEHDTCIGNDGKAAFS-WGLVWVIILGLAVAGVGAYAVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLDNQ E+PNH+S
Sbjct  591  IRRYMDSEIRAIMAQYMPLDNQGEVPNHIS  620



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 112/149 (75%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETRNG T+SAC    +G C CP GFKGDG   CED+DECK++TACQC EC 
Sbjct  468  EINNGGCWKETRNGRTHSACT---DGGCKCPDGFKGDGVHKCEDVDECKERTACQCKECK  524

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            C NTWGSY+C C  G LY+++HDTCISK A   +  W  +W +L GL  V    Y VYKY
Sbjct  525  CNNTWGSYECGCGGGFLYMKEHDTCISKDAG-ARVGWNFLWFLLFGLAAVGIAGYAVYKY  583

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+RSYMD+EIRAIMAQYMPLDNQ EIPNH
Sbjct  584  RIRSYMDSEIRAIMAQYMPLDNQGEIPNH  612



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETR G TYSAC+      C CP GF+GDG KSCED+DECK+K ACQCP C 
Sbjct  471  EINNGGCWRETREGRTYSACIDDHSHGCKCPYGFRGDGVKSCEDVDECKEKLACQCPGCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS G LY+R+HDTCISK   + + +W +VWVI++GL     G Y +YKY
Sbjct  531  CKNTWGSYECSCSGGSLYMREHDTCISKN-VKTEVSWGSVWVIILGLVAAGAGGYAIYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLDNQ   PN+V
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQ---PNNV  616



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score =   184 bits (468),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 117/152 (77%), Gaps = 4/152 (3%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED+DECK+KT CQCPEC C
Sbjct  473  INNGGCWRETRGSYTYSACVDDHSNGCKCPVGFKGDGVKSCEDVDECKEKTVCQCPECKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKY
Sbjct  533  KNTWGSYECSCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEI--PNHV  403
            R+RSYMD EIR IMAQYMPL++Q     P+H+
Sbjct  593  RIRSYMDAEIRGIMAQYMPLESQPNPSGPHHM  624



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   184 bits (468),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETRNG TYSAC  +++G C CP GFKGDGK  CEDIDECK++TACQC EC 
Sbjct  474  EINNGGCWKETRNGRTYSAC--TDDG-CKCPDGFKGDGKHKCEDIDECKERTACQCKECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK     ++ W  +WVI +GL       Y VYKY
Sbjct  531  CKNTWGSYECGCSGGLLYMKEHDTCISKNGA-TETGWGFLWVIFLGLVAAGIAGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++ +H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGDVQSH  618



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   184 bits (468),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSACV      C CPPGFKGDG  SCEDI+ECK+K ACQC +C 
Sbjct  473  EINNGGCWKQTQNGKTYSACVDDHTKGCNCPPGFKGDGVNSCEDINECKEKVACQCSDCK  532

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRA-TQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSYDC+C+ G +Y+++HDTCIS    + V+ +   ++ I++ L  V   AY VYK
Sbjct  533  CKNTWGSYDCSCNGGSIYMQEHDTCISATVESSVRLSMGGIFFIILCLAAVGVCAYAVYK  592

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            YR+R YMD+EIRAIMAQYMPLDNQ EIP HVS
Sbjct  593  YRIRRYMDSEIRAIMAQYMPLDNQGEIPTHVS  624



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+R G TYSACV      C CP GFKGDG KSCED+DECK+KT CQCPEC C
Sbjct  470  INNGGCWRESRGGFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPECKC  529

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+CSNGLLY+R+HDTCI S +    K +W+ +W ++IG+GV     Y VYKY
Sbjct  530  KNTWGSYECSCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWFLIIGVGVAGLSGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  590  RIRSYMDAEIRGIMAQYMPLESQ  612



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETRNG TYSAC  +++G C CP GFKGDGK  CEDIDECK++TACQC EC 
Sbjct  474  EINNGGCWKETRNGRTYSAC--TDDG-CKCPDGFKGDGKHKCEDIDECKERTACQCKECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKY
Sbjct  531  CKNTWGSYECGCSGGLLYMKEHDTCISKNGA-TETGWGFLWVIFFGLVAAGIAGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++ +H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGDVQSH  618



>ref|XP_010036004.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW47526.1| hypothetical protein EUGRSUZ_K01287 [Eucalyptus grandis]
Length=628

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW+ETR G T+SACV      C CPPGF GDG  SCED+DECK+K  CQCPEC 
Sbjct  475  EINNGGCWNETRGGRTFSACVDDSSTGCKCPPGFTGDGVNSCEDVDECKEKKVCQCPECK  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CK+TWGS++CTCS GLLY++++DTCIS      KS     W++++GL     GAY+VYKY
Sbjct  535  CKDTWGSFECTCSGGLLYMQEYDTCISTHPV-TKSFGVFFWIVILGLTAAGVGAYMVYKY  593

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+RSYMD+EIR+IMAQYMPLD Q+E+P+H S
Sbjct  594  RIRSYMDSEIRSIMAQYMPLDGQAEVPSHGS  624



>gb|ACN25155.1| unknown [Zea mays]
Length=310

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSAC  +++G C CP GFKGDGK  CED+DECK++T CQC EC 
Sbjct  160  EINNGGCWKDTKNGRTYSAC--TDDG-CRCPDGFKGDGKHKCEDVDECKERTVCQCEECR  216

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK     ++ W  +WV++ GL       Y VYKY
Sbjct  217  CKNTWGSYECGCSGGLLYMKEHDTCISKNGAS-EAGWGFLWVVVFGLVAAGIAGYAVYKY  275

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLD+Q ++ +H 
Sbjct  276  RIRRYMDSEIRAIMAQYMPLDSQGDVQSHA  305



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 112/150 (75%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T++G TYSACV      C CPPGFKGDG  SCED+DECK+K ACQC EC 
Sbjct  471  EINNGGCWRKTQDGRTYSACVDDHSHGCKCPPGFKGDGVNSCEDVDECKEKLACQCRECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+CS G LY+R+HDTCI K A+  K +W  VW I+ GL       Y  YKY
Sbjct  531  CKNTWGSYECSCSGGSLYMREHDTCIGKEAS-TKVSWGYVWAIIFGLVAAGAAGYAFYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLDNQ   PN+V
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQ---PNNV  616



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR+G TYSAC       C+CPPGFKGDG K+CED+DECK+KTACQC +C C
Sbjct  472  INNGGCWKETRSGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTACQCSQCKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCIS-KRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C  GLLY+R++D CI+ K  +   S+W  +WVI++ LG V  G + VYKY
Sbjct  532  KNTWGSYECSCGGGLLYMRENDACIAGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ E+P+HV+
Sbjct  592  RIRRYMDSEIRAIMAQYMPLDNQGEVPSHVA  622



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSAC  +++G C CP GFKGDGK  CEDIDECK+KTACQC EC 
Sbjct  477  EINNGGCWKDTKNGRTYSAC--TDDG-CKCPDGFKGDGKHKCEDIDECKEKTACQCKECK  533

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+R+HDTCISK     ++ W  +WV+  GL       Y VYKY
Sbjct  534  CKNTWGSYECGCSGGLLYMREHDTCISKNGGS-EAGWGFLWVVFFGLVAAGIAGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++ +H
Sbjct  593  RIRRYMDSEIRAIMAQYMPLDNQGDVQSH  621



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCW +T++G TYSACV   +  C CPPGFKGDG  +CEDIDECK+K ACQC  C 
Sbjct  470  EIDNGGCWKKTKDGKTYSACV---DDGCKCPPGFKGDGVNTCEDIDECKEKIACQCSACK  526

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS   LYI++HDTCISK  T  +  W+ +WVI  GL V   GAY VYKY
Sbjct  527  CKNTWGSYDCSCSGDRLYIKEHDTCISKEGT-TEVGWSFLWVIFFGLAVAGMGAYAVYKY  585

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+RSYMD+EIRAIMAQYMPLDNQ E  NH+
Sbjct  586  RIRSYMDSEIRAIMAQYMPLDNQGEASNHI  615



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 112/149 (75%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            Q+NNGGCW ET NG TYSAC       C CP GFKGDG   CEDIDECK++TACQC EC+
Sbjct  775  QINNGGCWKETMNGRTYSACTAD---GCKCPDGFKGDGIHKCEDIDECKERTACQCKECN  831

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WV+  GL  V    Y VYKY
Sbjct  832  CKNTWGSYECGCSGGLLYMKEHDTCISKSAA-AQVGWNFLWVVFFGLAAVGIAGYAVYKY  890

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPL+NQ EIP+H
Sbjct  891  RIRRYMDSEIRAIMAQYMPLENQGEIPSH  919



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+R G TYSACV      C CP GFKGDG K+CED+DECK+KT CQCPEC C
Sbjct  470  INNGGCWRESRGGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKC  529

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKY
Sbjct  530  KNTWGSYECSCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  590  RIRSYMDAEIRGIMAQYMPLESQ  612



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+R G TYSACV      C CP GFKGDG K+CED+DECK+KT CQCPEC C
Sbjct  470  INNGGCWRESRGGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKC  529

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKY
Sbjct  530  KNTWGSYECSCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  590  RIRSYMDAEIRGIMAQYMPLESQ  612



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW E+R G TYSACV      C CP GFKGDG K+CED+DECK+KT CQCPEC C
Sbjct  470  INNGGCWRESRGGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKC  529

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+CSNGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKY
Sbjct  530  KNTWGSYECSCSNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  590  RIRSYMDAEIRGIMAQYMPLESQ  612



>gb|EMS68621.1| Vacuolar-sorting receptor 4 [Triticum urartu]
Length=265

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -2

Query  813  NGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCTC  637
             G  YS+   S +  C CP GF+GDG K C+DIDECK++ ACQCPECSC++TWG YDCTC
Sbjct  120  QGAEYSSPEESGDQNCKCPAGFRGDGVKKCDDIDECKERKACQCPECSCRDTWGGYDCTC  179

Query  636  SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRA  457
            S  LLYI++HDTCISK   Q K+AWAAVW IL+ L +VA G+Y+VYKYRLRSYMD+EIRA
Sbjct  180  SGDLLYIKEHDTCISKTTVQAKAAWAAVWGILVALVIVAAGSYVVYKYRLRSYMDSEIRA  239

Query  456  IMAQYMPLDNQSEIPN  409
            IMAQYMPLD+Q E+PN
Sbjct  240  IMAQYMPLDSQGEVPN  255



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   183 bits (464),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 113/149 (76%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETRNG T+SAC    +G C CP GFKGDG   C D+DECK++TACQC +C 
Sbjct  545  EINNGGCWKETRNGRTHSACT---DGGCKCPDGFKGDGVHKCIDVDECKERTACQCKDCK  601

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C C  GLLY+++HDTCISK A   +  W  +WV+L GL       Y VYKY
Sbjct  602  CKNTWGSYECGCGGGLLYMKEHDTCISKDAG-ARVGWNFLWVVLFGLAAAGIAVYAVYKY  660

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+RSYMD+EIRAIMAQYMPLDNQ EIP+H
Sbjct  661  RIRSYMDSEIRAIMAQYMPLDNQGEIPSH  689



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ET+ G TYSAC+      C CP GF+GDG KSCED+DECK+K ACQCP C 
Sbjct  471  EINNGGCWRETQEGRTYSACIDDHSHGCKCPYGFRGDGVKSCEDVDECKEKLACQCPGCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            C+NTWGSY+C+CS G LY+R+HDTCISK   + + +W +VWVI++GL     G Y +YKY
Sbjct  531  CRNTWGSYECSCSGGSLYMREHDTCISKN-VKTEVSWGSVWVIILGLVAAGAGGYAIYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLDNQ   PN+V
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQ---PNNV  616



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ++R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC 
Sbjct  441  EINNGGCWKDSRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECK  497

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKY
Sbjct  498  CKNTWGSYECGCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKY  556

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++PNH
Sbjct  557  RIRRYMDSEIRAIMAQYMPLDNQGDVPNH  585



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 114/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW E R+G TYSAC  + +G C CP GFKGDG   CEDIDECK+++ACQC EC 
Sbjct  503  EINNGGCWKEARHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERSACQCKECK  559

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y +YKY
Sbjct  560  CKNTWGSYECGCSGGLLYMKEHDTCISKSAA-TEVGWNFLWVIFFGLVVAGIAGYALYKY  618

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ E+PNH
Sbjct  619  RIRRYMDSEIRAIMAQYMPLDNQGEVPNH  647



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 2/151 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T +G TYSAC       C CPPGFKGDG  +CED+DECK+K ACQCPEC 
Sbjct  471  EINNGGCWKGTHDGKTYSACSDDHTKGCKCPPGFKGDGVHTCEDVDECKEKLACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C NGLLY+ +HDTCI    + V S W+ V ++++ L +     Y +YKY
Sbjct  531  CKNTWGSYECSCRNGLLYMHEHDTCIGNIGSTVTS-WSVVKIVILVLAITGIAGYAIYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLDNQ E  +HV+
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGETGSHVA  620



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ++R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC 
Sbjct  476  EINNGGCWKDSRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECK  532

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKY
Sbjct  533  CKNTWGSYECGCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++PNH
Sbjct  592  RIRRYMDSEIRAIMAQYMPLDNQGDVPNH  620



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   182 bits (462),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 114/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW E R+G TYSAC  + +G C CP GFKGDG   CEDIDECK+++ACQC EC 
Sbjct  548  EINNGGCWKEARHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERSACQCKECK  604

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y +YKY
Sbjct  605  CKNTWGSYECGCSGGLLYMKEHDTCISKSAA-TEVGWNFLWVIFFGLVVAGIAGYALYKY  663

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ E+PNH
Sbjct  664  RIRRYMDSEIRAIMAQYMPLDNQGEVPNH  692



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   182 bits (461),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ++R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC 
Sbjct  476  EINNGGCWKDSRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECK  532

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKY
Sbjct  533  CKNTWGSYECGCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++PNH
Sbjct  592  RIRRYMDSEIRAIMAQYMPLDNQGDVPNH  620



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   182 bits (461),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ++R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC 
Sbjct  476  EINNGGCWKDSRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECK  532

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKY
Sbjct  533  CKNTWGSYECGCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++PNH
Sbjct  592  RIRRYMDSEIRAIMAQYMPLDNQGDVPNH  620



>gb|EMS63262.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=864

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 113/162 (70%), Gaps = 17/162 (10%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ETRNG T+SAC    +G C CP GFKGDG   CED+DECK++TACQC EC 
Sbjct  411  EINNGGCWKETRNGLTHSACT---DGGCKCPVGFKGDGVHKCEDVDECKERTACQCKECK  467

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCI-------------SKRATQVKSAWAAVWviligl  532
            CKNTWGSY+C C  GLLY+++HDTCI             S +    +  W  +W +L GL
Sbjct  468  CKNTWGSYECGCGGGLLYMKEHDTCINYLLKAYKVNTFYSGKDAGARVGWNFLWFLLFGL  527

Query  531  gvvaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
              V    Y VYKYR+RSYMD+EIRAIMAQYMPLDNQ EIPNH
Sbjct  528  AAVGIAGYAVYKYRIRSYMDSEIRAIMAQYMPLDNQGEIPNH  569



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ET+ G TYSAC       C+CPPGFKGDG K+CED+DECK+KT CQC  C C
Sbjct  472  INNGGCWKETQLGRTYSACRDDHTNGCSCPPGFKGDGEKTCEDVDECKEKTVCQCAHCKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCIS-KRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSYDC+C  GLLY++ +D CI+ K A+   S+W  +W+I++ LG V  G Y VYKY
Sbjct  532  KNTWGSYDCSCGGGLLYMQAYDACITGKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKY  591

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPL N+ E P HVS
Sbjct  592  RIRRYMDSEIRAIMAQYMPLGNEGEAPGHVS  622



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSAC+      C CPPGFKGDG +SCED+DECK+K ACQCPEC C
Sbjct  472  INNGGCWRETRGVYTYSACLDDHSSGCKCPPGFKGDGVESCEDVDECKEKVACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+C  GL Y+R+HDTCI K    +K +W+ +W++L+         Y +YKYR
Sbjct  532  KNTWGSYECSCGKGLFYLREHDTCIGKFGA-MKLSWSFLWILLLASAAATLTGYAIYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQ  424
            +RSYMD+EIR IMAQYMPLD+Q
Sbjct  591  IRSYMDSEIRTIMAQYMPLDSQ  612



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR G TYSACV      C CP GFKGDG KSCED+DECK+K  CQCP+C C
Sbjct  473  INNGGCWRETRGGFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKKVCQCPDCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C+NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKY
Sbjct  533  KNTWGSYECSCNNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  593  RIRSYMDAEIRGIMAQYMPLESQ  615



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            Q+NNGGCW ET+NG T SAC   E   C CPPGFKGDG KSCEDIDECKDK  CQC +CS
Sbjct  470  QINNGGCWKETKNGKTVSACSNEESKGCKCPPGFKGDGIKSCEDIDECKDKLFCQCKDCS  529

Query  672  CKNTWGSYDCTC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            C+NTWGSY+C+C  + +LY+R+HDTCISK A+     W  +WVI  GL +   GAY VYK
Sbjct  530  CENTWGSYECSCGGSNMLYMREHDTCISKVASS-SVGWGFLWVIFFGLALAGIGAYAVYK  588

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPL+NQ E PN 
Sbjct  589  YRLRSYMDSEIRAIMAQYMPLENQ-ETPNQ  617



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED+DECK+KT CQCPEC C
Sbjct  473  INNGGCWRETRGIYTYSACVDDHSNGCKCPHGFKGDGVKSCEDVDECKEKTVCQCPECKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C+NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y +YKY
Sbjct  533  KNTWGSYECSCNNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGISGYAIYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+R+YMD EIR IMAQYMPL++Q
Sbjct  593  RIRTYMDAEIRGIMAQYMPLESQ  615



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 113/149 (76%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ET NG TYSAC       C CP GFKGDG   CEDIDECK++TACQC EC+
Sbjct  475  EINNGGCWKETMNGRTYSACTAD---GCKCPDGFKGDGIHKCEDIDECKERTACQCKECN  531

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WV+  GL  V   AY VYKY
Sbjct  532  CKNTWGSYECGCSGGLLYMKEHDTCISKSAA-AQVGWNFLWVVFFGLAAVGIAAYAVYKY  590

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPL+NQ EIP++
Sbjct  591  RIRRYMDSEIRAIMAQYMPLENQGEIPSN  619



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            Q+NNGGCW ET+NG T SAC   E   C CPPGFKGDG KSCEDIDECKDK  CQC +CS
Sbjct  470  QINNGGCWKETKNGKTVSACSNEESKGCKCPPGFKGDGIKSCEDIDECKDKLFCQCKDCS  529

Query  672  CKNTWGSYDCTC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            C+NTWGSY+C+C  + +LY+R+HDTCISK A+     W  +WVI  GL +   GAY VYK
Sbjct  530  CENTWGSYECSCGGSNMLYMREHDTCISKVASS-SVGWGFLWVIFFGLALAGIGAYAVYK  588

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPL+NQ E PN 
Sbjct  589  YRLRSYMDSEIRAIMAQYMPLENQ-ETPNQ  617



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ET+ G TYSAC+      C CPPGFKGDG  SCED+DECKDK ACQCP C 
Sbjct  471  EINNGGCWRETQEGKTYSACLDDHSHGCECPPGFKGDGVNSCEDVDECKDKLACQCPGCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRA-TQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+CS+G LY+R+HD CISK   T+V S +  +W I++GL V     Y +YK
Sbjct  531  CKNTWGSYECSCSDGSLYMREHDMCISKNGKTEVSSGF--IWAIILGLVVAGAVGYAIYK  588

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YR+R YMD+EIRAIMAQYMPLDNQ    +H
Sbjct  589  YRIRRYMDSEIRAIMAQYMPLDNQPSNIHH  618



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ++R+G TYSAC  + +G C CP GFKGDG   CEDIDECK++TACQC EC 
Sbjct  578  EINNGGCWKDSRHGRTYSAC--TNDG-CKCPDGFKGDGVHKCEDIDECKERTACQCKECK  634

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK A   +  W  +WVI  GL V     Y VYKY
Sbjct  635  CKNTWGSYECGCSGGLLYMKEHDTCISKNAA-TEVGWNFLWVIFFGLVVAGIAGYAVYKY  693

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++PNH
Sbjct  694  RIRRYMDSEIRAIMAQYMPLDNQGDVPNH  722



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 116/151 (77%), Gaps = 3/151 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T++G  YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQCPEC 
Sbjct  471  EINNGGCWKGTQDGRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGS+DC+C + LLY+ +HDTCISK  ++ + +W  VW I++GL V A  A+ VYKY
Sbjct  531  CKNTWGSFDCSCGSNLLYMHEHDTCISKD-SKSEFSWGLVWTIILGLAVAAVVAFAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLD Q E  NHVS
Sbjct  590  RIRRYMDSEIRAIMAQYMPLD-QGEGANHVS  619



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T+NG TYSAC       C CPPGFKGDG K+CED+DECK+K  CQC +C 
Sbjct  471  EINNGGCWKGTQNGRTYSACRDDHTNGCKCPPGFKGDGEKTCEDVDECKEKVNCQCAQCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C  GLLY+R+HD CISK A+  +  W  +WVI++ LG V  G Y V  Y
Sbjct  531  CKNTWGSYECSCGGGLLYMREHDACISKNASVSEFNWGFMWVIILCLGAVGVGGYAV--Y  588

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
             +R YMD+EIRAIMAQYMPLDNQ EIPNHV
Sbjct  589  NIR-YMDSEIRAIMAQYMPLDNQGEIPNHV  617



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED++ECK+KT CQCP+C C
Sbjct  473  INNGGCWRETRGSYTYSACVDDHSSDCKCPLGFKGDGVKSCEDVNECKEKTGCQCPDCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  593  RIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 110/143 (77%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR   TYSACV      C CP GFKGDG KSCED+DECK+KT CQCP+C C
Sbjct  473  INNGGCWRETRGIFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPDCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +WV++IG+ V     Y VYKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSGKVGTTKLSWSFLWVLIIGVAVAGLSGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  593  RIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 114/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSAC  +++G C CP GFKGDG+  CEDIDECK++T CQC EC 
Sbjct  474  EINNGGCWKDTKNGRTYSAC--NDDG-CKCPDGFKGDGRHKCEDIDECKERTVCQCKECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKY
Sbjct  531  CKNTWGSYECGCSGGLLYMKEHDTCISKSGAS-EAGWGFLWVIFFGLVAAGVAGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++ +H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGDVQSH  618



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 114/149 (77%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSAC  +++G C CP GFKGDG+  CEDIDECK++T CQC EC 
Sbjct  474  EINNGGCWKDTKNGRTYSAC--NDDG-CKCPDGFKGDGRHKCEDIDECKERTVCQCKECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK     ++ W  +WVI  GL       Y VYKY
Sbjct  531  CKNTWGSYECGCSGGLLYMKEHDTCISKSGAS-EAGWGFLWVIFFGLVAAGVAGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPLDNQ ++ +H
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGDVQSH  618



>ref|XP_009125234.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=625

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED+DECK+K  CQCPEC C
Sbjct  473  INNGGCWRETRGSYTYSACVDDHSNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +W ++I +GV     Y  YKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+R YMD EIR IMAQYMPL++Q
Sbjct  593  RIRRYMDAEIRGIMAQYMPLESQ  615



>emb|CDX67539.1| BnaA07g15790D [Brassica napus]
Length=625

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED+DECK+K  CQCPEC C
Sbjct  473  INNGGCWRETRGSYTYSACVDDHSNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +W ++I +GV     Y  YKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+R YMD EIR IMAQYMPL++Q
Sbjct  593  RIRRYMDAEIRGIMAQYMPLESQ  615



>emb|CDY13344.1| BnaC06g14130D [Brassica napus]
Length=625

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED+DECK+K  CQCPEC C
Sbjct  473  INNGGCWRETRGSYTYSACVDDHSNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +W ++I +GV     Y  YKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+R YMD EIR IMAQYMPL++Q
Sbjct  593  RIRRYMDAEIRGIMAQYMPLESQ  615



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR   TYSACV      C CP GFKGDG KSCED+DECK+KT CQCP+C C
Sbjct  473  INNGGCWRETRGLFTYSACVDDHSKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPDCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  593  RIRSYMDAEIRGIMAQYMPLESQ  615



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   179 bits (453),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 111/150 (74%), Gaps = 4/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW E++ G TYSAC       C CP GF+GDG   CEDI+EC +K ACQCP+CS
Sbjct  475  EINNGGCWKESQYGRTYSACTDDYRNGCKCPAGFRGDGVNGCEDINECAEKLACQCPDCS  534

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C   LLYI +HDTCISK A   + +W  +WVI++GL V     Y +YKY
Sbjct  535  CKNTWGSYECSCGGQLLYIHEHDTCISKDAANSEVSWGVMWVIILGLTVAGVAGYALYKY  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLDNQ   PNH+
Sbjct  595  RIRRYMDSEIRAIMAQYMPLDNQ---PNHM  621



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score =   179 bits (453),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR   TYSACV      C CP GFKGDG K+CED+DECK+KT CQCP+C C
Sbjct  473  INNGGCWRETRGVFTYSACVDDHSKDCKCPHGFKGDGVKNCEDVDECKEKTVCQCPDCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C+NGLLY+R+HDTCI S +    K +W+ +W+++IG+GV     Y VYKY
Sbjct  533  KNTWGSYECSCNNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGIGVAGLSGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  593  RIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T++G  YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQCP C 
Sbjct  471  EINNGGCWKGTQDGRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCPACK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGS+DC+C   LLY+ +HDTCISK  ++ + +W  VW I++GL V     Y VYKY
Sbjct  531  CKNTWGSFDCSCGGNLLYMHEHDTCISKD-SKSEFSWGLVWTIILGLAVAVVVGYAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            R+R YMD+EIRAIMAQYMPLD Q E  NHVS
Sbjct  590  RIRRYMDSEIRAIMAQYMPLD-QGEGANHVS  619



>gb|ACR34782.1| unknown [Zea mays]
Length=317

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCW ET++G T SAC       C CP GFKGDG KSCEDIDEC++K  CQC  CS
Sbjct  160  EISNGGCWQETKDGKTISACSNEISEGCKCPMGFKGDGEKSCEDIDECQEKLYCQCKGCS  219

Query  672  CKNTWGSYDCTCS-NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+C  + +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYK
Sbjct  220  CKNTWGSYECSCGDDNMLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYK  279

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPLDNQ     H
Sbjct  280  YRLRSYMDSEIRAIMAQYMPLDNQEGANQH  309



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 107/145 (74%), Gaps = 2/145 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T++G TYSAC       C CPPGFKGDG + CED+DECK+K ACQCPEC 
Sbjct  471  EINNGGCWKGTQDGRTYSACSDDHTEGCKCPPGFKGDGIRKCEDVDECKEKLACQCPECK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            C+NTWGSYDC+C NGLLY+ +HDTCI      V S W+ V + ++ L +     + VYKY
Sbjct  531  CQNTWGSYDCSCRNGLLYMHEHDTCIGNIGNTVTS-WSVVKITILVLAITGITGFAVYKY  589

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSE  418
            R+R YMD+EIRAIMAQYMPLDNQ E
Sbjct  590  RIRRYMDSEIRAIMAQYMPLDNQGE  614



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            Q+NNGGCW ETRNG T SAC   E   C CPPGFKGDG  SCEDIDECKDK  CQC +C+
Sbjct  474  QINNGGCWKETRNGKTVSACSNEESKGCKCPPGFKGDGINSCEDIDECKDKLFCQCKDCT  533

Query  672  CKNTWGSYDCTC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            C NTWGSY+C+C  N +LY+R+HDTCISK  +     W  +WVI  GL +   GAY VYK
Sbjct  534  CDNTWGSYECSCGGNNMLYMREHDTCISKVGSS-SVGWGFLWVIFFGLALAGVGAYAVYK  592

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPL+NQ     H
Sbjct  593  YRLRSYMDSEIRAIMAQYMPLENQETQNQH  622



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGK-SCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+NG TYSAC  +++G C CP GFKGDGK  CED+DECK++T CQC EC 
Sbjct  473  EINNGGCWKDTKNGRTYSAC--TDDG-CRCPDGFKGDGKHKCEDVDECKERTVCQCEECR  529

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCISK     ++ W  +WV++ GL       Y VYKY
Sbjct  530  CKNTWGSYECGCSGGLLYMKEHDTCISKNGAS-EAGWGFLWVVVFGLVAAGIAGYAVYKY  588

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+R YMD+EIRAIMAQYMPLD+Q ++ +H 
Sbjct  589  RIRRYMDSEIRAIMAQYMPLDSQGDVQSHA  618



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED++ECK+KT CQC +C C
Sbjct  473  INNGGCWRETRGSYTYSACVDDHSSDCKCPLGFKGDGVKSCEDVNECKEKTVCQCADCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+RSYMD EIR IMAQYMPL++Q
Sbjct  593  RIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ET++G T SAC       C CP GFKGDG KSCEDIDECKDK  CQC  CS
Sbjct  472  EINNGGCWQETKDGKTISACSNEVSEGCKCPVGFKGDGEKSCEDIDECKDKLYCQCKGCS  531

Query  672  CKNTWGSYDCTCS-NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+C  + +LY+R+HDTCISK+ T     W+ +WVI  GL     GAY VYK
Sbjct  532  CKNTWGSYECSCGDDNMLYMREHDTCISKKGTTSTVGWSFLWVIFFGLVFAGVGAYAVYK  591

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPLDNQ     H
Sbjct  592  YRLRSYMDSEIRAIMAQYMPLDNQEGANQH  621



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR  +TYSACV      C CP GFKGDG KSCED++ECK+K  CQCP+C C
Sbjct  473  INNGGCWRETRGSYTYSACVDDHSSDCKCPLGFKGDGVKSCEDVNECKEKKVCQCPDCKC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCI-SKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            KNTWGSY+C+C NGLLY+R+HDTCI S +    K +W+ +WV++IG+GV     Y VYKY
Sbjct  533  KNTWGSYECSCKNGLLYMREHDTCIGSSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ  424
            R+R+YMD EIR IMAQYMPL++Q
Sbjct  593  RIRTYMDAEIRGIMAQYMPLESQ  615



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 108/148 (73%), Gaps = 5/148 (3%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR G+TYSAC       C CPPGFKGDG KSCED+DECK+K ACQCPEC C
Sbjct  470  INNGGCWRETRGGYTYSACTDDHSSVCKCPPGFKGDGVKSCEDVDECKEKLACQCPECKC  529

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+CTC  GL Y+R+ DTCI      VK  W+ V ++L+ L       Y +YKYR
Sbjct  530  KNTWGSYECTCRKGLFYLRELDTCIGAFGA-VKLGWSFVLILLLALTAATLSGYAIYKYR  588

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            +R YMD+EIR+IMAQYMPLD+Q   PN+
Sbjct  589  IRHYMDSEIRSIMAQYMPLDSQ---PNN  613



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 108/148 (73%), Gaps = 5/148 (3%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR G+TYSAC       C CPPGFKGDG KSCED+DECK+K ACQCPEC C
Sbjct  470  INNGGCWRETRGGYTYSACTDDHSSVCKCPPGFKGDGVKSCEDVDECKEKLACQCPECKC  529

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+CTC  GL Y+R+ DTCI      VK  W+ V ++L+ L       Y +YKYR
Sbjct  530  KNTWGSYECTCRKGLFYLRELDTCIGAFGA-VKLGWSFVLILLLALTAATLSGYAIYKYR  588

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            +R YMD+EIR+IMAQYMPLD+Q   PN+
Sbjct  589  IRHYMDSEIRSIMAQYMPLDSQ---PNN  613



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW + ++G ++SACV +    C CPPGF+GDG  +CED+DEC++K ACQCPEC C
Sbjct  472  INNGGCWKKIQDGKSFSACVENSLHGCKCPPGFRGDGVNNCEDVDECEEKLACQCPECKC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            K+TWGSY+C+C +GLLY+++HDTCISK   + +++W  VW++++GL       Y  YKYR
Sbjct  532  KDTWGSYECSCGSGLLYMQEHDTCISKD-VRSEASWGFVWMVILGLAATGVAGYAFYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEI  415
            +R YMD+EIRAIMAQYMPLD+Q+E+
Sbjct  591  IRRYMDSEIRAIMAQYMPLDSQAEV  615



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 110/151 (73%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR   +YSAC+      C CPPGF+GDG  SCED+DECK+K ACQCPEC C
Sbjct  473  INNGGCWKETRGSRSYSACIDGHTKGCKCPPGFRGDGANSCEDVDECKEKLACQCPECQC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS+GL Y R++D CI K A  +      VW++++ LG+   G Y  YKYR
Sbjct  533  KNTWGSYECSCSDGLFYARENDMCIGKYAASMAGG-GIVWLVILVLGIAGTGVYAFYKYR  591

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            ++ YMD+EIRAIMAQYMPLDNQ EI +   +
Sbjct  592  IQRYMDSEIRAIMAQYMPLDNQPEISSQAHE  622



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 110/151 (73%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR   +YSAC+      C CPPGF+GDG  SCED+DECK+K ACQCPEC C
Sbjct  471  INNGGCWKETRGSRSYSACIDGHTKGCKCPPGFRGDGANSCEDVDECKEKLACQCPECQC  530

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS+GL Y R++D CI K A  +      VW++++ LG+   G Y  YKYR
Sbjct  531  KNTWGSYECSCSDGLFYARENDMCIGKYAASMAGG-GIVWLVILVLGIAGTGVYAFYKYR  589

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            ++ YMD+EIRAIMAQYMPLDNQ EI +   +
Sbjct  590  IQRYMDSEIRAIMAQYMPLDNQPEISSQAHE  620



>ref|XP_010252052.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=495

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW +T++G T+SAC   +   C CPPGFKGDG  +CED++ECK+K ACQCPEC C
Sbjct  343  INNGGCWKKTQDGKTFSACTEGQSKGCKCPPGFKGDGVNTCEDVNECKEKLACQCPECIC  402

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+R+HDTCISK+ T     W  V VI++ L  +  G Y VYKYR
Sbjct  403  KNTWGSYECSCSGNLLYMREHDTCISKQGTST-MGWNIVGVIVLALAAIGVGGYAVYKYR  461

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLD+Q +  + V+
Sbjct  462  IRRYMDSEIRAIMAQYMPLDSQGDNFSRVT  491



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ET NG TYSAC       C CP GFKGDG   CEDIDECK++TACQC EC+
Sbjct  492  EINNGGCWKETMNGRTYSACTAD---GCKCPDGFKGDGIHKCEDIDECKERTACQCKECN  548

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C CS GLLY+++HDTCIS+ A   +  W  +WVI  GL       Y VYKY
Sbjct  549  CKNTWGSYECGCSGGLLYMKEHDTCISESAA-AQVGWNFLWVIFFGLAAAGIAGYAVYKY  607

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            R+R YMD+EIRAIMAQYMPL+NQ +I +H
Sbjct  608  RIRRYMDSEIRAIMAQYMPLENQGDIHSH  636



>ref|NP_001050034.1| Os03g0335300 [Oryza sativa Japonica Group]
 gb|ABF95810.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11948.1| Os03g0335300 [Oryza sativa Japonica Group]
 dbj|BAG93773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00476.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75202.1| hypothetical protein OsI_11454 [Oryza sativa Indica Group]
 gb|EEE59012.1| hypothetical protein OsJ_10747 [Oryza sativa Japonica Group]
Length=628

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++ NGGCW ETRNG T SAC       C CPPGFKGDG KSCEDIDECK+K  CQC  CS
Sbjct  471  EIKNGGCWKETRNGKTISACSNEVSEGCKCPPGFKGDGIKSCEDIDECKEKLYCQCKGCS  530

Query  672  CKNTWGSYDCTC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            C+NTWGSY+C+C  N +LY+R+HDTC+SK AT     W+ +WVI  GL +   GAY VYK
Sbjct  531  CENTWGSYECSCGGNNMLYMREHDTCLSKEATSA-VGWSFLWVIFFGLVLAGVGAYAVYK  589

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPLDNQ     H
Sbjct  590  YRLRSYMDSEIRAIMAQYMPLDNQEAANQH  619



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCWH+ R+GH YSAC+    GKC CPPGFKGDG K+CEDIDECK+K ACQCPECS
Sbjct  476  KINNGGCWHDARDGHAYSACLDDGNGKCQCPPGFKGDGVKNCEDIDECKEKKACQCPECS  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+CTCS  LLYIRDHDTCISK  T+V+S+WAAVWVILIGL + +GGAYL+YKY
Sbjct  536  CKNTWGSYECTCSGDLLYIRDHDTCISKSGTEVRSSWAAVWVILIGLAMASGGAYLIYKY  595

Query  492  RLR  484
            RLR
Sbjct  596  RLR  598



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 116/153 (76%), Gaps = 6/153 (4%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T  G TYSACV   E  C CPPGFKGDG   CED+DECK+KTACQC  C 
Sbjct  472  EINNGGCWKKTHEGKTYSACV---EDGCKCPPGFKGDGINKCEDVDECKEKTACQCSGCK  528

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C   LLY+++HDTCISK+A+  +  W+ +WVIL GL +   G Y VYKY
Sbjct  529  CKNTWGSYECSCGGDLLYMKEHDTCISKKAS-TEVGWSFLWVILFGLVIAGIGGYAVYKY  587

Query  492  RLRSYMDTEIRAIMAQYMPLDNQ-SEIPNHVSD  397
            R+RSYMD+EIRAIMAQYMPLDNQ  +I  H  D
Sbjct  588  RIRSYMDSEIRAIMAQYMPLDNQEGQIHVHHGD  620



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++ NGGCW E RNG T SAC       C CPPGF+GDG KSCEDIDECKDK  CQC  CS
Sbjct  473  EIKNGGCWKEARNGKTISACSNEVSEGCKCPPGFRGDGIKSCEDIDECKDKLYCQCKGCS  532

Query  672  CKNTWGSYDCTC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            C+NTWGSY+C+C  N +LY+R+HDTC+SK AT     W+ +WVI  GL +   GAY VYK
Sbjct  533  CENTWGSYECSCGGNNMLYMREHDTCLSKEATST-VGWSFLWVIFFGLALAGVGAYAVYK  591

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPLDNQ E PN 
Sbjct  592  YRLRSYMDSEIRAIMAQYMPLDNQ-EAPNQ  620



>ref|XP_002992389.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
 gb|EFJ06539.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
Length=628

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCWH+TR+G  +SAC  +    C CP GF+GDG   CED+DECK K ACQC EC 
Sbjct  476  KIDNGGCWHDTRDGVRHSACQETHTKGCECPAGFRGDGVNQCEDVDECKSKLACQCKECH  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC C   LLYI++HDTCISK +   +  W+A + IL GL VV    Y++YKY
Sbjct  536  CKNTWGSYDCQCDGNLLYIKEHDTCISKISV-TRVGWSATFFILAGLAVVGAVGYVIYKY  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            R+RSYMD+EIRAIMAQYMPLD+Q+E+  H+ +
Sbjct  595  RIRSYMDSEIRAIMAQYMPLDSQNEVHRHLEE  626



>ref|XP_002967764.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
 gb|EFJ31111.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
Length=628

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCWH+TR+G  +SAC  +    C CP GF+GDG   CED+DECK K ACQC EC 
Sbjct  476  KIDNGGCWHDTRDGVRHSACQETHTKGCECPAGFRGDGVNQCEDVDECKSKLACQCKECH  535

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC C   LLYI++HDTCISK +   +  W+A + IL GL VV    Y++YKY
Sbjct  536  CKNTWGSYDCQCDGNLLYIKEHDTCISKISV-TRVGWSATFFILAGLAVVGAVGYVIYKY  594

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            R+RSYMD+EIRAIMAQYMPLD+Q+E+  H+ +
Sbjct  595  RIRSYMDSEIRAIMAQYMPLDSQNEVHRHLEE  626



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T+NG  YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQC EC 
Sbjct  469  EINNGGCWKGTQNGRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCAECK  528

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+C+  LLY+ +HDTCISK A + + +W  VW I++GL V    AY VYKY
Sbjct  529  CKNTWGSYDCSCNANLLYMHEHDTCISKDA-KSEFSWGLVWTIILGLAVAGVSAYAVYKY  587

Query  492  RLRSYMDTEIRAIMAQYMPLD  430
            R+R YMD+EIRAIMAQYMPLD
Sbjct  588  RIRRYMDSEIRAIMAQYMPLD  608



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW +T++G T+SAC   +   C CPPGFKGDG  +CED++ECK+K ACQCPEC C
Sbjct  472  INNGGCWKKTQDGKTFSACTEGQSKGCKCPPGFKGDGVNTCEDVNECKEKLACQCPECIC  531

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLY+R+HDTCISK+ T     W  V VI++ L  +  G Y VYKYR
Sbjct  532  KNTWGSYECSCSGNLLYMREHDTCISKQGTST-MGWNIVGVIVLALAAIGVGGYAVYKYR  590

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVS  400
            +R YMD+EIRAIMAQYMPLD+Q +  + V+
Sbjct  591  IRRYMDSEIRAIMAQYMPLDSQGDNFSRVT  620



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 108/148 (73%), Gaps = 5/148 (3%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ETR G+TYSAC       C CPPGF+GDG KSCED+DECK+K ACQCPEC C
Sbjct  470  INNGGCWRETRGGYTYSACTDDHSSVCKCPPGFRGDGVKSCEDVDECKEKLACQCPECKC  529

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+C  GL Y+R+ DTCI      VK  W+ V ++L+ L       Y +YKYR
Sbjct  530  KNTWGSYECSCRKGLFYLRELDTCIGAFGA-VKLGWSFVLILLLALIAATLSGYAIYKYR  588

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            +R YMD+EIR+IMAQYMPLD+Q   PN+
Sbjct  589  IRHYMDSEIRSIMAQYMPLDSQ---PNN  613



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 110/150 (73%), Gaps = 4/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            + NNGGCW ET+ G TYSAC+      C CPPGFKGDG   CED+DECK+K ACQCP C 
Sbjct  471  EFNNGGCWRETQEGKTYSACLDDHSHGCKCPPGFKGDGVNGCEDVDECKEKLACQCPGCK  530

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRA-TQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+C +G LY+R+HD CISK   T+V S +  +W I++GL V     Y +YK
Sbjct  531  CKNTWGSYECSCCDGSLYMREHDMCISKNGKTEVSSGF--IWAIILGLVVAGAVGYAIYK  588

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YR+R YMD+EIRAIMAQYMPLDNQ    +H
Sbjct  589  YRIRRYMDSEIRAIMAQYMPLDNQPSNIHH  618



>emb|CDY38158.1| BnaA07g02250D [Brassica napus]
Length=302

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  T+ G TYSAC       C CPPGFK DG K+CED++EC++KTACQC  C C
Sbjct  151  INNGGCWKHTQMGRTYSACRDDHSKGCKCPPGFKRDGLKNCEDVNECEEKTACQCRGCKC  210

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIR+HD CISK A +   +W  +W+IL+GLG  A GAY VYKYR
Sbjct  211  KNTWGSYECSCSGSLLYIREHDICISKDA-RGDVSWGVIWIILMGLGAAALGAYTVYKYR  269

Query  489  LRSYMDTEIRAIMAQYMPLDNQ  424
            +R+YMD+EIRAIMAQYMPLDN 
Sbjct  270  IRTYMDSEIRAIMAQYMPLDNH  291



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 109/144 (76%), Gaps = 2/144 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCW ET++G T SAC   E   C CP GFKGDG KSCEDIDECK+K  CQC  CS
Sbjct  471  EISNGGCWQETKDGKTISACSNEEPDGCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCS  530

Query  672  CKNTWGSYDCTCSNG-LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+C +  +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYK
Sbjct  531  CKNTWGSYECSCGDDKMLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYK  590

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQ  424
            YRLRSYMD+EIRAIMAQYMPLDNQ
Sbjct  591  YRLRSYMDSEIRAIMAQYMPLDNQ  614



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 109/144 (76%), Gaps = 2/144 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCW ET++G T SAC   E   C CP GFKGDG KSCEDIDECK+K  CQC  CS
Sbjct  497  EISNGGCWQETKDGKTISACSNEEPDGCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCS  556

Query  672  CKNTWGSYDCTCSNG-LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+C +  +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYK
Sbjct  557  CKNTWGSYECSCGDDKMLYMREHDTCISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYK  616

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQ  424
            YRLRSYMD+EIRAIMAQYMPLDNQ
Sbjct  617  YRLRSYMDSEIRAIMAQYMPLDNQ  640



>ref|XP_001777810.1| predicted protein [Physcomitrella patens]
 gb|EDQ57348.1| predicted protein [Physcomitrella patens]
Length=626

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++N GCW E R   T+SAC  S+   C CP GF+GDG K C DIDECK+K+ CQCPEC 
Sbjct  473  KVDNAGCWQEKRGDITFSACHESQSKGCQCPRGFRGDGIKECIDIDECKEKSKCQCPECM  532

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            C N WG YDC CS  LLYIR+HDTCISK++   K  WA   ++ +G+  +    Y+VYKY
Sbjct  533  CTNKWGDYDCGCSKDLLYIREHDTCISKKSQSSKLGWAVSLIVFLGVASLGVVGYVVYKY  592

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            RLRSYMD+EIRAIMAQYMPLD+ SE+ +H+++
Sbjct  593  RLRSYMDSEIRAIMAQYMPLDSSSEVNHHLTE  624



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 6/150 (4%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ++  G TYSACV  +EG C CP GFKGDG   CED+DECK+KTACQC  C 
Sbjct  473  EINNGGCWKKSHEGKTYSACV--DEG-CKCPLGFKGDGVDKCEDVDECKEKTACQCSGCK  529

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C+C + LLYI++HDTCISK+ +  +  W+ +WVI  GL +   GAY +YKY
Sbjct  530  CKNTWGSYECSCGDDLLYIKEHDTCISKKPS-TEVGWSFLWVIFFGLVIAGVGAYAIYKY  588

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R+RSYMD+EIRAIMAQYMPLDNQ E  NH+
Sbjct  589  RIRSYMDSEIRAIMAQYMPLDNQ-EAQNHI  617



>ref|XP_010228654.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=627

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 111/145 (77%), Gaps = 4/145 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ET+NG T SAC   E   C CP GFKGDG KSCEDIDECK KTACQC  CS
Sbjct  469  EINNGGCWKETKNGKTISACSHEESNGCKCPEGFKGDGIKSCEDIDECKMKTACQCTGCS  528

Query  672  CKNTWGSYDCTCSNG--LLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvY  499
            C+NTWGSY+C+C+ G  +LY+R+ DTCISK+A      W+ +WVI  GL     GAY VY
Sbjct  529  CENTWGSYECSCAGGDSMLYMREQDTCISKQAVS-SVGWSFMWVIFFGLVFAGVGAYAVY  587

Query  498  KYRLRSYMDTEIRAIMAQYMPLDNQ  424
            KYRLRSYMD+EIRAIMAQYMPLD+Q
Sbjct  588  KYRLRSYMDSEIRAIMAQYMPLDSQ  612



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   173 bits (439),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 107/151 (71%), Gaps = 2/151 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ET+   +YSAC+      C CPPGF+GDG  SCED+DECK+K  CQCPEC C
Sbjct  473  INNGGCWKETQGSRSYSACIDDHTKGCKCPPGFRGDGVHSCEDVDECKEKLVCQCPECQC  532

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+CTCS+ L Y R++D CI K A  V      VW++++ LG+     Y  YKYR
Sbjct  533  KNTWGSYECTCSDDLFYTRENDMCIGKYAASVAGG-GIVWMVILVLGIAGTSGYAFYKYR  591

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHVSD  397
            ++ YMD+EIRAIMAQYMPLDNQ EI +   +
Sbjct  592  IQRYMDSEIRAIMAQYMPLDNQPEISSQAHE  622



>ref|XP_007140077.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
 gb|ESW12071.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
Length=619

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
             NNGGCW  ++ G  Y+AC+      CTCPPGF+GDG KSCEDIDEC++KTACQCP C C
Sbjct  471  FNNGGCWKGSQGGKAYTACLDDYRKGCTCPPGFRGDGVKSCEDIDECQEKTACQCPSCKC  530

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C C +GL Y R++DTC+   +    ++  ++W+I++ + V   G Y  YKYR
Sbjct  531  KNTWGSYECKCGSGLFYSRENDTCLGAYS----ASGVSIWMIMLIVVVAVSGGYAFYKYR  586

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            ++ YMD+EIRAIMAQYMPLDNQ ++PN V
Sbjct  587  IQRYMDSEIRAIMAQYMPLDNQPDVPNQV  615



>gb|EPS73119.1| hypothetical protein M569_01632, partial [Genlisea aurea]
Length=636

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 23/171 (13%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW +T+ G TYSACV  +   C CPPGFKGDG  +C+DIDECK+K+ACQC EC+
Sbjct  466  EINNGGCWKDTKGGRTYSACVNDQTKGCYCPPGFKGDGVNTCDDIDECKEKSACQCSECN  525

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKS----------------------AWA  559
            CKNT+GSY+C+CS  LLY+ + DTCISK    + S                      +W+
Sbjct  526  CKNTYGSYECSCSKNLLYLHEQDTCISKHKKVIVSLSFIIHILTTVVCIAGKAGSGPSWS  585

Query  558  AVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
              WV+++ +  V    Y VYKYR+R YMD+EIRAIMAQYMPLDN+ E+ NH
Sbjct  586  VAWVVILAMAAVGLAGYTVYKYRIRRYMDSEIRAIMAQYMPLDNEGEMRNH  636



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW   R G  YSAC+      C CPPGF+GDG  SC+D+DECK+K ACQCPEC+C
Sbjct  474  VNNGGCWKGARGGRAYSACIDDRTKGCKCPPGFRGDGVHSCKDVDECKEKLACQCPECNC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C C+NGL Y+R+ D CI K +  V S    +W++++ LG      Y+ YKYR
Sbjct  534  KNTWGSYECRCNNGLFYVRESDMCIGKYSASVSSG-GFIWLVILLLGTCGAVGYVFYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            ++ YMD EIRAIMAQYMPLDNQ E  N V
Sbjct  593  IQRYMDDEIRAIMAQYMPLDNQPEHTNQV  621



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW  T+N   YSAC+      C CPPGFKGDG  SCEDIDECK+K ACQC EC 
Sbjct  469  EINNGGCWKGTQNSRAYSACIDDHTKGCKCPPGFKGDGVNSCEDIDECKEKLACQCAECK  528

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSYDC+CS  LLY+ +HDTCISK A + + +W  VW I++GL V    AY VYKY
Sbjct  529  CKNTWGSYDCSCSANLLYMHEHDTCISKDA-KSEFSWGLVWTIILGLAVAGVSAYAVYKY  587

Query  492  RLRSYMDTEIRAIMAQYMPL  433
            R+R YMD+EIRAIMAQYMPL
Sbjct  588  RIRRYMDSEIRAIMAQYMPL  607



>ref|NP_001292791.1| vacuolar sorting receptor homolog1 precursor [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            +++NGGCW ET++G T SAC       C CP GFKGDG KSCEDIDEC++K  CQC  CS
Sbjct  472  EISNGGCWQETKDGKTISACSNEISEGCKCPMGFKGDGEKSCEDIDECQEKLYCQCKGCS  531

Query  672  CKNTWGSYDCTCS-NGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            CKNTWGSY+C+C  + +LY+R+HDTCISK  T     W+ +WVI  GL     GAY VYK
Sbjct  532  CKNTWGSYECSCGDDNMLYMREHDTCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYK  591

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YRLRSYMD+EIRAIMAQYMPLDNQ     H
Sbjct  592  YRLRSYMDSEIRAIMAQYMPLDNQEGANQH  621



>ref|XP_003552313.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=619

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 108/150 (72%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            Q NNGGCW   + G  YSAC+      CTCPPGF+GDG +SCEDIDECK+KTACQCP C 
Sbjct  470  QFNNGGCWKGVQGGRAYSACLDDYRKGCTCPPGFRGDGVQSCEDIDECKEKTACQCPGCK  529

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C C +GL Y R++DTC  + +  V +    +WVI++ L V   G Y  YKY
Sbjct  530  CKNTWGSYECKCKSGLFYSRENDTCFGEYSASVLN----IWVIILVLVVAVAGGYAFYKY  585

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R++ YMD+EIRAIMAQYMPLDNQ E+ N V
Sbjct  586  RIQRYMDSEIRAIMAQYMPLDNQPEVSNQV  615



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  T+ G TYSAC       C CPPGFKGDG K+CED++EC++KTACQC  C C
Sbjct  484  INNGGCWKHTQMGRTYSACRDDHSKGCKCPPGFKGDGLKNCEDVNECEEKTACQCRGCKC  543

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIR+HD CISK A +   +W  +W+IL+GLG  A GAY VYKYR
Sbjct  544  KNTWGSYECSCSGSLLYIREHDICISKDA-RGDVSWGVIWIILMGLGAAALGAYTVYKYR  602

Query  489  LRSYMDTEIRAIMAQYMPLDNQ  424
            +R+YMD+EIRAIMAQYMPLDN 
Sbjct  603  IRTYMDSEIRAIMAQYMPLDNH  624



>gb|KHN40635.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=618

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 108/150 (72%), Gaps = 5/150 (3%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            Q NNGGCW   + G  YSAC+      CTCPPGF+GDG +SCEDIDECK+KTACQCP C 
Sbjct  469  QFNNGGCWKGVQGGRAYSACLDDYRKGCTCPPGFRGDGVQSCEDIDECKEKTACQCPGCK  528

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKY  493
            CKNTWGSY+C C +GL Y R++DTC  + +  V +    +WVI++ L V   G Y  YKY
Sbjct  529  CKNTWGSYECKCKSGLFYSRENDTCFGEYSASVLN----IWVIILVLVVAVAGGYAFYKY  584

Query  492  RLRSYMDTEIRAIMAQYMPLDNQSEIPNHV  403
            R++ YMD+EIRAIMAQYMPLDNQ E+ N V
Sbjct  585  RIQRYMDSEIRAIMAQYMPLDNQPEVSNQV  614



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW  T+ G TYSAC       C CPPGFKGDG K+CED++EC++KTACQC  C C
Sbjct  476  INNGGCWKHTQMGRTYSACRDDHSKGCKCPPGFKGDGLKNCEDVNECEEKTACQCRGCKC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIR+HD CISK A +   +W  +W+I++GLG  A GAY VYKYR
Sbjct  536  KNTWGSYECSCSGSLLYIREHDICISKDA-RGDVSWGVIWIIVMGLGAAALGAYTVYKYR  594

Query  489  LRSYMDTEIRAIMAQYMPLDNQ  424
            +R+YMD+EIRAIMAQYMPLDN 
Sbjct  595  IRTYMDSEIRAIMAQYMPLDNH  616



>gb|AAF80450.1|AF161719_1 vacuolar targeting receptor bp-80 [Triticum aestivum]
Length=624

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            ++NNGGCW ET+NG T SAC   E   C CP GFKGDG KSCEDIDECK K+ACQC  CS
Sbjct  467  EINNGGCWKETKNGKTISACSHEESEGCKCPQGFKGDGVKSCEDIDECKAKSACQCNGCS  526

Query  672  CKNTWGSYDCTC-SNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYK  496
            C+NTWGSY+C+C  N +LY+R+ DTCISK+A      W+ +WVI  GL     GAY VYK
Sbjct  527  CENTWGSYECSCGGNNMLYMREQDTCISKQAAS-SVGWSFMWVIFFGLVFAGVGAYAVYK  585

Query  495  YRLRSYMDTEIRAIMAQYMPLDNQ  424
            YRLRSYMD+EIRAIMAQYMPLD+Q
Sbjct  586  YRLRSYMDSEIRAIMAQYMPLDSQ  609



>ref|XP_010260770.1| PREDICTED: vacuolar-sorting receptor 7 [Nelumbo nucifera]
 ref|XP_010260771.1| PREDICTED: vacuolar-sorting receptor 7 [Nelumbo nucifera]
Length=623

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDGKSCEDIDECKDKTACQCPECSCK  667
            +NNGGCW +TRNG T+SAC  SE   C CPPGF+GDG +CEDI+ECK+  ACQC  C+CK
Sbjct  472  MNNGGCWTDTRNGKTFSACSESEVKGCHCPPGFQGDGHTCEDINECKEGLACQCDGCTCK  531

Query  666  NTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYRL  487
            NTWGSYDC C   LLYI D DTCI++ ++  K AW   +++L  +       Y+ YKYRL
Sbjct  532  NTWGSYDCKCKGDLLYIMDQDTCIARNSS--KYAWFLTFLVLACIAGAGLAGYIFYKYRL  589

Query  486  RSYMDTEIRAIMAQYMPLDNQ  424
            RSYMD+EI AIM+QYMPLDNQ
Sbjct  590  RSYMDSEIMAIMSQYMPLDNQ  610



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW +T+ G TYSAC       C CPPGFKGDG K C+D++EC++KTACQC +C C
Sbjct  474  INNGGCWKQTQMGKTYSACRDDHSKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIR+HD CI+K A +   +W  +W+I +GL   A GAY +YKYR
Sbjct  534  KNTWGSYECSCSGSLLYIREHDICINKDA-RGDVSWGVIWIIFMGLSAAALGAYTIYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDN  427
            +R+YMD+EIRAIMAQYMPLDN
Sbjct  593  IRTYMDSEIRAIMAQYMPLDN  613



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW +T+ G TYSAC       C CPPGFKGDG K C+D++EC++KTACQC +C C
Sbjct  474  INNGGCWKQTQMGKTYSACRDDHSKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIR+HD CI+K A +   +W  +W+I +GL   A GAY +YKYR
Sbjct  534  KNTWGSYECSCSGSLLYIREHDICINKDA-RGDVSWGVIWIIFMGLSAAALGAYTIYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDN  427
            +R+YMD+EIRAIMAQYMPLDN
Sbjct  593  IRTYMDSEIRAIMAQYMPLDN  613



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW +T+ G TYSAC       C CPPGFKGDG K C+D++EC++KTACQC +C C
Sbjct  474  INNGGCWKQTQMGKTYSACRDDHSKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIR+HD CI+K A +   +W  +W+I +GLG  A GAY +YKYR
Sbjct  534  KNTWGSYECSCSGSLLYIREHDICINKDA-RGDVSWGVIWIIFMGLGAAALGAYTIYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDN  427
            +R+YMD+EIRAIMAQYMPLDN
Sbjct  593  IRTYMDSEIRAIMAQYMPLDN  613



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW +T+ G TYSAC       C CPPGFKGDG K+C D++EC++KTACQC  C C
Sbjct  476  INNGGCWKQTQMGRTYSACRDDHSKGCKCPPGFKGDGLKNCTDVNECEEKTACQCRGCKC  535

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            KNTWGSY+C+CS  LLYIR+HD CISK A +   +W  +W+I++GLG  A GAY VYKYR
Sbjct  536  KNTWGSYECSCSGNLLYIREHDICISKDA-RGDVSWGVIWIIIMGLGAAALGAYTVYKYR  594

Query  489  LRSYMDTEIRAIMAQYMPLDNQ  424
            +R+YMD+EIRAIMAQYMPLDN 
Sbjct  595  IRTYMDSEIRAIMAQYMPLDNH  616



>gb|KGN58685.1| hypothetical protein Csa_3G728020 [Cucumis sativus]
Length=161

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = -2

Query  768  CTCPPGFKGDG-KSCEDIDECKDKTACQCPECSCKNTWGSYDCTCSNGLLYIRDHDTCIS  592
            C CPPGFKGDG + CED+DECK+K ACQCPEC C+NTWGSYDC+C NGLLY+ +HDTCI 
Sbjct  35   CKCPPGFKGDGVRKCEDVDECKEKLACQCPECKCRNTWGSYDCSCRNGLLYMHEHDTCIG  94

Query  591  KRATQVKSAWAAVWviliglgvvaggaylvYKYRLRSYMDTEIRAIMAQYMPLDNQSEIP  412
               + V S W+ V + ++ L +     + VYKYR+R YMD+EIRAIMAQYMPLDNQ E  
Sbjct  95   NIGSTVTS-WSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIMAQYMPLDNQGETS  153

Query  411  NHVS  400
            NHV+
Sbjct  154  NHVA  157



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 109/152 (72%), Gaps = 6/152 (4%)
 Frame = -2

Query  849  QLNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECS  673
            + NNGGCW ET+ G TYSAC+      C CPPGFKGDG   CED+DECK+K ACQCP C 
Sbjct  469  EFNNGGCWRETQEGKTYSACLDDHSHGCKCPPGFKGDGVNGCEDVDECKEKLACQCPGCK  528

Query  672  CKNTWGSYDCTCSNGLLYIRDHDTCIS---KRATQVKSAWAAVWviliglgvvaggaylv  502
            CKNTWGSY+C+C +G LY+R+HD CI+      T+V S +  +W I++GL V     Y +
Sbjct  529  CKNTWGSYECSCCDGSLYMREHDMCINAGKNGKTEVSSGF--IWAIILGLVVAGAVGYAI  586

Query  501  YKYRLRSYMDTEIRAIMAQYMPLDNQSEIPNH  406
            YKYR+R YMD+EIRAIMAQYMPLDNQ    +H
Sbjct  587  YKYRIRRYMDSEIRAIMAQYMPLDNQPSNIHH  618



>ref|XP_007134557.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
 gb|ESW06551.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
Length=625

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = -2

Query  846  LNNGGCWHETRNGHTYSACVPSEEGKCTCPPGFKGDG-KSCEDIDECKDKTACQCPECSC  670
            +NNGGCW ET+   T+SAC+      C CPPGF+GDG  SC+D+DEC +K ACQCPEC C
Sbjct  474  INNGGCWKETQGRTTFSACIDDHTKGCKCPPGFRGDGVNSCKDVDECSEKLACQCPECHC  533

Query  669  KNTWGSYDCTCSNGLLYIRDHDTCISKRATQVKSAWAAVWviliglgvvaggaylvYKYR  490
            +NTWGSY+C+CS+GL Y R++D CI K A  V      VW++L+ L V   G Y  YKYR
Sbjct  534  RNTWGSYECSCSDGLFYTRENDMCIGKYAASVAGG-GIVWMVLLILVVAGAGGYAFYKYR  592

Query  489  LRSYMDTEIRAIMAQYMPLDNQSE  418
            +R YMD+EIRAIMAQYMPLDNQ E
Sbjct  593  IRRYMDSEIRAIMAQYMPLDNQPE  616



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1853757769455