BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11095

Length=1071
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  575   0.0      Ipomoea batatas [batate]
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    520   1e-180   Nicotiana sylvestris
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               513   1e-177   Nicotiana tabacum [American tobacco]
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    512   2e-177   Nicotiana tomentosiformis
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    511   6e-177   Nicotiana tomentosiformis
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    509   3e-176   Nicotiana sylvestris
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    506   6e-175   Solanum tuberosum [potatoes]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    505   1e-174   Coffea canephora [robusta coffee]
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    504   3e-174   Coffea arabica [arabica coffee]
emb|CDP02827.1|  unnamed protein product                                506   4e-174   Coffea canephora [robusta coffee]
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         503   4e-174   Coffea arabica [arabica coffee]
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           503   6e-174   
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    501   2e-173   Coffea canephora [robusta coffee]
ref|NP_001275483.1|  HQT                                                499   2e-172   Solanum tuberosum [potatoes]
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               498   1e-171   Solanum tuberosum [potatoes]
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              481   5e-165   Cynara cardunculus var. scolymus [artichoke]
gb|AEK80405.1|  HQT                                                     477   1e-163   Lonicera japonica [Japanese honeysuckle]
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      475   5e-163   Cynara cardunculus var. scolymus [artichoke]
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    474   2e-162   Lonicera japonica [Japanese honeysuckle]
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    473   1e-161   Platycodon grandiflorus [balloon-flower]
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              464   2e-158   Cynara cardunculus var. scolymus [artichoke]
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    463   4e-158   Cynara cardunculus var. scolymus [artichoke]
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             463   6e-158   Cynara cardunculus var. scolymus [artichoke]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    459   9e-157   Cynara cardunculus var. scolymus [artichoke]
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    457   5e-156   Cynara cardunculus var. altilis [cultivated cardoon]
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      457   6e-156   Cynara cardunculus var. scolymus [artichoke]
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    429   6e-145   Nelumbo nucifera [Indian lotus]
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    423   1e-142   Hibiscus cannabinus [bimli-jute]
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    422   5e-142   Sesamum indicum [beniseed]
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             421   8e-142   
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         421   9e-142   Fagopyrum tataricum [Kangra buckwheat]
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...    419   1e-141   Garcinia mangostana [mangosteen]
gb|KJB56501.1|  hypothetical protein B456_009G122600                    419   6e-141   Gossypium raimondii
gb|AGE10604.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    414   7e-141   Lonicera hypoglauca
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    419   5e-140   Gossypium hirsutum [American cotton]
emb|CAN82918.1|  hypothetical protein VITISV_023290                     416   6e-140   Vitis vinifera
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    416   7e-140   Vitis vinifera
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    416   8e-140   Populus euphratica
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    416   9e-140   Populus euphratica
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    416   1e-139   Fragaria vesca subsp. vesca
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    415   5e-139   Eucalyptus grandis [rose gum]
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    414   6e-139   Theobroma cacao [chocolate]
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             414   7e-139   Prunus persica
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    413   2e-138   Sesamum indicum [beniseed]
emb|CDO98242.1|  unnamed protein product                                413   2e-138   Coffea canephora [robusta coffee]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    413   2e-138   Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      413   2e-138   Coffea canephora [robusta coffee]
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           412   3e-138   Coffea arabica [arabica coffee]
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    411   6e-138   Ricinus communis
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    411   9e-138   Coffea canephora [robusta coffee]
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    411   1e-137   Platycodon grandiflorus [balloon-flower]
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    411   1e-137   Coffea arabica [arabica coffee]
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    411   1e-137   Coffea canephora [robusta coffee]
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       410   2e-137   Prunus mume [ume]
ref|XP_012067474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    410   3e-137   Jatropha curcas
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    410   3e-137   
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    410   3e-137   Leucaena leucocephala [cassie]
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    409   4e-137   Populus euphratica
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    409   4e-137   Salvia miltiorrhiza [Chinese salvia]
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    409   5e-137   Populus tomentosa [Chinese white poplar]
emb|CBI83579.1|  hydroxycinnamoyl transferase                           409   7e-137   Plectranthus scutellarioides
gb|AHK05938.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    409   8e-137   Caragana korshinskii
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    409   1e-136   Glycine soja [wild soybean]
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    410   1e-136   
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    407   1e-136   Tarenaya hassleriana [spider flower]
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    408   1e-136   Glycine max [soybeans]
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 408   1e-136   Trifolium pratense [peavine clover]
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       408   2e-136   Pyrus x bretschneideri [bai li]
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     410   2e-136   Eucalyptus grandis [rose gum]
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    408   2e-136   Coffea canephora [robusta coffee]
ref|XP_006368492.1|  transferase family protein                         407   3e-136   Populus trichocarpa [western balsam poplar]
gb|ADG46003.1|  hydroxycinnamoyl transferase                            407   4e-136   Salvia miltiorrhiza [Chinese salvia]
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                406   7e-136   Trifolium pratense [peavine clover]
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    406   7e-136   Glycine max [soybeans]
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    406   8e-136   Pyrus x bretschneideri [bai li]
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    405   1e-135   Ipomoea batatas [batate]
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    405   1e-135   Populus trichocarpa [western balsam poplar]
dbj|BAF49306.1|  putative acyltransferase                               405   2e-135   Clitoria ternatea
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    406   2e-135   Glycine max [soybeans]
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    406   3e-135   Glycine max [soybeans]
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    405   3e-135   Nicotiana tomentosiformis
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    404   4e-135   Populus euphratica
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    405   4e-135   
gb|AEO00530.1|  hydroxycinnamoyl transferase                            402   5e-135   Nicotiana benthamiana
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    404   5e-135   Cicer arietinum [garbanzo]
gb|ABR17170.1|  unknown                                                 404   7e-135   Picea sitchensis
gb|AFS68800.1|  hydroxycinnamoyl transferase                            403   1e-134   Lonicera japonica [Japanese honeysuckle]
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    403   2e-134   Glechoma hederacea [gill-over-the-ground]
dbj|BAF49305.1|  putative acyltransferase                               403   2e-134   Clitoria ternatea
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    402   2e-134   Citrus sinensis [apfelsine]
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    402   4e-134   Nicotiana sylvestris
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    401   5e-134   Pinus pinaster [cluster pine]
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           400   1e-133   Medicago truncatula
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    400   1e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    401   1e-133   
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    400   1e-133   Solanum lycopersicum
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    400   1e-133   Pinus radiata
ref|XP_002894568.1|  transferase family protein                         400   2e-133   Arabidopsis lyrata subsp. lyrata
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       400   2e-133   Arabidopsis thaliana [mouse-ear cress]
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    399   3e-133   Lonicera japonica [Japanese honeysuckle]
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    399   7e-133   Solanum tuberosum [potatoes]
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    398   1e-132   Malus domestica [apple tree]
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    398   1e-132   Glycine soja [wild soybean]
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    398   1e-132   Nicotiana tomentosiformis
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   398   2e-132   Capsicum annuum
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    397   2e-132   Cynara cardunculus [cardoon]
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    397   2e-132   Larix kaempferi [karamatsu]
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    397   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             397   2e-132   Eutrema salsugineum [saltwater cress]
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    397   3e-132   Nicotiana tomentosiformis
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    398   3e-132   Camelina sativa [gold-of-pleasure]
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 397   4e-132   Phaseolus vulgaris [French bean]
emb|CBI25231.3|  unnamed protein product                                395   5e-132   Vitis vinifera
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             396   6e-132   Phaseolus vulgaris [French bean]
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    396   7e-132   Camelina sativa [gold-of-pleasure]
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    395   1e-131   Glechoma hederacea [gill-over-the-ground]
emb|CDY05770.1|  BnaC07g00330D                                          395   2e-131   
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    395   2e-131   Glycine max [soybeans]
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    394   3e-131   Camelina sativa [gold-of-pleasure]
emb|CDY31956.1|  BnaA07g00390D                                          394   4e-131   Brassica napus [oilseed rape]
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             395   5e-131   Phaseolus vulgaris [French bean]
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    394   8e-131   Brassica rapa
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    393   1e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    392   2e-130   Camelina sativa [gold-of-pleasure]
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             392   2e-130   Capsella rubella
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    392   3e-130   Prunus mume [ume]
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    391   7e-130   Elaeis guineensis
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    391   1e-129   Eucalyptus grandis [rose gum]
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    390   2e-129   Cynara cardunculus var. scolymus [artichoke]
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    390   2e-129   
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             390   3e-129   
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    389   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    389   3e-129   Nicotiana sylvestris
emb|CDY22880.1|  BnaA01g18180D                                          389   3e-129   Brassica napus [oilseed rape]
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           389   4e-129   Medicago truncatula
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             388   7e-129   Cucumis sativus [cucumbers]
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    389   8e-129   Prunus mume [ume]
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    388   8e-129   Morus notabilis
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    388   8e-129   
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    388   1e-128   Brassica rapa
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    388   1e-128   
emb|CDY44162.1|  BnaC01g22120D                                          387   1e-128   Brassica napus [oilseed rape]
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    387   2e-128   
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    387   2e-128   Arabis alpina [alpine rockcress]
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    387   3e-128   Camelina sativa [gold-of-pleasure]
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           387   3e-128   Medicago truncatula
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             386   6e-128   Prunus persica
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    385   2e-127   
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    385   3e-127   Eucalyptus grandis [rose gum]
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             384   4e-127   Capsella rubella
gb|AGE10615.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    378   4e-127   Lonicera macranthoides
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    384   6e-127   Erythroxylum coca [coca]
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    383   7e-127   Phoenix dactylifera
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             383   7e-127   Prunus persica
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    384   8e-127   
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    381   9e-126   Morus notabilis
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    380   1e-125   Camelina sativa [gold-of-pleasure]
ref|NP_001132890.1|  LOC100194386                                       380   2e-125   Zea mays [maize]
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    380   2e-125   Nelumbo nucifera [Indian lotus]
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    378   8e-125   Oryza brachyantha
gb|KJB56505.1|  hypothetical protein B456_009G122600                    377   8e-125   Gossypium raimondii
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             378   2e-124   Zea mays [maize]
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            377   2e-124   Prunus persica
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    377   2e-124   Pyrus x bretschneideri [bai li]
ref|XP_012071524.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    377   3e-124   Jatropha curcas
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    376   5e-124   Vitis vinifera
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    376   5e-124   Nelumbo nucifera [Indian lotus]
ref|NP_001053225.1|  Os04g0500700                                       375   2e-123   
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    374   2e-123   Setaria italica
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             374   4e-123   Capsella rubella
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    373   7e-123   
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    373   8e-123   Populus euphratica
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    375   2e-122   Setaria italica
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    372   2e-122   Panicum virgatum
gb|ADB44897.1|  hydroxycinnamoyl transferase                            372   3e-122   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    372   3e-122   Pyrus x bretschneideri [bai li]
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    371   5e-122   Brachypodium distachyon [annual false brome]
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...    371   6e-122   Panicum virgatum
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    370   1e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001145871.1|  uncharacterized protein LOC100279386               369   3e-121   
dbj|BAJ95750.1|  predicted protein                                      369   3e-121   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93247.1|  predicted protein                                      369   3e-121   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          369   4e-121   Sorghum bicolor [broomcorn]
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    367   2e-120   Brachypodium distachyon [annual false brome]
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2             366   4e-120   Zea mays [maize]
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g             366   5e-120   
dbj|BAK06288.1|  predicted protein                                      366   6e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87836.1|  predicted protein                                      365   7e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          365   8e-120   Sorghum bicolor [broomcorn]
gb|KJB54947.1|  hypothetical protein B456_009G055900                    364   1e-119   Gossypium raimondii
ref|XP_002303858.2|  hypothetical protein POPTR_0003s18210g             360   1e-119   
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3      364   2e-119   Avena sativa [cultivated oat]
ref|NP_001047408.1|  Os02g0611800                                       364   2e-119   
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                364   2e-119   Erythranthe guttata [common monkey flower]
gb|KJB54946.1|  hypothetical protein B456_009G055900                    364   3e-119   Gossypium raimondii
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      364   3e-119   Avena sativa [cultivated oat]
gb|AEN02914.1|  HCT1                                                    359   3e-119   Populus nigra [black poplar]
emb|CAE01635.3|  OSJNBa0029H02.19                                       365   3e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               363   9e-119   Selaginella moellendorffii
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              362   2e-118   Selaginella moellendorffii
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             362   2e-118   
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    361   4e-118   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      360   1e-117   Avena sativa [cultivated oat]
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             360   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g             359   3e-117   Populus trichocarpa [western balsam poplar]
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    357   1e-116   Gossypium arboreum [tree cotton]
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    355   1e-116   
gb|EPS67512.1|  hypothetical protein M569_07262                         357   2e-116   Genlisea aurea
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    356   4e-116   Cicer arietinum [garbanzo]
gb|KJB71577.1|  hypothetical protein B456_011G130700                    356   4e-116   Gossypium raimondii
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    354   3e-115   Populus euphratica
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    353   4e-115   
gb|KJB71596.1|  hypothetical protein B456_011G132100                    353   5e-115   Gossypium raimondii
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    356   8e-115   
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    351   4e-114   Populus euphratica
gb|EAZ23787.1|  hypothetical protein OsJ_07497                          351   6e-114   Oryza sativa Japonica Group [Japonica rice]
emb|CAD88491.1|  hydroxycinnamoyl-CoA hydroxycinnamoyltransferase       346   8e-114   Nicotiana benthamiana
gb|KJB54948.1|  hypothetical protein B456_009G055900                    350   1e-113   Gossypium raimondii
gb|KHN22398.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    352   2e-113   Glycine soja [wild soybean]
gb|EPS67739.1|  hypothetical protein M569_07035                         347   9e-113   Genlisea aurea
ref|XP_006826688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    346   4e-112   Amborella trichopoda
gb|KJB68257.1|  hypothetical protein B456_010G234800                    345   4e-112   Gossypium raimondii
gb|KJB68253.1|  hypothetical protein B456_010G234500                    345   6e-112   Gossypium raimondii
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    345   7e-112   Prunus mume [ume]
gb|KJB68256.1|  hypothetical protein B456_010G234800                    345   9e-112   Gossypium raimondii
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             344   1e-111   Phaseolus vulgaris [French bean]
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1             344   2e-111   
gb|KJB68255.1|  hypothetical protein B456_010G234700                    345   2e-111   Gossypium raimondii
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...    342   3e-111   
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             343   6e-111   Prunus persica
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                341   2e-110   Erythranthe guttata [common monkey flower]
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             342   2e-110   Prunus persica
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    339   6e-110   
gb|KHN38057.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    334   7e-110   Glycine soja [wild soybean]
gb|ACF81845.1|  unknown                                                 335   1e-109   Zea mays [maize]
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    340   1e-109   
dbj|BAH57209.1|  AT5G48930                                              333   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    335   2e-108   
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    336   2e-108   
gb|KJB54981.1|  hypothetical protein B456_009G057200                    335   3e-108   Gossypium raimondii
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    335   4e-108   
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    334   1e-107   Gossypium arboreum [tree cotton]
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    332   1e-106   Populus euphratica
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    328   2e-105   Gossypium arboreum [tree cotton]
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    328   2e-105   
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg                328   3e-105   Erythranthe guttata [common monkey flower]
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...    327   4e-105   Ricinus communis
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg                330   4e-105   Erythranthe guttata [common monkey flower]
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    326   2e-104   
ref|XP_010093468.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    325   3e-104   
ref|XP_008466864.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    320   4e-104   Cucumis melo [Oriental melon]
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    325   4e-104   Citrus sinensis [apfelsine]
gb|AFR67331.1|  hydroxycinnamoyl CoA shikimate hydroxycinnamoyl t...    319   7e-104   Leucaena leucocephala [cassie]
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    322   8e-103   
gb|KJB68227.1|  hypothetical protein B456_010G233600                    319   7e-102   Gossypium raimondii
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    317   3e-101   Citrus sinensis [apfelsine]
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    318   3e-101   Citrus sinensis [apfelsine]
gb|ERN01793.1|  hypothetical protein AMTR_s00727p00010990               311   7e-101   Amborella trichopoda
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    317   1e-100   Fragaria vesca subsp. vesca
gb|AGE10614.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    308   1e-100   Lonicera macranthoides
gb|EMS64908.1|  Anthranilate N-benzoyltransferase protein 1             314   1e-100   Triticum urartu
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    316   2e-100   Prunus mume [ume]
gb|ABI48360.1|  putative alcohol acyltransferase 1                      317   2e-100   Lavandula angustifolia [lavender]
gb|EMS60258.1|  Anthranilate N-benzoyltransferase protein 1             317   2e-100   Triticum urartu
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    315   3e-100   Citrus sinensis [apfelsine]
gb|EPS73563.1|  hypothetical protein M569_01193                         311   3e-100   Genlisea aurea
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg             315   3e-100   Citrus clementina [clementine]
gb|ADA60182.1|  rosmarinic acid synthase                                315   4e-100   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004295153.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    317   4e-100   Fragaria vesca subsp. vesca
gb|KJB68229.1|  hypothetical protein B456_010G233600                    314   5e-100   Gossypium raimondii
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    314   7e-100   Sesamum indicum [beniseed]
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    314   8e-100   Fragaria vesca subsp. vesca
gb|AEA36976.1|  rosmarinic acid synthase                                315   1e-99    Lavandula angustifolia [lavender]
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    314   1e-99    Pyrus x bretschneideri [bai li]
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    313   1e-99    Pyrus x bretschneideri [bai li]
gb|AJA31666.1|  rosmarinic acid synthase                                313   2e-99    Salvia miltiorrhiza [Chinese salvia]
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    313   2e-99    
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...    312   5e-99    Plectranthus scutellarioides
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    312   6e-99    Citrus sinensis [apfelsine]
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    312   6e-99    
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    312   6e-99    
gb|AEV93472.1|  hydroxycinnamoyl transferase                            304   1e-98    
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...    310   3e-98    
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg                310   4e-98    
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg             308   1e-97    
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    308   1e-97    
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    308   2e-97    
gb|AGW27209.1|  rosmarinic acid synthase 4                              307   2e-97    
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    307   4e-97    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    307   6e-97    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    305   3e-96    
dbj|BAC78636.1|  hydroxyanthranilate hydroxycinnamoyltransferase 4      299   7e-96    
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    304   7e-96    
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    301   9e-95    
gb|AGH61997.1|  rosmarinic acid synthase                                300   3e-94    
gb|EMT09803.1|  Anthranilate N-benzoyltransferase protein 1             298   9e-93    
gb|KDP38697.1|  hypothetical protein JCGZ_04050                         294   3e-92    
ref|XP_012071529.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    294   3e-92    
ref|XP_007216540.1|  hypothetical protein PRUPE_ppa027223mg             293   4e-92    
ref|XP_007216286.1|  hypothetical protein PRUPE_ppa020471mg             288   7e-92    
gb|KJB68258.1|  hypothetical protein B456_010G234900                    292   2e-91    
gb|AGW27207.1|  rosmarinic acid synthase 2                              288   7e-91    
ref|XP_012071530.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    290   2e-90    
gb|KDP38698.1|  hypothetical protein JCGZ_04051                         289   2e-90    
ref|XP_009403962.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    289   4e-90    
emb|CAR40185.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoylt...    282   4e-90    
ref|XP_010911018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    282   3e-89    
ref|XP_002269790.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    286   6e-89    
gb|EYU24588.1|  hypothetical protein MIMGU_mgv1a0237892mg               281   1e-88    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          285   2e-88    
ref|XP_006478316.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    285   2e-88    
gb|AFF19202.1|  BAHD acyltransferase                                    284   3e-88    
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    283   7e-88    
gb|AAZ80047.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    278   2e-87    
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    282   3e-87    
gb|AGW27208.1|  rosmarinic acid synthase 3                              281   4e-87    
ref|XP_008779303.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    278   5e-87    
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    281   7e-87    
gb|AAZ80048.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    276   8e-87    
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    281   1e-86    
gb|ACZ52699.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    272   2e-86    
gb|AGW27211.1|  rosmarinic acid synthase 6                              279   2e-86    
gb|ACF85468.1|  unknown                                                 273   2e-86    
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    279   3e-86    
gb|KDO61846.1|  hypothetical protein CISIN_1g036315mg                   278   1e-85    
ref|XP_002274695.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    278   2e-85    
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g             278   2e-85    
ref|XP_002866234.1|  transferase family protein                         276   7e-85    
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    276   7e-85    
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    276   8e-85    
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    275   8e-85    
ref|XP_006453312.1|  hypothetical protein CICLE_v10008265mg             275   1e-84    
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    275   2e-84    
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...    274   3e-84    
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    274   4e-84    
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg             275   5e-84    
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                          273   7e-84    
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    270   4e-83    
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    270   8e-83    
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...    269   2e-82    
ref|XP_010483334.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    268   7e-82    
gb|AGW27210.1|  rosmarinic acid synthase 5                              267   2e-81    
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    266   2e-81    
ref|XP_007011893.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    264   3e-81    
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                    266   4e-81    
emb|CAN72449.1|  hypothetical protein VITISV_011069                     265   7e-81    
ref|XP_002276550.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    265   9e-81    
emb|CDY11845.1|  BnaC03g12710D                                          276   1e-80    
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    265   1e-80    
emb|CDG56251.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    263   1e-80    
emb|CDX88644.1|  BnaA03g10050D                                          264   3e-80    
ref|NP_001169127.1|  hypothetical protein                               263   4e-80    
ref|NP_200592.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfer...    263   5e-80    
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg             263   7e-80    
emb|CBI36554.3|  unnamed protein product                                264   7e-80    
ref|XP_010452842.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    263   8e-80    
ref|XP_010443493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    260   9e-80    
ref|XP_010656623.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    263   9e-80    
ref|XP_001756433.1|  predicted protein                                  261   1e-79    
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    262   1e-79    
gb|KJB71590.1|  hypothetical protein B456_011G1315001                   259   2e-79    
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...    261   5e-79    
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...    260   6e-79    
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    260   7e-79    
ref|XP_007011892.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    260   9e-79    
ref|XP_002529384.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    258   2e-78    
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             259   2e-78    
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    259   2e-78    
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780          259   2e-78    
dbj|BAJ89730.1|  predicted protein                                      258   3e-78    
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    258   3e-78    
emb|CDX88645.1|  BnaA03g10040D                                          258   6e-78    
dbj|BAJ91746.1|  predicted protein                                      258   9e-78    
ref|XP_011069658.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    258   1e-77    
gb|AFU82547.1|  hydroxycinnamoyl CoA quinate transferase                248   1e-77    
ref|XP_011083883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    257   1e-77    
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase     257   1e-77    
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    256   2e-77    
ref|XP_007149777.1|  hypothetical protein PHAVU_005G098300g             254   4e-77    
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    256   5e-77    
gb|AFD64619.1|  putative hydroxycinnamoyl-CoA:shikimate/quinate h...    255   5e-77    
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    255   6e-77    
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    254   7e-77    
ref|XP_010050942.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    255   7e-77    
gb|KHN17616.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    252   8e-77    
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    255   8e-77    
ref|XP_003550655.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    254   1e-76    
ref|XP_004149125.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    254   2e-76    
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    254   2e-76    
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    253   3e-76    
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    254   4e-76    
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    253   4e-76    
gb|KJB71583.1|  hypothetical protein B456_011G130900                    251   5e-76    
gb|EPS61293.1|  hypothetical protein M569_13504                         251   6e-76    
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    253   6e-76    
ref|XP_006409088.1|  hypothetical protein EUTSA_v10022690mg             252   1e-75    
ref|XP_009787025.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    250   4e-75    
gb|AFZ93419.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    244   5e-75    
ref|XP_007161968.1|  hypothetical protein PHAVU_001G112900g             250   5e-75    
gb|EYU25632.1|  hypothetical protein MIMGU_mgv1a006215mg                250   6e-75    
ref|XP_009628063.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    249   1e-74    
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    249   1e-74    
ref|XP_002325143.2|  transferase family protein                         249   3e-74    
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    254   4e-74    
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    248   4e-74    
gb|KFK40283.1|  hypothetical protein AALP_AA3G354800                    248   7e-74    
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    248   8e-74    
ref|XP_010489453.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    247   8e-74    
ref|XP_007149790.1|  hypothetical protein PHAVU_005G0989001g            240   1e-73    
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    257   1e-73    
ref|XP_007154735.1|  hypothetical protein PHAVU_003G143100g             247   1e-73    
ref|XP_010050943.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    246   2e-73    
gb|KCW80900.1|  hypothetical protein EUGRSUZ_C02269                     246   2e-73    
ref|XP_010034869.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    246   3e-73    
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    246   3e-73    
ref|XP_006296658.1|  hypothetical protein CARUB_v10015907mg             245   6e-73    
ref|XP_010672786.1|  PREDICTED: anthranilate N-benzoyltransferase...    242   8e-73    
gb|KHN35439.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    243   8e-73    
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    244   9e-73    
gb|ADD71921.1|  BAHD-type hydroxycinnamoyltransferase                   244   2e-72    
ref|XP_003555244.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    244   2e-72    
ref|XP_008441993.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    243   3e-72    
gb|ACU23734.1|  unknown                                                 243   4e-72    
ref|XP_006605610.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    243   5e-72    
ref|XP_011092043.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    243   7e-72    
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    241   1e-71    
gb|AFR40372.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    232   2e-71    
gb|AFR40382.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    232   2e-71    
gb|AFR40350.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    232   2e-71    
ref|XP_011077685.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    241   2e-71    
gb|AFR40387.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    232   2e-71    
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    241   3e-71    
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    241   3e-71    
gb|KJB68254.1|  hypothetical protein B456_010G234600                    237   4e-71    
ref|NP_179497.1|  spermidine hydroxycinnamoyl transferase               240   6e-71    
gb|EAY99938.1|  hypothetical protein OsI_21941                          239   1e-70    
ref|XP_002884178.1|  transferase family protein                         239   1e-70    
ref|XP_007161967.1|  hypothetical protein PHAVU_001G112800g             239   2e-70    
gb|ACC68164.1|  unknown                                                 239   2e-70    
dbj|BAK06725.1|  predicted protein                                      238   3e-70    
gb|AFR40245.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   3e-70    
gb|AFK40022.1|  unknown                                                 228   5e-70    
gb|AFR40375.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    228   5e-70    
gb|AFR40214.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   5e-70    
gb|AFR40251.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   5e-70    
gb|AFR40264.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   5e-70    
gb|AFR40243.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   6e-70    
gb|AFR40216.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   6e-70    
gb|KCW82842.1|  hypothetical protein EUGRSUZ_C04213                     237   6e-70    
gb|AFR40219.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    229   6e-70    
gb|KJB68259.1|  hypothetical protein B456_010G235000                    234   6e-70    
ref|XP_010051711.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    237   9e-70    
gb|AFR40386.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    228   9e-70    
gb|AFR40239.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    228   1e-69    
gb|AFR40240.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    228   1e-69    
gb|AFR40246.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   2e-69    
gb|AFR40241.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   2e-69    
gb|AFR40250.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   2e-69    
gb|AFR40238.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   2e-69    
gb|AFR40248.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   2e-69    
ref|XP_002445569.1|  hypothetical protein SORBIDRAFT_07g021750          235   2e-69    
gb|AFR40230.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   3e-69    
ref|XP_010414994.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    236   3e-69    
gb|AFR40231.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   3e-69    
gb|AFR40229.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   3e-69    
gb|AFR40374.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    226   3e-69    
gb|AFR40242.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    227   3e-69    
ref|XP_007149788.1|  hypothetical protein PHAVU_005G0988001g            227   4e-69    
dbj|BAN10302.1|  hydroxycinnamoyl-Coenzyme A shikimate/quinate hy...    228   4e-69    
ref|XP_006280407.1|  hypothetical protein CARUB_v10026341mg             231   4e-69    
ref|NP_001056998.1|  Os06g0184900                                       234   5e-69    
gb|AFR40223.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    226   6e-69    
gb|EPS69670.1|  hypothetical protein M569_05094                         234   7e-69    
gb|AFR40236.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    225   1e-68    
gb|AFR40233.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    225   1e-68    
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   1e-68    
emb|CDY62143.1|  BnaCnng39330D                                          231   3e-68    
emb|CDY56515.1|  BnaCnng30570D                                          230   4e-68    
gb|ACF87435.1|  unknown                                                 232   4e-68    
gb|EYU25633.1|  hypothetical protein MIMGU_mgv1a006801mg                232   4e-68    
ref|XP_010533495.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   5e-68    
ref|XP_009150708.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    231   9e-68    
ref|XP_004243059.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    231   1e-67    
emb|CDY66506.1|  BnaAnng22360D                                          231   1e-67    
ref|NP_001147464.1|  anthranilate N-benzoyltransferase protein 1        230   1e-67    
gb|KJB71578.1|  hypothetical protein B456_011G130700                    227   2e-67    
ref|XP_004956854.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   3e-67    
ref|XP_009112574.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    230   3e-67    
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    228   1e-66    
ref|XP_006359722.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    228   1e-66    
gb|KJB71581.1|  hypothetical protein B456_011G130700                    224   2e-66    
emb|CDY03367.1|  BnaC09g09810D                                          227   3e-66    
ref|XP_003532115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    227   6e-66    
ref|XP_003610074.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    226   8e-66    
dbj|BAJ92446.1|  predicted protein                                      225   1e-65    
ref|XP_006474077.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   1e-65    
dbj|BAJ94002.1|  predicted protein                                      225   1e-65    
ref|XP_004956853.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   3e-65    
ref|XP_010541075.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    226   5e-65    
ref|XP_010673351.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    224   6e-65    



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/328 (82%), Positives = 300/328 (91%), Gaps = 1/328 (0%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDFTPSLELRK +P+VDTSGDISSFPL +FQVTRFKCGGV LGTG+FHTLSDG+
Sbjct  105   ACVDDFGDFTPSLELRKFIPTVDTSGDISSFPLIIFQVTRFKCGGVCLGTGVFHTLSDGV  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGLSVAIPPFIDRT+LRARDPP PAF+H+EYD PP LKS P SK  G
Sbjct  165   SSLHFINTWSDMARGLSVAIPPFIDRTLLRARDPPTPAFEHSEYDQPPKLKSVPESKR-G  223

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIATDG  531
             ++ ST MLKITP+QLALLKT S HEGSTYEILAAHIWRC C+ARGL+DDQ TKLY+ATDG
Sbjct  224   SSASTTMLKITPEQLALLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQATKLYVATDG  283

Query  530   RSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYL  351
             RSRLCP LPPG+LGNV+FTATP+AESGEL +EPL +SAKRI SAL RMDDEYLRSALD+L
Sbjct  284   RSRLCPPLPPGYLGNVVFTATPMAESGELQSEPLTNSAKRIHSALSRMDDEYLRSALDFL  343

Query  350   ECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPS  171
             ECQPDLSKL+RGSNYFASPNLNINSWTRLPVH SDFGWG P+HMGPA ILYEGTVYILPS
Sbjct  344   ECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPS  403

Query  170   PNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             PNKDR+LSLAVCLDA+HMPLF++ LY F
Sbjct  404   PNKDRTLSLAVCLDAEHMPLFKEFLYDF  431



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   520 bits (1340),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 249/332 (75%), Positives = 284/332 (86%), Gaps = 5/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDFTPSLELRKL+P+VDTSGDIS+FPL +FQVTRFKCGGVSLG G+FHTLSDGL
Sbjct  106   AFVDDFGDFTPSLELRKLIPTVDTSGDISTFPLIIFQVTRFKCGGVSLGGGVFHTLSDGL  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S++HFI TW+D+ARGLSVAIPPFIDRT+LRARDPP  +F+H EY  PP+L S     L  
Sbjct  166   SSIHFINTWSDIARGLSVAIPPFIDRTLLRARDPPTSSFEHVEYHPPPSLISSS-KTLES  224

Query  710   ANPS---TAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              +P    T MLK +  QL LLK+ S HEGSTYEILAAHIWRC C+AR L+DDQ TKL++A
Sbjct  225   TSPKPSMTTMLKFSSDQLGLLKSKSKHEGSTYEILAAHIWRCTCKARALADDQLTKLHVA  284

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRLCP LPPG+LGNV+FTATP+A+S ELL EPL +SAKRI ++L +MDD YLRSAL
Sbjct  285   TDGRSRLCPPLPPGYLGNVVFTATPMAKSSELLQEPLTNSAKRIHTSLSKMDDNYLRSAL  344

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDLS L+RG  YFASPNLNINSWTRLPVH+SDFGWG P+HMGPA ILYEGTVYI
Sbjct  345   DYLELQPDLSALIRGPTYFASPNLNINSWTRLPVHDSDFGWGRPIHMGPACILYEGTVYI  404

Query  179   LPSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSPN KDR+L LAVCLDADHMPLF+K LY+F
Sbjct  405   LPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score =   513 bits (1320),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 249/331 (75%), Positives = 282/331 (85%), Gaps = 3/331 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDFTPSLELRKL+P+VDTSGDIS+FPL +FQVTRFKCGGVSLG G+FHTLSDGL
Sbjct  106   AFVDDFGDFTPSLELRKLIPTVDTSGDISTFPLIIFQVTRFKCGGVSLGGGVFHTLSDGL  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL-KSGPLSKLP  714
             S++HFI TW+D+ARGLSVAIPPFIDRT+LRARDPP  +F+H EY  PP+L  S    +  
Sbjct  166   SSIHFINTWSDIARGLSVAIPPFIDRTLLRARDPPTSSFEHVEYHPPPSLISSSKSLEST  225

Query  713   GANPSTA-MLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIAT  537
                PST  MLK +  QL LLK+ S H+GSTYEILAAHIWRC C+AR LSDDQ TKL++AT
Sbjct  226   SPKPSTTTMLKFSSDQLGLLKSKSKHDGSTYEILAAHIWRCTCKARALSDDQLTKLHVAT  285

Query  536   DGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALD  357
             DGRSRLCP LPPG+LGNV+FT TP+A+S ELL EPL +SAKRI SAL +MDD YLRSALD
Sbjct  286   DGRSRLCPPLPPGYLGNVVFTGTPMAKSSELLQEPLTNSAKRIHSALSKMDDNYLRSALD  345

Query  356   YLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYIL  177
             YLE  PDLS L+RG  YFASPNLNINSWTRLPVH+SDFGWG P+HMGPA ILYEGTVYIL
Sbjct  346   YLELLPDLSALIRGPTYFASPNLNINSWTRLPVHDSDFGWGRPIHMGPACILYEGTVYIL  405

Query  176   PSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
             PSPN KDR+L LAVCLDADHMPLF+K LY+F
Sbjct  406   PSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   512 bits (1319),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 281/333 (84%), Gaps = 5/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLL-PSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
             A IDDFGDF PSLE++K+L P+VDTSGDISSFPL +FQVTRFKCGGVSLG G+FHTLSDG
Sbjct  102   AIIDDFGDFIPSLEIKKMLIPNVDTSGDISSFPLVIFQVTRFKCGGVSLGCGVFHTLSDG  161

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
             +S+LHFI TW+++ RG+SVA+ PFIDR++L ARDPP PA+KH EY  PP LKS   +   
Sbjct  162   ISSLHFINTWSEVVRGVSVAVSPFIDRSLLHARDPPTPAYKHVEYHSPPALKSSSKNVHD  221

Query  713   GAN----PSTAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLY  546
               N     +T M KIT  QL LLKT S HEGSTYEILAAHIWRC C+AR L DDQ TKL+
Sbjct  222   QVNGPKSSTTTMFKITSDQLTLLKTKSKHEGSTYEILAAHIWRCTCKARILDDDQLTKLH  281

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +ATDGRSRL P LPPG+LGNV+FTATP+A+SGE+L+EPL ++A+RI SAL RMDDEYLRS
Sbjct  282   VATDGRSRLFPPLPPGYLGNVVFTATPIAKSGEILSEPLMNTAQRIHSALARMDDEYLRS  341

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             A+DYLE Q DLSKL+RG  YFASPNLNINSWTRLPVH+SDFGWG P+HMGPA ILYEGTV
Sbjct  342   AIDYLELQTDLSKLIRGPTYFASPNLNINSWTRLPVHDSDFGWGKPIHMGPACILYEGTV  401

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YILPSP+ D++L LAVCLDADHMPLF+K LY+F
Sbjct  402   YILPSPSNDKNLRLAVCLDADHMPLFEKYLYEF  434



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   511 bits (1316),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 248/331 (75%), Positives = 281/331 (85%), Gaps = 3/331 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDFTPSLELRKL+P+VDTSGDIS+FPL +FQVTRFKCGGVSLG G+FHTLSDGL
Sbjct  106   AFVDDFGDFTPSLELRKLIPTVDTSGDISTFPLIIFQVTRFKCGGVSLGGGVFHTLSDGL  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL-KSGPLSKLP  714
             S++HFI TW+D+ARGLSV IPPFIDRT+LRARDPP  +F+H EY  PP+L  S    +  
Sbjct  166   SSIHFINTWSDIARGLSVVIPPFIDRTLLRARDPPTSSFEHVEYHPPPSLISSSKTKEST  225

Query  713   GANPSTA-MLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIAT  537
                PST  MLK +  QL LLK+ S H+GSTYEILAAHIWRC C+AR LSDDQ TKL++AT
Sbjct  226   SPKPSTTTMLKFSSDQLGLLKSKSKHDGSTYEILAAHIWRCTCKARALSDDQLTKLHVAT  285

Query  536   DGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALD  357
             DGRSRLCP LPPG+LGNV+FT TP+A+S ELL EPL +SAKRI SAL +MDD YLRSALD
Sbjct  286   DGRSRLCPPLPPGYLGNVVFTGTPMAKSSELLQEPLTNSAKRIHSALSKMDDNYLRSALD  345

Query  356   YLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYIL  177
             YLE  PDLS L+RG  YFASPNLNINSWTRLPVH+SDFGWG P+HMGPA ILYEGTVYIL
Sbjct  346   YLELLPDLSALIRGPTYFASPNLNINSWTRLPVHDSDFGWGRPIHMGPACILYEGTVYIL  405

Query  176   PSPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
             PSPN KDR+L LAVCLDADHMPLF+K LY+F
Sbjct  406   PSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   509 bits (1311),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 246/338 (73%), Positives = 284/338 (84%), Gaps = 18/338 (5%)
 Frame = -2

Query  1064  IDDFGD-FTPSLELRKLL-PSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             IDDFGD FTPSLE++K+L P+VDTSGDISSFPL +FQVTRFKCGGVSLG G+FHTLSDG+
Sbjct  105   IDDFGDDFTPSLEIKKMLIPNVDTSGDISSFPLVIFQVTRFKCGGVSLGCGVFHTLSDGI  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS--------  735
             S+LHFI TW+++ARGLSVA+ PFIDR++LRARDPP PA+KH EY  PPTLKS        
Sbjct  165   SSLHFINTWSEVARGLSVAVSPFIDRSLLRARDPPTPAYKHVEYHPPPTLKSSSEYVHDQ  224

Query  734   --GPLSKLPGANPSTAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQ  561
               GP S +      TAM KIT  QL LLKT S  EGSTYE+LAAHIWRC C+AR L +DQ
Sbjct  225   VNGPKSSI------TAMFKITSDQLTLLKTKSKKEGSTYEVLAAHIWRCTCKARALDNDQ  278

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKL++ATDGRSRL P LPPG+LGNV+FTATP+A+SGE+L+EPL ++A+RI SAL RMDD
Sbjct  279   LTKLHVATDGRSRLFPPLPPGYLGNVVFTATPIAKSGEILSEPLMNTAQRIHSALARMDD  338

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYLRSA+DYLE Q DLSKL+RG  YFASPNLNINSWTRLPVH+SDFGWG P+HMGPA IL
Sbjct  339   EYLRSAIDYLELQTDLSKLIRGPTYFASPNLNINSWTRLPVHDSDFGWGKPIHMGPACIL  398

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEGTVYILPSP+ D++L LAVCLDADHMPLF+K LY F
Sbjct  399   YEGTVYILPSPSNDKNLRLAVCLDADHMPLFEKYLYDF  436



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score =   506 bits (1303),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 238/330 (72%), Positives = 280/330 (85%), Gaps = 2/330 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDFTP LEL+KL+PSV+TSGDIS+FPLA+FQVTRFKCGG++LG G+FHTLSDGL
Sbjct  106   SCIDDFGDFTPCLELKKLIPSVETSGDISTFPLAIFQVTRFKCGGIALGGGVFHTLSDGL  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGLSVA+PPFIDRT+L ARDPP  +F+H EY  PPTL S    +  G
Sbjct  166   SSLHFINTWSDIARGLSVAVPPFIDRTLLHARDPPTSSFEHVEYHPPPTLISSKKGESTG  225

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIATD  534
                ST AMLK + +Q+ LLK+ S +EGSTYEILAAHIWRC  +ARGL+DDQ TKL++ATD
Sbjct  226   PKSSTTAMLKFSSEQVGLLKSKSENEGSTYEILAAHIWRCTSKARGLADDQLTKLHVATD  285

Query  533   GRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDY  354
             GRSRLCP LPPG+LGNV+FTATP+A+S EL +EPL +S KRI + L++MDD YLRSALDY
Sbjct  286   GRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIHNELIKMDDNYLRSALDY  345

Query  353   LECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILP  174
             LE QPDLS L+RG  YF SPNLNINSWTRLPVH  DFGWG P+HMGPA ILYEGT+YI+P
Sbjct  346   LELQPDLSTLIRGPTYFTSPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTIYIIP  405

Query  173   SPN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
             SPN KDR+L LAVCLD DHMPLF+K LY+F
Sbjct  406   SPNTKDRNLRLAVCLDPDHMPLFEKYLYEF  435



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   505 bits (1300),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 232/331 (70%), Positives = 282/331 (85%), Gaps = 3/331 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +++DDFGDF PSLELR+L+P+VD SGDISS+PL +FQVTRFKCG  +LG G+ H LSDG+
Sbjct  100   SSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGV  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGL++A+PPFIDRT++RARDPP P F+H EY  PP LKS    +   
Sbjct  160   SSLHFINTWSDIARGLTIAVPPFIDRTLIRARDPPVPVFEHVEYYPPPQLKSDSRIQELK  219

Query  710   ANP---STAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
               P   +TA+LKITP+QL+ LK  +++EGSTYEILAAHIWR  C+ARGL++DQ+TKLY+A
Sbjct  220   TGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQSTKLYVA  279

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRL P LPPG+LGNV+FTATP+AES  L +EPL +SAKRI +AL RMD++YLRSAL
Sbjct  280   TDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSAL  339

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDLS LVRG  +FASPNLNINSWTRLP H++DFGWG P+H+GPA+ILYEGTVY+
Sbjct  340   DYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYV  399

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP KDR+LSLAVCLDADHMPLFQ+ LY F
Sbjct  400   LPSPGKDRTLSLAVCLDADHMPLFQRFLYDF  430



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   504 bits (1298),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 232/331 (70%), Positives = 282/331 (85%), Gaps = 3/331 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +++DDFGDF PSLELR+L+P+VD SGDISS+PL +FQVTRFKCG  +LG G+ H LSDG+
Sbjct  100   SSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGV  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGL++A+PPFIDRT++ ARDPP P F+H EY  PP LKS    +   
Sbjct  160   SSLHFINTWSDIARGLTIAVPPFIDRTLIHARDPPVPVFEHVEYYPPPQLKSDSRIQELK  219

Query  710   ANP---STAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
               P   +TA+LKITP+QL+ LK  +++EGSTYEILAAHIWR  C+ARGL++DQ+TKLY+A
Sbjct  220   TGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQSTKLYVA  279

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRL P LPPG+LGNV+FTATP+AES +L +EPL +SAKRI +AL RMD++YLRSAL
Sbjct  280   TDGRSRLIPPLPPGYLGNVVFTATPIAESSDLQSEPLTNSAKRIHNALARMDNDYLRSAL  339

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDLS LVRG  +FASPNLNINSWTRLP H++DFGWG P+H+GPA+ILYEGTVY+
Sbjct  340   DYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYV  399

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  400   LPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   506 bits (1302),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 233/331 (70%), Positives = 282/331 (85%), Gaps = 3/331 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +++DDFGDF PSLELR+L+P+VD SGDISS+PL +FQVTRFKCG  +LG G+ H LSDG+
Sbjct  154   SSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGV  213

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGL++A+PPFIDRT++RARDPP P F+H EY  PP LKS    +   
Sbjct  214   SSLHFINTWSDIARGLTIAVPPFIDRTLIRARDPPVPVFEHVEYYPPPQLKSDSRIQELK  273

Query  710   ANP---STAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
               P   +TA+LKITP+QL+ LK  +++EGSTYEILAAHIWR  C+ARGL++DQ+TKLY+A
Sbjct  274   TGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQSTKLYVA  333

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRL P LPPG+LGNV+FTATP+AES  L +EPL +SAKRI +AL RMD++YLRSAL
Sbjct  334   TDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSAL  393

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDLS LVRG  +FASPNLNINSWTRLP H++DFGWG P+H+GPA+ILYEGTVY+
Sbjct  394   DYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYV  453

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  454   LPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  484



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   503 bits (1296),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 232/331 (70%), Positives = 281/331 (85%), Gaps = 3/331 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +++DDFGDF PSLELR+L+P+VD SGDISS+PL +FQVTRFKCG  +LG G+ H LSDG+
Sbjct  100   SSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGV  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGL++A+PPFIDRT++ ARDPP P F+H EY  PP LKS    +   
Sbjct  160   SSLHFINTWSDIARGLTIAVPPFIDRTLIHARDPPVPVFEHVEYYPPPQLKSDSRIQELK  219

Query  710   ANP---STAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
               P   +TA+LKITP+QL+ LK  +++EGSTYEILAAHIWR  C+ARGL++DQ+TKLY+A
Sbjct  220   TGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQSTKLYVA  279

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRL P LPPG+LGNV+FTATP+AES  L +EPL +SAKRI +AL RMD++YLRSAL
Sbjct  280   TDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSAL  339

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDLS LVRG  +FASPNLNINSWTRLP H++DFGWG P+H+GPA+ILYEGTVY+
Sbjct  340   DYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYV  399

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  400   LPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score =   503 bits (1296),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 235/329 (71%), Positives = 279/329 (85%), Gaps = 5/329 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDFTPSLELRKL+PSV+TSGDIS+FPL +FQ+TRFKCGGV+LG G+FHTLSDGL
Sbjct  106   SCVDDFGDFTPSLELRKLIPSVETSGDISTFPLVIFQITRFKCGGVALGGGVFHTLSDGL  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S++HFI TW+D+ARGLSVA+PPFIDRT+LRARDPP  +F+H EY  PPTL S    +   
Sbjct  166   SSIHFINTWSDIARGLSVAVPPFIDRTLLRARDPPTYSFEHVEYHPPPTLNSSKNRE---  222

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIATDG  531
              + +T MLK + +QL LLK+ S +EGSTYEILAAHIWRC C+ARGL +DQ TKL++ATDG
Sbjct  223   -SSTTTMLKFSSEQLGLLKSKSKNEGSTYEILAAHIWRCTCKARGLPEDQLTKLHVATDG  281

Query  530   RSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYL  351
             RSRLCP LPPG+LGNV+FTATP+A+S EL +EPL +S KRI + L++MDD YLRSALDYL
Sbjct  282   RSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLTNSVKRIHNELIKMDDNYLRSALDYL  341

Query  350   ECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPS  171
             E QPDLS L+RG  YFASPNLNINSWTRLPVH  DFGWG P+HMGPA ILYEGT+YI+PS
Sbjct  342   ELQPDLSTLIRGPAYFASPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTIYIIPS  401

Query  170   PN-KDRSLSLAVCLDADHMPLFQKLLYKF  87
             PN KDR+L LAVCLDA HM LF+K LY+ 
Sbjct  402   PNSKDRNLRLAVCLDAGHMSLFEKYLYEL  430



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   501 bits (1291),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 231/331 (70%), Positives = 280/331 (85%), Gaps = 3/331 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +++DDFGDF PSLELR+L+P+VD SGDISS+PL +FQVTRFKCG  +LG G+ H LSDG+
Sbjct  100   SSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGV  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI  W+D+AR L++A+PPFIDRT++RARDPP P F+H EY  PP LKS    +   
Sbjct  160   SSLHFINAWSDIARDLTIAVPPFIDRTLIRARDPPVPVFEHVEYYPPPQLKSDSRIQELK  219

Query  710   ANP---STAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
               P   +TA+LKITP+QL+ LK  +++EGSTYEILAAHIWR  C+ARGL++DQ+TKLY+A
Sbjct  220   TGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQSTKLYVA  279

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRL P LPPG+LGNV+FTATP+AES  L +EPL +SAKRI +AL RMD++YLRSAL
Sbjct  280   TDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSAL  339

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDLS LVRG  +FASPNLNINSWTRLP H++DFGWG P+H+GPA+ILYEGTVY+
Sbjct  340   DYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYV  399

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP KDR+LSLAVCLDADHMPLFQK LY F
Sbjct  400   LPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score =   499 bits (1286),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 277/327 (85%), Gaps = 2/327 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDFTP LEL+KL+PSV+TSGDIS+FPLA+FQVTRFKCGG++LG G+FHTLSDGL
Sbjct  106   SCIDDFGDFTPCLELKKLIPSVETSGDISTFPLAIFQVTRFKCGGIALGGGVFHTLSDGL  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGLSVA+PPFIDRT+L ARDPP  +F+H EY  PPTL S    +  G
Sbjct  166   SSLHFINTWSDIARGLSVAVPPFIDRTLLHARDPPTSSFEHVEYHPPPTLISSKKGESTG  225

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIATD  534
                ST AMLK + +Q+ LLK+ S +EGSTYEILAAHIWRC  +ARGL+DDQ TKL++ATD
Sbjct  226   PKSSTTAMLKFSSEQVGLLKSKSENEGSTYEILAAHIWRCTSKARGLADDQLTKLHVATD  285

Query  533   GRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDY  354
             GRSRLCP LPPG+LGNV+FTATP+A+S EL +EPL +S KRI + L++MDD YLRSALDY
Sbjct  286   GRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIHNELIKMDDNYLRSALDY  345

Query  353   LECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILP  174
             LE QPDLS L+RG  YF SPNLNINSWTRLPVH  DFGWG P+HMGPA ILYEGT+YI+P
Sbjct  346   LELQPDLSTLIRGPTYFTSPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTIYIIP  405

Query  173   SPN-KDRSLSLAVCLDADHMPLFQKLL  96
             SPN KDR+L LAVCLD DHMPLF+K L
Sbjct  406   SPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score =   498 bits (1281),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 235/327 (72%), Positives = 277/327 (85%), Gaps = 2/327 (1%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDFTP LEL+KL+PSV+TSGDIS+FPLA+FQVTRFKCGG++LG G+FHTLSDGL
Sbjct  106   SCIDDFGDFTPCLELKKLIPSVETSGDISTFPLAIFQVTRFKCGGIALGGGVFHTLSDGL  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S+LHFI TW+D+ARGLSVA+PPFIDRT+L AR+PP  +F+H EY  PPTL S    +  G
Sbjct  166   SSLHFINTWSDIARGLSVAVPPFIDRTLLHAREPPTSSFEHVEYHPPPTLISSKKGESTG  225

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIATD  534
                ST AMLK + +Q+ LLK+ S +EGSTYEILAAHIWRC  +ARGL+DDQ TKL++ATD
Sbjct  226   PKSSTTAMLKFSSEQVGLLKSKSENEGSTYEILAAHIWRCTSKARGLADDQLTKLHVATD  285

Query  533   GRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDY  354
             GRSRLCP LPPG+LGNV+FTATP+A+S EL +EPL +S KRI + L++MDD YLRSALDY
Sbjct  286   GRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIPNELIKMDDNYLRSALDY  345

Query  353   LECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILP  174
             LE QPDLS L+RG  YF SPNLNINSWTRLPVH  DFGWG P+HMGPA ILYEGT+YI+P
Sbjct  346   LELQPDLSTLIRGPTYFTSPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTIYIIP  405

Query  173   SPN-KDRSLSLAVCLDADHMPLFQKLL  96
             SPN KDR+L LAVCLD DHMPLF+K L
Sbjct  406   SPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 223/333 (67%), Positives = 274/333 (82%), Gaps = 5/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +T+DDFG+FTPS ELR+L P+VD SGDISS+PL   QVT FKCGGV+LG G+FHTL+DGL
Sbjct  117   STLDDFGEFTPSPELRRLTPTVDYSGDISSYPLFFAQVTHFKCGGVALGCGVFHTLADGL  176

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S++HFI TW+D+ARGLS+AIPPFIDRT+LRAR+PP P F H EY  PP++K+   +    
Sbjct  177   SSIHFINTWSDMARGLSIAIPPFIDRTLLRAREPPTPTFDHIEYHAPPSMKTISQNPESS  236

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGS-----TYEILAAHIWRCVCEARGLSDDQTTKLY  546
               PST +LK+T  QL +LK ++ ++GS     TYEILAAH+WRC C+ARGL DDQ TKLY
Sbjct  237   RKPSTTVLKLTLDQLNVLKASAKNDGSNTTYSTYEILAAHLWRCACKARGLPDDQLTKLY  296

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +ATDGRSRL P LPPG+LGNV+FT TPVA+SG+L T+ L+++A  IR+ L +MD+ YLRS
Sbjct  297   VATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTTQSLSNAASLIRTTLTKMDNNYLRS  356

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             A+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPVH++DFGWG PV MGPA ILYEGT+
Sbjct  357   AIDYLEVQPDLSALIRGPSYFASPNLNINTWTRLPVHDADFGWGRPVFMGPACILYEGTI  416

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             Y+LPSPN DRS+SLAVCLDAD  PLF+K LY F
Sbjct  417   YVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  449



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 227/331 (69%), Positives = 270/331 (82%), Gaps = 7/331 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             +DDFGDFTPS E+R+L P+VD SGDISS+PL + QVT FKCGGVSLG G+ HTLSDG+S+
Sbjct  111   VDDFGDFTPSTEMRRLTPTVDYSGDISSYPLIILQVTYFKCGGVSLGVGVHHTLSDGVSS  170

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHFI TW+D+ARGLS+AIPPFIDRT+LR R PP P F H EY  PP++ + PLS   G  
Sbjct  171   LHFINTWSDMARGLSIAIPPFIDRTLLRPRTPPTPTFDHVEYHPPPSMITKPLSGPKGV-  229

Query  704   PSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              STA+LK++  QL  LK  + +EG     STYEILAAH+WRC C+AR LS +QT+KLYIA
Sbjct  230   -STAILKLSLDQLTTLKAKAKNEGNGKDHSTYEILAAHLWRCACKARDLSANQTSKLYIA  288

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRLCP LPPG+LGNV+FTATP+A+SG+L  EP+ S+AKRI ++L RMD+EYLRSAL
Sbjct  289   TDGRSRLCPPLPPGYLGNVVFTATPMADSGDLQAEPVTSTAKRIHNSLTRMDNEYLRSAL  348

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             D+LE  PDL  LVRG NYFASPNLNINSWTRLPVH++DFGWG P+ MGPA ILYEGT+YI
Sbjct  349   DFLETTPDLKTLVRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMGPASILYEGTIYI  408

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +PS   DRSLSLAVCLDA HM  F+K LY+F
Sbjct  409   IPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score =   475 bits (1223),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 221/333 (66%), Positives = 272/333 (82%), Gaps = 5/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +T+DDFG+FTPS ELR+L P+VD SGDISS+PL   QVT FKCGGV+LG G+FH L+DGL
Sbjct  100   STLDDFGEFTPSPELRRLTPTVDYSGDISSYPLFFAQVTHFKCGGVALGCGVFHALADGL  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S++HFI TW+D+ARGLS+AIPPFIDRT+LRAR+PP P F H EY  PP++K+   +    
Sbjct  160   SSIHFINTWSDMARGLSIAIPPFIDRTLLRAREPPTPTFDHIEYHAPPSMKTISQNPESS  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGS-----TYEILAAHIWRCVCEARGLSDDQTTKLY  546
               PST +LK+T  QL +LK ++ ++GS     TYEILAAH+WRC C+ARGL DDQ TKLY
Sbjct  220   RKPSTTVLKLTLDQLNVLKASTKNDGSNTTYSTYEILAAHLWRCACKARGLPDDQLTKLY  279

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +ATDGRSRL P LPPG+LGNV+FT TPVA+SG+L T+ L+++A  IR+ L +MD+ YLRS
Sbjct  280   VATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTTQSLSNAASLIRTTLTKMDNNYLRS  339

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             A+DY E QPDLS L+RG +YFASPNLNIN+WTRLPVH++DFGWG PV MGPA ILYEGT+
Sbjct  340   AIDYPEVQPDLSALIRGPSYFASPNLNINTWTRLPVHDADFGWGRPVFMGPACILYEGTI  399

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             Y+LPSPN DRS+SLAVCLDAD  PLF+K LY F
Sbjct  400   YVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  432



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   474 bits (1220),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/331 (69%), Positives = 269/331 (81%), Gaps = 7/331 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             +DDFGDFTPS E+R+L P+VD SG ISS+PL + QVT FKCGGVSLG G+ HTLSDG+S+
Sbjct  111   VDDFGDFTPSSEMRRLTPTVDYSGAISSYPLIILQVTYFKCGGVSLGVGVHHTLSDGVSS  170

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHFI TW+D+ARGLS+AIPPFIDRT+LR R PP P F H EY  PP++ + PLS   G  
Sbjct  171   LHFINTWSDMARGLSIAIPPFIDRTLLRPRIPPTPTFDHVEYHPPPSMITKPLSGPKGV-  229

Query  704   PSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              STA+LK++  QL  LK  + +EG     STYEILAAH+WRC C+AR LS +QT+KLYIA
Sbjct  230   -STAILKLSLDQLTTLKAKAKNEGNGKDHSTYEILAAHLWRCACKARDLSPNQTSKLYIA  288

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRLCP LPPG+LGNV+FTATP+AESG+L  EP+ S+AKRI ++L RMD+EYLRSAL
Sbjct  289   TDGRSRLCPPLPPGYLGNVVFTATPMAESGDLQVEPVTSTAKRIHNSLTRMDNEYLRSAL  348

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             D+LE  PDL  LVRG NYFASPNLNINSWTRLPVH++DFGWG P+ MGPA ILYEGT+YI
Sbjct  349   DFLETTPDLKTLVRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMGPASILYEGTIYI  408

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +PS   DRSLSLAVCLDA HM  F+K LY+F
Sbjct  409   IPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 223/338 (66%), Positives = 276/338 (82%), Gaps = 10/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +T+DDFGDFTPS E R+L P VD SGDISS+PL   QVT FKCGGVSLG G+ HTLSDG+
Sbjct  106   STVDDFGDFTPSAEQRQLAPMVDYSGDISSYPLFFAQVTYFKCGGVSLGCGVHHTLSDGV  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRAR-DPPCPAFKHTEYDHPPTLKSGPLSKLP  714
             S+LHFI TW+D+ARGLS+AIPPFIDRT+LRAR  PP P F H EY  PP++ +   +  P
Sbjct  166   SSLHFINTWSDIARGLSIAIPPFIDRTLLRARLQPPRPVFDHVEYHPPPSMNASVQNTNP  225

Query  713   GANP---STAMLKITPQQLALLKTNSSHEGST------YEILAAHIWRCVCEARGLSDDQ  561
              ++P   STA+LK+T  QL  LK  + ++G+T      Y ILAAH+WRC C+ARGL DDQ
Sbjct  226   KSSPKPVSTAILKLTLDQLNELKAKTKNDGNTREQYSSYVILAAHLWRCACKARGLPDDQ  285

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY+ATDGR RL P LPPG+LGNV+FTATPVAESGE++++PL++SAK+I +AL +MDD
Sbjct  286   LTKLYVATDGRFRLSPTLPPGYLGNVVFTATPVAESGEIVSQPLSNSAKKIHNALAKMDD  345

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYLRSALDYLE QPDL  L+RG NYFA PNLNINSWTRLP++++DFGWG P+ MGPA IL
Sbjct  346   EYLRSALDYLESQPDLGALIRGPNYFACPNLNINSWTRLPIYDADFGWGRPIFMGPASIL  405

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEGT+Y++PSP+ +RS+SLA+CL+ADHMPLF+K LY+F
Sbjct  406   YEGTIYVIPSPDNNRSVSLALCLEADHMPLFEKYLYEF  443



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   464 bits (1194),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/339 (66%), Positives = 270/339 (80%), Gaps = 16/339 (5%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +T+DDFG+  PS E R+L PSVD SGDISS+PL   QVT FKCGGV+LG G+ HTLSDGL
Sbjct  110   STLDDFGELKPSPEFRQLTPSVDYSGDISSYPLFFAQVTHFKCGGVALGCGVHHTLSDGL  169

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK-------SG  732
             S+LHFI TW+D+ARGLSVAIPPFI+RT+LRAR+PP P + H EY  PP++        SG
Sbjct  170   SSLHFINTWSDMARGLSVAIPPFIERTLLRAREPPTPTYDHVEYHSPPSMNTTAQKPGSG  229

Query  731   PLSKLPGANPSTAMLKITPQQLALLKTNSSHEG----STYEILAAHIWRCVCEARGLSDD  564
              LSK      ST MLK+T  QL  LK  +  E     STYEILAAHIWRC C+ARGL DD
Sbjct  230   SLSK-----SSTTMLKLTLDQLNSLKAKAKSESGSTHSTYEILAAHIWRCACKARGLPDD  284

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q +KLY+ATDGRSRL P LPPG+LGNV+FTATPVA+SG+L ++ L+++AK I + L +MD
Sbjct  285   QLSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTSKSLSNTAKLIHTTLTKMD  344

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             D+YLRSA+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPV+++DFGWG P+ MGPA I
Sbjct  345   DDYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPVYDADFGWGRPIFMGPACI  404

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LYEGT+Y+LPSPN DRS+SLAVCLDA+  PLF+K LY+F
Sbjct  405   LYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   463 bits (1191),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 225/334 (67%), Positives = 270/334 (81%), Gaps = 7/334 (2%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             +IDDFG+ TPS ELRKL P+VD S  +SS+PL + QVTRF CGGVSLG G+ HTLSDGLS
Sbjct  101   SIDDFGEITPSPELRKLAPTVDYSDQVSSYPLCITQVTRFNCGGVSLGCGLHHTLSDGLS  160

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGA  708
             +LHFI TW+D ARGLSVAIPPFIDR++LRARDPP   F+H EY  PP+L +   ++   +
Sbjct  161   SLHFINTWSDKARGLSVAIPPFIDRSLLRARDPPTAMFEHLEYHSPPSLIAPSQNQNFTS  220

Query  707   NP---STAMLKITPQQLALLKTNSSHEGS----TYEILAAHIWRCVCEARGLSDDQTTKL  549
             +P   STAML++T  Q+  LK+ +  +GS    TYEILAAH+WRC CEARGLSDDQ TKL
Sbjct  221   HPKLASTAMLRLTLDQINGLKSKAKGDGSVYHSTYEILAAHLWRCACEARGLSDDQPTKL  280

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             Y+ATDGRSRL P LPPG+LGNV+FTATP+A+SGE  +E LA +A+RI S L +MDD+YLR
Sbjct  281   YVATDGRSRLNPPLPPGYLGNVVFTATPIAKSGEFKSESLADTARRIHSELAKMDDQYLR  340

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SA+DYLE QPDL+ LVRG  YFASPNLNINSWTRLP++ SDFGWG P+ MGPA ILYEGT
Sbjct  341   SAIDYLELQPDLTALVRGPTYFASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGT  400

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +YI+PSP+ DRS+SLAVCLD DHM LF+K LY F
Sbjct  401   IYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   463 bits (1191),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 222/339 (65%), Positives = 270/339 (80%), Gaps = 16/339 (5%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +T+DDFG+  PS E R+L PSVD SGDISS+PL   QVT FKCGGV+LG G+ HTLSDGL
Sbjct  110   STLDDFGELKPSPEFRQLTPSVDYSGDISSYPLFFAQVTHFKCGGVALGCGVHHTLSDGL  169

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK-------SG  732
             S+LHFI TW+D+ARGLSVAIPPFI+RT+LRAR+PP P + H EY  PP++        SG
Sbjct  170   SSLHFINTWSDMARGLSVAIPPFIERTLLRAREPPTPTYDHVEYHSPPSMNTTAQKPGSG  229

Query  731   PLSKLPGANPSTAMLKITPQQLALLKTNSSHEG----STYEILAAHIWRCVCEARGLSDD  564
              LSK      ST MLK+T  QL  LK  +  E     STYEILAAHIWRC C+ARGL DD
Sbjct  230   SLSK-----SSTTMLKLTLDQLNSLKAKAKSESGSTHSTYEILAAHIWRCACKARGLPDD  284

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q +KLY+ATDGRSRL P LPPG++GNV+FTATPVA+SG+L ++ L+++AK I + L +MD
Sbjct  285   QLSKLYVATDGRSRLSPRLPPGYVGNVVFTATPVAKSGDLTSKSLSNTAKLIHTTLTKMD  344

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             D+YLRSA+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPV+++DFGWG P+ MGPA I
Sbjct  345   DDYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPVYDADFGWGRPIFMGPACI  404

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LYEGT+Y+LPSPN DRS+SLAVCLDA+  PLF+K LY+F
Sbjct  405   LYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   459 bits (1182),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 268/334 (80%), Gaps = 7/334 (2%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             +IDDFG+ TPS ELRKL P+VD S  ISS+PL + QVTRF CGGVSLG G+ HTLSDGLS
Sbjct  101   SIDDFGEITPSPELRKLAPTVDYSDQISSYPLCITQVTRFNCGGVSLGCGLHHTLSDGLS  160

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGA  708
             +LHFI TW+D ARGLSVAIPPFIDR++LRARDPP   F+H EY  PP+L +   ++   +
Sbjct  161   SLHFINTWSDKARGLSVAIPPFIDRSLLRARDPPTAMFEHLEYHSPPSLIAPSQNQNSTS  220

Query  707   NP---STAMLKITPQQLALLKTNSSHEGS----TYEILAAHIWRCVCEARGLSDDQTTKL  549
             +P   ST ML++T  Q+  LK+ +  +GS    TYEILAAH+WRC C+ARGLSDDQ TKL
Sbjct  221   HPKLASTTMLRLTLDQINGLKSKAKGDGSVYHSTYEILAAHLWRCACKARGLSDDQPTKL  280

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             Y+ATDGRSRL P LPPG+LGNV+FTATP+A+SGE  +E LA +A+RI   L +MDD+YLR
Sbjct  281   YVATDGRSRLSPPLPPGYLGNVVFTATPIAKSGEFKSESLADTARRIHIELAKMDDQYLR  340

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SA+DYLE QPDL+ LVRG  YFASPNLNINSWTRLP++ SDFGWG P+ MGPA ILYEGT
Sbjct  341   SAIDYLELQPDLTALVRGPTYFASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGT  400

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +YI+PSP+ DRS+SLAVCLD DHM LF+K LY F
Sbjct  401   IYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   457 bits (1177),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 268/334 (80%), Gaps = 7/334 (2%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             +IDDFG+ TPS ELRKL P+VD S  +SS+PL + QVTRF CGGVSLG G+ HTLSDGLS
Sbjct  101   SIDDFGETTPSPELRKLAPTVDYSDQVSSYPLCITQVTRFNCGGVSLGCGLHHTLSDGLS  160

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGA  708
             +LHFI TW+D ARGLSVAIPPFIDR++LRARDPP   F+H EY  PP+L +   ++   +
Sbjct  161   SLHFINTWSDKARGLSVAIPPFIDRSLLRARDPPTAMFEHLEYHSPPSLIAPSQNQNFTS  220

Query  707   NP---STAMLKITPQQLALLKTNSSHEGS----TYEILAAHIWRCVCEARGLSDDQTTKL  549
             +P   STAML++T  Q+  LK+ +  +GS    TYEILAAH+WRC CEARGLSDDQ TKL
Sbjct  221   HPKLASTAMLRLTLDQINGLKSKAKGDGSVYHSTYEILAAHLWRCACEARGLSDDQPTKL  280

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             Y+ATDGRSRL P LPPG+LGNV+F ATP+A+SGE  +E LA +A+RI S L +M D+YLR
Sbjct  281   YVATDGRSRLNPPLPPGYLGNVVFKATPIAKSGEFKSESLADTARRIHSELAKMGDQYLR  340

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SA+DYLE QPDL+ LVRG  YFASPNLNINSWTRLP++ SDFGWG P+ MGPA ILYEGT
Sbjct  341   SAIDYLELQPDLTALVRGPTYFASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGT  400

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +YI+PSP+ DRS+SLAVCLD DHM LF+K LY F
Sbjct  401   IYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score =   457 bits (1177),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 221/339 (65%), Positives = 267/339 (79%), Gaps = 16/339 (5%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +T+DDFG+  PS   R+L PSVD SGDISS+PL   QVT FKCGGV+LG G+ HTLSDGL
Sbjct  110   STLDDFGELKPSPVFRQLTPSVDYSGDISSYPLLFAQVTHFKCGGVALGCGVHHTLSDGL  169

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK-------SG  732
             S LHFI TW+D+ARGLSVAIPPFI+RT+LRAR+PP P + H EY  PP++        SG
Sbjct  170   SLLHFINTWSDMARGLSVAIPPFIERTLLRAREPPTPTYDHVEYHSPPSMNTTAQKPGSG  229

Query  731   PLSKLPGANPSTAMLKITPQQLALLKTNSSHEG----STYEILAAHIWRCVCEARGLSDD  564
              LSK      ST MLK+T  QL  LK  +  E     STYEILAAHIWRC C+ARGL DD
Sbjct  230   SLSK-----SSTTMLKLTLDQLNSLKAKAKSESGSTHSTYEILAAHIWRCACKARGLPDD  284

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q +KLY+ATDGRSRL P LPPG+LGNV+FTATPVA+SG+L ++ L+++AK I + L +MD
Sbjct  285   QLSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTSKSLSNTAKLIHTTLTKMD  344

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             D+YLRSA+DYLE QPDLS L+RG +YFASPNLNIN+WTRLPV+++D GWG P+ MGPA I
Sbjct  345   DDYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPVYDADLGWGRPIFMGPACI  404

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LYEGT+Y+LPSPN DRS+SLAVCLDA+  PLF+K LY+F
Sbjct  405   LYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   429 bits (1104),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 254/336 (76%), Gaps = 8/336 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P++EL++L+P+VD SGDISS+PL + Q+TRFKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTMELKQLIPAVDYSGDISSYPLLVLQITRFKCGGVSLGVGMQHHVADGS  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P+F H EY   P +K  P +    
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPTPSFHHIEYQPAPPMKHPPETPNSQ  219

Query  710   ANP---STAMLKITPQQLALLKTNS-----SHEGSTYEILAAHIWRCVCEARGLSDDQTT  555
             + P   +  M KI+  QL +LK  S     S   S+YE+LA H+WRCVC+ARGL DDQ T
Sbjct  220   SGPESTTVTMFKISRDQLNILKAKSKDGANSVNYSSYEMLAGHVWRCVCKARGLPDDQDT  279

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYIATDGRSRL P LPPG+ GN IFTATP+A SG+LL++PL  +A RI  ALVRMDDEY
Sbjct  280   KLYIATDGRSRLRPPLPPGYFGNGIFTATPIAVSGDLLSKPLTYAAGRIHDALVRMDDEY  339

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALDYLE QPDL+ LVRG++ F  PN+ I SW RLP+H++DFGWG P+ MGP  I YE
Sbjct  340   LRSALDYLELQPDLTVLVRGAHTFRCPNIGITSWVRLPIHDADFGWGRPIFMGPGGIAYE  399

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  ++LPSP  D +LSLA+ L +DHM +FQK+LY F
Sbjct  400   GLAFLLPSPVNDGNLSLAISLQSDHMKVFQKILYDF  435



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/331 (61%), Positives = 250/331 (76%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SG IS++PL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPTVDYSGGISTYPLLVLQVTYFKCGGASLGVGMQHHAADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY  PP L + P S  P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHIEYQPPPALNTPPQSTGPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K+T +QL  LK  S  +G     S+YE+L+ H+WR VC+ARGL+DDQ TKLY
Sbjct  220   ST-AVSIFKLTREQLNALKAKSKEDGNSVNYSSYEMLSGHVWRSVCKARGLTDDQGTKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G+L+ +P   +A RI  ALVRMDDEYLRS
Sbjct  279   IATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLMLKPTWYAASRIHDALVRMDDEYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALD+LE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDFLELQPDLSALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIPYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSPN D SLS+A+ L  +HM +F+KL Y
Sbjct  399   FVLPSPNNDGSLSVAISLQTEHMKVFEKLFY  429



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score =   422 bits (1085),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 246/333 (74%), Gaps = 8/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDF P+LELR+L+P VD S  IS+FPL + QVTRFKCGGVSLG GI H ++DGL
Sbjct  100   AVVDDFGDFAPTLELRRLIPPVDYSQGISTFPLVVLQVTRFKCGGVSLGVGIHHIVADGL  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             SALHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F+H EY  PPT+      K+  
Sbjct  160   SALHFINTWSDMARGLDITIPPFIDRTLLRARDPPQPKFEHIEYQPPPTMAIHDSQKI-N  218

Query  710   ANPST--AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             A P T  A+LK+T  QL  LK  S  +G+T     YEILAAHIW C C ARGL D+Q TK
Sbjct  219   AAPRTVVAILKLTRGQLNTLKAKSKEDGNTVTYSSYEILAAHIWVCACRARGLVDEQKTK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L+IAT+GRSRL P LPPG+ GNVIFT TPV  SGEL ++P++ +A +I   LVRMDDEYL
Sbjct  279   LFIATNGRSRLRPPLPPGYFGNVIFTTTPVGVSGELQSKPISYTAGKIHDVLVRMDDEYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG+N F  PNL I SW  LP+H++DFGWG PV MGP  ILYEG
Sbjct  339   RSALDYLEVQPDLMALVRGANTFNCPNLAITSWVGLPIHDADFGWGRPVFMGPGSILYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
                +LPSP  D SLS+AV L  + M +F+KL Y
Sbjct  399   LCVVLPSPTNDGSLSVAVSLQEEPMKVFEKLFY  431



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score =   421 bits (1083),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/331 (63%), Positives = 246/331 (74%), Gaps = 7/331 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDD GDFT S +L  L+P VD SG ISSFPL + QVT FKCG VSLG G+ H L+DG SA
Sbjct  102   IDDLGDFTDSSKLLPLVPEVDYSGGISSFPLVVLQVTHFKCGAVSLGVGLHHILADGTSA  161

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHFI +W+D+ARGL V+ PPFIDRT+LRARDPP P F H EYD PPT+ + P S+     
Sbjct  162   LHFINSWSDVARGLPVSTPPFIDRTLLRARDPPNPTFHHVEYDPPPTMNTPPQSQ--PKT  219

Query  704   PSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
               T +LKITP+QL  LK     E      STYE + AHIWR +C+ARGLSDDQ +KLYI+
Sbjct  220   TCTKILKITPEQLGSLKAKVRTEDGAVRHSTYETITAHIWRSMCKARGLSDDQASKLYIS  279

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRL P LPPG+LGNV+FT T +  SGE+ ++PLA + +RI  ALVRMDDEYLRSAL
Sbjct  280   TDGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPLARTMERIHEALVRMDDEYLRSAL  339

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DY+E QPDL+ L RG + +ASPNLNI SW RLPVH++DFGWG PV MGPA +  EG  YI
Sbjct  340   DYIEAQPDLNALKRGPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYI  399

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             L SP  D SLSL +CL+A HMPLF+K LY F
Sbjct  400   LRSPVNDGSLSLFICLEAQHMPLFEKCLYDF  430



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   421 bits (1083),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 247/333 (74%), Gaps = 6/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELRKL+P+VD S  ISS+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  104   SVIDDFGDFAPTLELRKLIPTVDYSQGISSYSLLVLQLTYFKCGGVSLGVGMQHHAADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TWAD+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTLK+ P      
Sbjct  164   SGLHFINTWADMARGLDLTIPPFIDRTLLRARDPPQPKFHHVEYQPPPTLKN-PTEPSTP  222

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
                + A+ KI+ +Q++ LK  S  +G+T     YE+L+ H+WRCVC+ARGL +DQ TKLY
Sbjct  223   EEATVAIFKISREQISTLKAKSKEDGNTIPYSSYEMLSGHVWRCVCQARGLENDQGTKLY  282

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFT TPVA++G+L ++P   +A RI  AL RMD+EYLRS
Sbjct  283   IATDGRSRLNPTLPPGYFGNVIFTTTPVAQAGDLASKPTWYAASRIHDALARMDNEYLRS  342

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL+ LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  I YEG  
Sbjct  343   ALDYLELQPDLTALVRGAHTFRCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIPYEGLA  402

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             Y+LPSP  D SLSLA+ L  +HM LF K LY+ 
Sbjct  403   YMLPSPVNDGSLSLAIALQPEHMKLFSKYLYEI  435



>gb|AID69225.1| hydroxycinnamoyl coenzyme A shikimate hydroxycinnamoyl transferase, 
partial [Garcinia mangostana]
Length=367

 Score =   419 bits (1076),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/331 (60%), Positives = 248/331 (75%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+ +L++L+PS+D SGDI SFPL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  36    SVIDDFGDFAPTPDLKQLIPSIDYSGDIGSFPLLVLQVTYFKCGGVSLGVGMQHHVADGY  95

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF+H EY  PP LKS P   L  
Sbjct  96    SGLHFVNTWSDMARGLDITIPPFIDRTLLRARDPPQPAFQHIEYQPPPPLKS-PSQTLKP  154

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              +   A+ K +  Q++ LK  +   G+T     YE+LA H+WRC C+ARGL+DDQ TKLY
Sbjct  155   DSTKVAIFKFSKGQISALKAKAKEAGNTVSYSSYEMLAGHVWRCTCKARGLADDQETKLY  214

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P   +A RI  AL RMD+EYLRS
Sbjct  215   IATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLQSKPTWYAASRIHGALSRMDNEYLRS  274

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  275   ALDYLELQPDLSALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  334

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +ILPS   D S+S+A+ L ++HM LF+KLLY
Sbjct  335   FILPSATIDGSMSVAIALQSEHMKLFEKLLY  365



>gb|KJB56501.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56503.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56504.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=431

 Score =   419 bits (1077),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 200/331 (60%), Positives = 247/331 (75%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SG IS++PL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPTVDYSGGISTYPLLVLQVTYFKCGGASLGVGMQHHAADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PP +K  P S  P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHVEYQPPPAMKIPPQSTGPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K+T  QL  LK     +G     S+YE+L+ H+WR VC+ARGL DDQ TKLY
Sbjct  220   ST-AISIFKLTRDQLNALKAKCKEDGNDVNYSSYEMLSGHVWRSVCKARGLEDDQGTKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P LPPG+ GNVIFTATP+A +G+LL++P   +A RI  ALVRMDDEYLRS
Sbjct  279   IATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDALVRMDDEYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIPYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSPN D SLS+A+ L  +HM +F+KL Y
Sbjct  399   FVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  429



>gb|AGE10604.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera hypoglauca]
Length=296

 Score =   414 bits (1064),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 238/297 (80%), Gaps = 6/297 (2%)
 Frame = -2

Query  962  QVTRFKCGGVSLGTGIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPC  783
            QVT FKCGGVSLG G+ HTLSDG+S+LHFI TW+D AR LS+A+PPFIDRT+LRAR PP 
Sbjct  1    QVTYFKCGGVSLGVGVHHTLSDGVSSLHFINTWSDTARSLSIAVPPFIDRTLLRARTPPT  60

Query  782  PAFKHTEYDHPPTLKSGPLSKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEI  618
            P F H EY  PP++ + P    P A  STA+LK+T  QL  LK+ + ++G     STYE+
Sbjct  61   PTFDHVEYHAPPSMNTAPAQSSPKA-VSTAILKLTLDQLNNLKSTAKNDGTTKDYSTYEV  119

Query  617  LAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLT  438
            LAAH+WRC C+ARGL+ DQ +KLYIATDGR+RLC  LP G+LGNV+FTATP+A SG+L+ 
Sbjct  120  LAAHLWRCACKARGLAKDQMSKLYIATDGRARLCSPLPFGYLGNVVFTATPMAVSGDLVA  179

Query  437  EPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPV  258
            EP+  S++RI SAL +MD+ YLRSALDYLE  PDL  LVRG +YFASPNLNINSW+RLPV
Sbjct  180  EPIIDSSRRIHSALTQMDNGYLRSALDYLELLPDLKALVRGPHYFASPNLNINSWSRLPV  239

Query  257  HNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
            +++DFGWG P+ MGPA ILYEGT+YI+PSP  DRSLSLAVCLD  HMPLF+K LY+F
Sbjct  240  YDADFGWGRPIFMGPASILYEGTIYIIPSPTNDRSLSLAVCLDVGHMPLFKKYLYEF  296



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
 gb|KJB56502.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=499

 Score =   419 bits (1078),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 200/331 (60%), Positives = 247/331 (75%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SG IS++PL + QVT FKCGG SLG G+ H  +DG 
Sbjct  168   SVIDDFGDFAPTLELRQLIPTVDYSGGISTYPLLVLQVTYFKCGGASLGVGMQHHAADGY  227

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PP +K  P S  P 
Sbjct  228   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHVEYQPPPAMKIPPQSTGPE  287

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K+T  QL  LK     +G     S+YE+L+ H+WR VC+ARGL DDQ TKLY
Sbjct  288   ST-AISIFKLTRDQLNALKAKCKEDGNDVNYSSYEMLSGHVWRSVCKARGLEDDQGTKLY  346

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P LPPG+ GNVIFTATP+A +G+LL++P   +A RI  ALVRMDDEYLRS
Sbjct  347   IATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDALVRMDDEYLRS  406

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  407   ALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIPYEGLS  466

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSPN D SLS+A+ L  +HM +F+KL Y
Sbjct  467   FVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  497



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   416 bits (1070),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 200/333 (60%), Positives = 246/333 (74%), Gaps = 8/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SGDI S+ L + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPTVDYSGDIGSYSLLILQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY  PP LK+ PL     
Sbjct  160   SGLHFINTWSDMARGLDITIPPFIDRTLLRARDPPQPAFHHIEYQPPPQLKT-PLPNT--  216

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              N +  + +IT  QL  LK  S  +G+T     Y +LA H+WRC C+AR L  DQ +K+Y
Sbjct  217   QNTNVCIFRITRDQLNTLKNKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMY  276

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL PALPPG+ GNVIFT TPVA +GEL+++PL  +A +I +AL RMDDEYLRS
Sbjct  277   IATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRS  336

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL+ LVRG++ F  PN+ I SWTRLP++++DFGWG P+ MGP  I  EG  
Sbjct  337   ALDYLEIQPDLTALVRGAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLA  396

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             + LPSP  D SLS+A+ L  DHM LFQK LY+ 
Sbjct  397   FALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  429



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   416 bits (1070),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 200/333 (60%), Positives = 246/333 (74%), Gaps = 8/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SGDI S+ L + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPTVDYSGDIGSYSLLILQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY  PP LK+ PL     
Sbjct  160   SGLHFINTWSDMARGLDITIPPFIDRTLLRARDPPQPAFHHIEYQPPPQLKT-PLPNT--  216

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              N +  + +IT  QL  LK  S  +G+T     Y +LA H+WRC C+AR L  DQ +K+Y
Sbjct  217   QNTNVCIFRITRDQLNTLKNKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMY  276

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL PALPPG+ GNVIFT TPVA +GEL+++PL  +A +I +AL RMDDEYLRS
Sbjct  277   IATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRS  336

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL+ LVRG++ F  PN+ I SWTRLP++++DFGWG P+ MGP  I  EG  
Sbjct  337   ALDYLELQPDLTALVRGAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLA  396

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             + LPSP  D SLS+A+ L  DHM LFQK LY+ 
Sbjct  397   FALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  429



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score =   416 bits (1070),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 205/330 (62%), Positives = 245/330 (74%), Gaps = 7/330 (2%)
 Frame = -2

Query  1061  DDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSAL  882
             DD GDFT S +L  L+P VD +G ISSFPL + QVTRFKCG VSLG G+ H L+DG SAL
Sbjct  103   DDLGDFTDSSKLLPLVPEVDYAGGISSFPLVVLQVTRFKCGAVSLGVGLHHILADGTSAL  162

Query  881   HFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANP  702
             HFI +W+D+ARGL V+ PPFIDRT+LRARDPP P F H+EYD PPT+ + P S+      
Sbjct  163   HFINSWSDVARGLPVSTPPFIDRTLLRARDPPHPTFHHSEYDPPPTMNTPPRSQ--PKTT  220

Query  701   STAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIAT  537
              T +LKITP+QL  LK     E      STYE + AHIWR +C+ARGLSDDQ +KLYI+T
Sbjct  221   CTKILKITPEQLGSLKAKVRTEDGAARHSTYETITAHIWRSMCKARGLSDDQASKLYIST  280

Query  536   DGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALD  357
             DGRSRL P LPPG+LGNV+FT T +  SGE+ ++PL  + +RI  AL RMDDEYLRSALD
Sbjct  281   DGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPLVRTMERIHEALGRMDDEYLRSALD  340

Query  356   YLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYIL  177
             Y+E QPDL+ L RG + +ASPNLNI SW RLPVH++DFGWG PV MGPA +  EG  YIL
Sbjct  341   YIEAQPDLNALKRGPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYIL  400

Query  176   PSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              SP  D SLSL +CL+A HMPLF+K LY F
Sbjct  401   RSPVNDGSLSLFICLEAQHMPLFEKCLYDF  430



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score =   416 bits (1070),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/330 (62%), Positives = 245/330 (74%), Gaps = 7/330 (2%)
 Frame = -2

Query  1061  DDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSAL  882
             DD GDFT S +L  L+P VD +G ISSFPL + QVTRFKCG VSLG G+ H L+DG SAL
Sbjct  111   DDLGDFTDSSKLLPLVPEVDYAGGISSFPLVVLQVTRFKCGAVSLGVGLHHILADGTSAL  170

Query  881   HFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANP  702
             HFI +W+D+ARGL V+ PPFIDRT+LRARDPP P F H+EYD PPT+ + P S+      
Sbjct  171   HFINSWSDVARGLPVSTPPFIDRTLLRARDPPHPTFHHSEYDPPPTMNTPPRSQ--PKTT  228

Query  701   STAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIAT  537
              T +LKITP+QL  LK     E      STYE + AHIWR +C+ARGLSDDQ +KLYI+T
Sbjct  229   CTKILKITPEQLGSLKAKVRTEDGAARHSTYETITAHIWRSMCKARGLSDDQASKLYIST  288

Query  536   DGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALD  357
             DGRSRL P LPPG+LGNV+FT T +  SGE+ ++PL  + +RI  AL RMDDEYLRSALD
Sbjct  289   DGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPLVRTMERIHEALGRMDDEYLRSALD  348

Query  356   YLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYIL  177
             Y+E QPDL+ L RG + +ASPNLNI SW RLPVH++DFGWG PV MGPA +  EG  YIL
Sbjct  349   YIEAQPDLNALKRGPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPARVFCEGNAYIL  408

Query  176   PSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              SP  D SLSL +CL+A HMPLF+K LY F
Sbjct  409   RSPVNDGSLSLFICLEAQHMPLFEKCLYDF  438



>ref|XP_011467012.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 249/332 (75%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELRKL+P+VD S  ISS+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  104   SVIDDFGDFAPTLELRKLIPTVDYSAGISSYPLLVLQVTYFKCGGVSLGVGMQHHVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             + LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY   P +K+   S  PG
Sbjct  164   AGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPEFHHIEYQPAPPMKNPQQSTKPG  223

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
             A  +T ++ K+T +QL  LK  S  +G+T     YE+LA H+WRCVC+AR L DDQ TKL
Sbjct  224   AEETTISIFKLTREQLNTLKAKSKEDGNTVNYSSYEMLAGHVWRCVCKARDLPDDQDTKL  283

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P   +A +I +ALVRMD++YLR
Sbjct  284   YIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQSKPTWYAASKIHNALVRMDNDYLR  343

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG 
Sbjct  344   SALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIGYEGL  403

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +++PS   D SLS+A+ L ++HM  F KLLY
Sbjct  404   AFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  435



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score =   415 bits (1067),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 248/335 (74%), Gaps = 7/335 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + I+DFGDF P+LELRKL+P+VD SG ISS+P+ + QVT FKCGGVSLG G+ H ++DG 
Sbjct  107   SVINDFGDFAPTLELRKLIPAVDYSGGISSYPVLVLQVTYFKCGGVSLGVGMQHHVADGF  166

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+DLARGL V +PPFIDRT+LRA  PP P F H EY  PP L+  P +    
Sbjct  167   SGLHFVNTWSDLARGLDVKLPPFIDRTLLRAHSPPRPQFPHIEYQSPPALRVSPETTNSA  226

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG------STYEILAAHIWRCVCEARGLSDDQTTK  552
                +T ++ K+T +QL  LKT +  E       S+YEILA H+WRC C ARGLSDDQ +K
Sbjct  227   PYSTTVSIFKVTREQLDTLKTQAELENGNITSYSSYEILAGHVWRCACRARGLSDDQDSK  286

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR RL P LP G+ GNVIFTATP+A +G+L+++P++ +A++IR +L RMDD+YL
Sbjct  287   LYIATDGRMRLSPPLPRGYFGNVIFTATPIAVAGDLISKPVSYAAQKIRESLARMDDDYL  346

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  347   RSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  406

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               +ILPS   D SLS+A+ L  +HM LF+K LY F
Sbjct  407   LSFILPSSTSDGSLSVAISLQTEHMKLFEKFLYDF  441



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   414 bits (1064),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 196/331 (59%), Positives = 247/331 (75%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SG I ++PL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPTVDYSGGIGTYPLLVLQVTYFKCGGASLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PP + + P S  P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHIEYQPPPAMNTPPQSTGPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K+T +QL  LK  S  +G+T     YE+L+ H+WR VC+ARGL+ DQ TKLY
Sbjct  220   ST-AVSIFKLTREQLNALKAKSKEDGNTVNYSSYEMLSGHVWRSVCKARGLAGDQGTKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P LPPG+ GNVIFTATP+A +G+LL++P   +A  I  AL RMDD+YLRS
Sbjct  279   IATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAAGTIHDALARMDDDYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLELQPDLSALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIPYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSP  D SLS+A+ L A+HM LF+KL+Y
Sbjct  399   FVLPSPTNDGSLSVAISLQAEHMKLFEKLIY  429



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score =   414 bits (1064),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 248/332 (75%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  105   SVIDDFGDFAPTLELRRLIPAVDYSAGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGF  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + +PPFIDRT+LRARDPP PAF H EY   P +K+ P S  PG
Sbjct  165   SGLHFVNTWSDVARGLDITLPPFIDRTLLRARDPPQPAFHHIEYQPAPPMKTPPQSTKPG  224

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
             A+ +T ++ ++T +QL +LK  S   G+T     YE++A HIWRCVC+AR L +DQ TKL
Sbjct  225   ADSTTVSIFRLTREQLNILKAKSKEAGNTVSYSSYEMMAGHIWRCVCKARELPNDQDTKL  284

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P   +A RI  +LVRMDD YLR
Sbjct  285   YIATDGRSRLQPPLPPGYFGNVIFTATPIAAAGDLQSKPTWFAASRIHDSLVRMDDNYLR  344

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I +EG 
Sbjct  345   SALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEGL  404

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +++PS   D SLS+A+ L ++HM  F KLLY
Sbjct  405   AFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  436



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 195/331 (59%), Positives = 242/331 (73%), Gaps = 5/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  IS++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGISTYPLLVLQVTHFKCGGVSLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P FKH EY   P +K+        
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPQFKHIEYQPAPAMKTLASKDAEA  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
                + ++ K+T  QL  LK  S   G+T     YE+LA H+WR VC ARGL +DQ TKLY
Sbjct  220   PETAVSIFKLTRDQLNALKAKSKEGGNTVTYSSYEMLAGHVWRSVCMARGLPEDQDTKLY  279

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A SG+L ++P+  +A +I  AL RMD++YLRS
Sbjct  280   IATDGRSRLQPPLPPGYFGNVIFTATPIAVSGDLTSKPVWYAASKIHDALARMDNDYLRS  339

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  340   ALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  399

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSP  D SLS+A+ L A+HM LF+KLLY
Sbjct  400   FVLPSPTNDGSLSVAISLQAEHMKLFEKLLY  430



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 244/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PP LK  P +    
Sbjct  160   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALKVSPQTAKSD  219

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK  S  +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  220   SVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  280   LYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  340   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  400   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 244/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PP LK  P +    
Sbjct  160   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALKVSPQTAKSD  219

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK  S  +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  220   SVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  280   LYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  340   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  400   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 244/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  102   GVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGF  161

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PP LK  P +    
Sbjct  162   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALKVSPQTAKSD  221

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK  S  +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  222   SVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  281

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  282   LYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYL  341

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  342   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  401

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  402   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  434



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   412 bits (1060),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 244/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PPTLK  P +    
Sbjct  160   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPTLKVSPQTAKSD  219

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK     +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  220   SVPETAVSIFKLTREQISALKAKPKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  280   LYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  340   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  400   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score =   411 bits (1057),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 247/333 (74%), Gaps = 6/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDF P+LEL++L+P+VD SG IS+FPL + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   AVVDDFGDFAPTLELKQLIPTVDYSGGISTFPLLVLQVTHFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL   IPPFIDRT+LRARDPP P F H EY  PP LK+   +  P 
Sbjct  160   SGLHFVNTWSDMARGLDCTIPPFIDRTLLRARDPPQPQFNHIEYQPPPALKASAETLKPD  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K++  QL +LK  +  +G+T     Y +LA H+WR  C+ARGL+DDQ TKLY
Sbjct  220   ST-TVSIFKLSRDQLNILKAKAKEDGNTINYSSYAMLAGHVWRSACKARGLTDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P   +A +I  AL RMD++YLRS
Sbjct  279   IATDGRSRLNPPLPPGYFGNVIFTATPIAVAGDLESKPTWYAAGKIHDALARMDNDYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALD+LE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDFLELQPDLSALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +ILPSP  D SLS+A+ L ++HM LF+K +Y+ 
Sbjct  399   FILPSPTNDGSLSVAIALQSEHMKLFEKFIYEL  431



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   411 bits (1057),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 243/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  105   GVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGF  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PP L   P +    
Sbjct  165   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALAVSPQTAASD  224

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK  S  +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  225   SVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  284

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  285   LYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYL  344

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  345   RSALDYLELQPDLKALVRGAHTFKXPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  404

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  405   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  437



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/333 (59%), Positives = 242/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELRKL+PSVD S +IS+ PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   GVVDDFGDFAPTLELRKLIPSVDYSLEISAIPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS--GPLSKL  717
             S LHFI TW+D+ARGL V +PPFIDRT+LRARDPP PAF H EY   PT+K+   P +  
Sbjct  160   SGLHFINTWSDMARGLDVTLPPFIDRTLLRARDPPQPAFPHIEYQPAPTMKAPLEPANAQ  219

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
                    ++ K+T +QL  LK  S  +G+T     YE+L+ H+WRCVC+ARGL DDQ TK
Sbjct  220   SVPETEISIFKLTREQLNALKAKSKEDGNTVSYSSYEMLSGHVWRCVCKARGLPDDQDTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFT TP A +G+L ++P   +A RI  AL RMD+EYL
Sbjct  280   LYIATDGRSRLQPVLPPGYFGNVIFTTTPTAVAGDLTSKPTWYAASRIHDALGRMDNEYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  340   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPS   D SLS+A+ L A+HM LF K LY
Sbjct  400   LSFVLPSTTNDGSLSIAISLQAEHMKLFSKFLY  432



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 244/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PPTLK  P +    
Sbjct  160   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPTLKVSPQTAKSD  219

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK  S  +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  220   SVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTAT +A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  280   LYIATDGRARLRPSLPPGYFGNVIFTATLIAIAGDLEFKPVWYAASKIHDALARMDNDYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  340   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  400   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 243/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LE R+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLEHRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PP LK  P +    
Sbjct  160   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALKVSPQTAKSD  219

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK  S  +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  220   SVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  280   LYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  340   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  400   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 247/332 (74%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  105   SVIDDFGDFAPTLELRRLIPAVDYSAGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGF  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + +PPFIDRT+LRARDPP PAF H EY   P LK+   S  PG
Sbjct  165   SGLHFVNTWSDMARGLDLTLPPFIDRTLLRARDPPQPAFHHIEYQPAPPLKTPLQSTKPG  224

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
             A+ +T ++ ++T +QL +LK  S   G+T     YE++A HIWRCVC+AR L +DQ TKL
Sbjct  225   ADSTTVSIFRLTREQLNILKAKSKEAGNTISYSSYEMMAGHIWRCVCKARELPNDQDTKL  284

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P   +A RI  +LVRMDD YLR
Sbjct  285   YIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQSKPTWFAASRIHDSLVRMDDNYLR  344

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I +EG 
Sbjct  345   SALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEGL  404

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +++PS   D SLS+A+ L ++HM  F KLLY
Sbjct  405   AFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  436



>ref|XP_012067474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Jatropha 
curcas]
 gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   410 bits (1053),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 249/332 (75%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LEL+KL+P+VD SG IS++PL + Q+T FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLELKKLIPTVDYSGGISTYPLLVLQLTYFKCGGVSLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ RGL + IPPFIDRT+LRARDPP PAF H EY  PP +K+ P+     
Sbjct  160   SGLHFVNTWSDMTRGLDLTIPPFIDRTLLRARDPPQPAFHHIEYQPPPAMKT-PVDNSKP  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ K+T  QL +LKT +  +G+T     YE+LA H+WR   +ARGL  DQ TKLY
Sbjct  219   DSTTVSIFKLTRDQLNILKTKAKEDGNTVSYSSYEMLAGHVWRSASKARGLVGDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A++GE+ ++P   +A++I  ALVRMD++YLRS
Sbjct  279   IATDGRSRLQPPLPPGYFGNVIFTATPIAQAGEMQSKPTWFAARKIHDALVRMDNDYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPD S LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLELQPDPSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIPYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             +ILPS   D SLS+A+ L  +HM LF+KL+Y+
Sbjct  399   FILPSATNDGSLSVAIALQTEHMKLFEKLIYE  430



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   410 bits (1054),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/333 (59%), Positives = 243/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+PSVD +  IS++PL L QVT FKCGGVSLG G+ H  +DG 
Sbjct  104   SVIDDFGDFAPTLELRRLIPSVDYAAGISTYPLLLLQVTXFKCGGVSLGVGMQHHAADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + +PPFIDRT+LRARDPP PAF H EY   P +K    S  PG
Sbjct  164   SGLHFINTWSDMARGLDLTLPPFIDRTLLRARDPPQPAFHHIEYQPAPQMKXPLQSAKPG  223

Query  710   ANPST--AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             A  ST  ++ ++T  QL +LK  S   G+T     YE+L+ H+WRC C+AR L DDQ TK
Sbjct  224   AADSTTVSIFRLTRDQLNILKYKSKEAGNTVSYSSYEMLSGHVWRCACKARELPDDQDTK  283

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L+IATDGRSRL P LPPG+ GNVIFTATP+A +G++ ++P   +A RI  ALVRMDD YL
Sbjct  284   LFIATDGRSRLQPPLPPGYFGNVIFTATPIAXAGDIQSKPTWYAASRIHDALVRMDDSYL  343

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I +EG
Sbjct  344   RSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEG  403

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +I+PS   D SLSLA+ L  +HM  F KLLY
Sbjct  404   LAFIIPSATNDGSLSLAISLQTEHMKSFSKLLY  436



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   410 bits (1053),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 249/339 (73%), Gaps = 12/339 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               IDDFGDF P+LELR+L+P+VD SG I ++PL + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GVIDDFGDFAPTLELRQLIPAVDYSGGIETYPLLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS--GPLSK-  720
             S LHFI TW+D+ARG  + +PPFIDRT+LRARDPP P F+H EY  PPT+KS   P+   
Sbjct  160   SGLHFINTWSDMARGFDLTLPPFIDRTLLRARDPPQPVFEHIEYKPPPTMKSPQNPVQSP  219

Query  719   -LPGANPSTA---MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSD  567
               PG++P+TA   + K+T  QL  LK  S   G+T     YE+LA H+WR  C+AR L D
Sbjct  220   TKPGSDPNTATVSIFKMTRAQLNALKAKSKEAGNTVNYSSYEMLAGHVWRSTCKARALPD  279

Query  566   DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRM  387
             DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+L+++P   +A RI +AL RM
Sbjct  280   DQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAVAGDLMSKPTWFAASRIHNALSRM  339

Query  386   DDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
             D+EYLRSALD+LE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  
Sbjct  340   DNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGG  399

Query  206   ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             I YEG  +ILPS   D SLS+A+ L  +HM +F+++LY+
Sbjct  400   IAYEGLSFILPSSGNDGSLSVAIALQPEHMKVFKEVLYE  438



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   409 bits (1052),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 246/331 (74%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + + DFGDF P+LEL++L+P+VD SG IS++PL + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   SVVADFGDFAPTLELKQLIPTVDYSGGISTYPLLVLQVTHFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY  PP +K+ P +  P 
Sbjct  160   SGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPPPAMKAVPETSKPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K+T  QL  LK  +   G     S+YE+LA H+WR  C+ARGL DDQ TKLY
Sbjct  220   ST-AVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACQARGLPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +GE+ ++P   +A +I  +LVRMD++YLRS
Sbjct  279   IATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALD+LE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS   D S+S+A+ L A+HM LF+K +Y
Sbjct  399   FIIPSSTNDGSMSVAISLQAEHMKLFEKFMY  429



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score =   409 bits (1052),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 245/332 (74%), Gaps = 10/332 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              ++DD+GDF P+LELR+L+P+VD S +IS++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   GSVDDYGDFAPTLELRRLIPAVDYSQEISAYPLLVLQVTFFKCGGVSLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + + PFIDRT+LRARDPP P FKH EY  PP +K+        
Sbjct  160   SGLHFVNTWSDMARGLDITLEPFIDRTLLRARDPPEPQFKHIEYQPPPAMKT-----YGE  214

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             A    ++ K+T +QL  LK  S  +G+T     YE+LA HIWRC C ARGL +DQ+TKLY
Sbjct  215   AETLVSIFKLTREQLTTLKAKSKDDGNTVTHSSYEMLAGHIWRCACLARGLPEDQSTKLY  274

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR RL P LPPG+ GNVIFTATP+A +G+L ++P    A +I  AL RMD+EYLRS
Sbjct  275   IATDGRFRLQPPLPPGYFGNVIFTATPMAVAGDLESKPAWYGASKIHDALARMDNEYLRS  334

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  335   ALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  394

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLS+A+ L ADHM +F+KLLY+
Sbjct  395   FVLPSPANDGSLSVAISLQADHMKVFEKLLYE  426



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 247/331 (75%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDF DF P+LEL++L+P+VD SG IS++PL + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   SVIDDFADFAPTLELKQLIPTVDYSGGISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PP++K+   +  P 
Sbjct  160   SGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHVEYQPPPSMKTVLETSKPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K++  QL+ LK  +  +G     S+YE+LAAH+WR  C+AR L DDQ TKLY
Sbjct  220   ST-AVSIFKLSRDQLSTLKAKAKEDGNNISYSSYEMLAAHVWRSTCKARELPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +GE+ ++P   +A +I  ALVRMD++YL+S
Sbjct  279   IATDGRSRLRPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDALVRMDNDYLKS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  399   FILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   409 bits (1050),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 244/332 (73%), Gaps = 10/332 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              T+DD+GDF PSLELR+L+P+VD S  IS++PL + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GTVDDYGDFAPSLELRRLIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + +PPFIDRT+L ARDPP P FKH EY  PP +K+        
Sbjct  160   SGLHFINTWSDMARGLDITLPPFIDRTLLSARDPPQPQFKHVEYQPPPAMKT-----YEP  214

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             A    ++ K+T  QL  LK  S  +G+T     YE+L+ H+WRC C ARGL ++Q TKLY
Sbjct  215   AETVVSIFKLTKDQLTTLKAKSKEDGNTTTYSSYEMLSGHVWRCTCLARGLPEEQETKLY  274

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P+  +A +I  AL RMD++YLRS
Sbjct  275   IATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRS  334

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALD+LE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  335   ALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  394

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLS+A+ L A+HM LF+KLLY+
Sbjct  395   FVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQ  426



>gb|AHK05938.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Caragana korshinskii]
Length=434

 Score =   409 bits (1050),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 247/333 (74%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+L LR+L+P+VD SG I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLHLRQLIPAVDYSGGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRT+LRARDPP P F H EY  PP++K+      PG
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTLLRARDPPRPIFDHIEYKPPPSMKTPQQPPKPG  219

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             ++ + A  + K+T +QL  LK  S   G+T     YE+LA H+WR VC+AR L DDQ TK
Sbjct  220   SDTAAAVSIFKLTREQLNTLKAKSKENGNTINCSSYEMLAGHVWRSVCKARALPDDQETK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L+++P+  +A RI +AL RMD+EYL
Sbjct  280   LYIATDGRSRLIPPPPPGYFGNVIFTTTPIAIAGDLMSKPIWYAASRIHNALSRMDNEYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  340   RSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +I+PS   D SLS+A+ L  +HM +F++LLY
Sbjct  400   LSFIIPSSTNDGSLSVALALQPEHMKVFKELLY  432



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score =   409 bits (1050),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 247/336 (74%), Gaps = 11/336 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLELRQLIPAVDYSQGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP +K+   +K PG
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPVFDHIEYKPPPAMKTQQPTK-PG  218

Query  710   ANPSTA-----MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQ  561
             ++   A     + ++T +QL  LK  S  +G+T     YE+LA H+WR VC+AR L DDQ
Sbjct  219   SDSDNAAAAVSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPDDQ  278

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RMD+
Sbjct  279   ETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDN  338

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             +YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  I 
Sbjct  339   DYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIA  398

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  399   YEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  434



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   410 bits (1054),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 250/335 (75%), Gaps = 9/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+LELRKL+P+VD S  +S++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  158   SAVDDFGDFAPTLELRKLIPAVDYSAGLSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGF  217

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLS---K  720
             S LHF+ TW+D+ARGL +  PPFIDRT+LRARDPP P FKH EY  PP LK+ PLS   K
Sbjct  218   SGLHFVNTWSDMARGLDLTTPPFIDRTLLRARDPPQPQFKHIEYQPPPALKA-PLSQTTK  276

Query  719   LPGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTT  555
                 + + ++ K+T +QL  LK  S  +G+T     YE+LA H+WR  C+AR L+ DQ +
Sbjct  277   SGAESTAVSIFKMTREQLNKLKGKSKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQES  336

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             K+YIATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P   +A RI  ALVRMD++Y
Sbjct  337   KMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDNDY  396

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YE
Sbjct  397   LRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYE  456

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             G  +ILPSP  D S+S+A+ L  +HM +F+KLLY+
Sbjct  457   GLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  491



>ref|XP_010527105.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=399

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/333 (59%), Positives = 250/333 (75%), Gaps = 8/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P+VD SG I S+PL + QVT FKCGG SLG G+ H ++DG 
Sbjct  65    SVIDDFGDFAPTLLLRQLIPTVDYSGPIDSYPLLVLQVTFFKCGGASLGVGMQHHVADGF  124

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKL  717
             S LHFI  W+D+ARGL + IPPFIDRT+LRARDPP PAF H EY  PP++K+ P+  SK 
Sbjct  125   SGLHFINAWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPPPSMKN-PVDPSKA  183

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
                N + ++ K++  QL  LK  S  EG+T     YE+L+ H+WR VC+ARGL+DDQ +K
Sbjct  184   GPDNTTVSIFKLSRDQLNALKAKSKEEGNTINYSSYEMLSGHVWRSVCKARGLADDQESK  243

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFTATPVA +G+L ++P   +A +I +ALVRMD+EYL
Sbjct  244   LYIATDGRSRLRPPLPPGYFGNVIFTATPVAVAGDLHSKPTWYAAGQIHNALVRMDNEYL  303

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  304   RSALDYLEMQPDLSALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIPYEG  363

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPS   D SLS+A+ L  +HM LF+K+L+
Sbjct  364   LSFVLPSSANDGSLSVAIALQTEHMKLFEKILH  396



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/331 (59%), Positives = 244/331 (74%), Gaps = 8/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I+S+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLELRQLIPAVDYSQGIASYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP +K+    +   
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPIFDHIEYKPPPAMKT---QQATN  216

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             A+ + ++ ++T  QL  LK  S  +G+T     YE+LA H+WR V +AR L DDQ TKLY
Sbjct  217   ASAAVSIFRLTRDQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVSKARALPDDQETKLY  276

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RMD++YLRS
Sbjct  277   IATDGRSRLQPPTPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRS  336

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  I YEG  
Sbjct  337   ALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLS  396

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS   D SLS+A+ L  DHM LF+  LY
Sbjct  397   FIIPSSTNDGSLSVAIALQPDHMKLFKDFLY  427



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 247/332 (74%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I S+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  101   AVIDDFGDFAPTLELRQLIPAVDYSRGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRT+LRARDPP P F H EY  PP++K+   S  PG
Sbjct  161   SGLHFINTWSDVARGLDVSIPPFIDRTLLRARDPPRPVFDHIEYKPPPSMKTTQQSTKPG  220

Query  710   AN-PSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
             ++  + ++ K+T +QL+ LK  S   G+T     YE+LA H+WR VC+AR L DDQ TKL
Sbjct  221   SDGAAVSIFKLTREQLSTLKAKSKEAGNTIHYSSYEMLAGHVWRSVCKARSLPDDQETKL  280

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL RMD+EYLR
Sbjct  281   YIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLR  340

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALD+LE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG 
Sbjct  341   SALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGL  400

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +I+PS   D SLS+A+ L  +HM +F++ LY
Sbjct  401   SFIIPSSTNDGSLSVAIALQHEHMKVFKEFLY  432



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/333 (59%), Positives = 243/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELRKL+PSVD +  IS++PL L QVT FKCGGVSLG G+ H  +DG 
Sbjct  104   SVIDDFGDFAPTLELRKLIPSVDYAAGISTYPLLLLQVTYFKCGGVSLGVGMQHHAADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + +PPFIDRT+LRARDPP PAF   EY   P +K+   S  PG
Sbjct  164   SGLHFINTWSDMARGLDLTLPPFIDRTLLRARDPPQPAFHPIEYQPAPQMKTPLQSAKPG  223

Query  710   ANPST--AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             A  ST  ++ ++T  QL +LK+ S   G+T     YE+L+ H+WRC C+AR L DDQ TK
Sbjct  224   AADSTTVSIFRLTRDQLNILKSKSKEAGNTVSYSSYEMLSGHVWRCACKARELPDDQDTK  283

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFT TP+A +G++ ++P   +A RI   LVRMDD YL
Sbjct  284   LYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDIQSKPTWYAASRIHDGLVRMDDSYL  343

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I +EG
Sbjct  344   RSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEG  403

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +I+PS   D SLS+A+CL  +HM  F KLLY
Sbjct  404   LSFIIPSATNDGSLSVAICLQTEHMKSFSKLLY  436



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   410 bits (1054),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/335 (58%), Positives = 250/335 (75%), Gaps = 9/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+LELRKL+P+VD S  +S++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  163   SAVDDFGDFAPTLELRKLIPAVDYSAGLSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGF  222

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLS---K  720
             S LHF+ TW+D+ARGL +  PPFIDRT+LRARDPP P FKH EY  PP LK+ PLS   K
Sbjct  223   SGLHFVNTWSDMARGLDLTTPPFIDRTLLRARDPPQPQFKHIEYQPPPALKA-PLSQTTK  281

Query  719   LPGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTT  555
                 + + ++ K+T +QL  LK  S  +G+T     YE+LA H+WR  C+AR L+ DQ +
Sbjct  282   SGAESTAVSIFKMTREQLNKLKGKSKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQES  341

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             K+YIATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P   +A RI  ALVRMD++Y
Sbjct  342   KMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDNDY  401

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YE
Sbjct  402   LRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYE  461

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             G  +ILPSP  D S+S+A+ L  +HM +F+KLLY+
Sbjct  462   GLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  496



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 242/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  ISS+ L + QVT FK GGVSLG G+ H  +DG 
Sbjct  105   GVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKXGGVSLGVGMRHHAADGF  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V +PPFIDRT+LRARDPP P F+H EY  PP L   P +    
Sbjct  165   SGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALAVSPQTAASD  224

Query  710   ANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             + P TA  + K+T +Q++ LK  S  +G+T     YE+LA H+WRC C+ARGL  DQ TK
Sbjct  225   SVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTK  284

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P+LPPG+ GNVIFTATP+A +G+L  +P+  +A +I  AL RMD++YL
Sbjct  285   LYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYL  344

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  345   RSALDYLELQPDLKALVRGAHTFKXPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  404

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D S+S+A+ L  +HM LFQ  LY
Sbjct  405   LSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  437



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 246/331 (74%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDF DF P+LEL++L+P+VD SG IS++PL + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   SVIDDFADFAPTLELKQLIPTVDYSGGISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PP++K+   +  P 
Sbjct  160   SGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHVEYQPPPSMKTVLETSKPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K++  QL+ LK  +  +G     S+YE+LAAH+WR  C+AR L DDQ TKLY
Sbjct  220   ST-AVSIFKLSRDQLSTLKAKAKEDGNNISYSSYEMLAAHVWRSTCKARELPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   +A +I  ALVRMD++YL+S
Sbjct  279   IATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDALVRMDNDYLKS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  399   FILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score =   407 bits (1045),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 244/332 (73%), Gaps = 10/332 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              ++DD+GDF P+LELR+L+P+VD S +IS++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   GSVDDYGDFAPTLELRRLIPAVDYSQEISAYPLLVLQVTFFKCGGVSLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S  HFI TW+D+ARGL + + PFIDRT+LRARDPP P FKH EY  PP +K+        
Sbjct  160   SGPHFINTWSDMARGLDITLEPFIDRTLLRARDPPEPQFKHIEYQPPPAMKT-----YGE  214

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             A    ++ K+T +QL  LK  S  +G+T     YE+LA HIWRC C ARGL +DQ+TKLY
Sbjct  215   AETLVSIFKLTREQLTTLKAKSKDDGNTVTYSSYEMLAGHIWRCACLARGLPEDQSTKLY  274

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR RL P LPPG+ GNVIFTATP+A +G+L ++P    A +I  AL RMD+EYLRS
Sbjct  275   IATDGRFRLQPPLPPGYFGNVIFTATPMAVAGDLESKPAWYGASKIHDALARMDNEYLRS  334

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  335   ALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  394

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLS+A+ L ADHM +F+KLLY+
Sbjct  395   FVLPSPANDGSLSVAISLQADHMKVFEKLLYE  426



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score =   406 bits (1044),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 247/332 (74%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I S+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  101   AVIDDFGDFAPTLELRQLIPAVDYSRGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRT+LRARDPP P F H EY  PP++K+   S  PG
Sbjct  161   SGLHFINTWSDVARGLDVSIPPFIDRTLLRARDPPRPVFDHIEYKPPPSMKTTQQSTKPG  220

Query  710   AN-PSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
             ++  + ++ K+T +QL+ LK  S   G+T     YE+LA H+WR VC+AR L DDQ TKL
Sbjct  221   SDGAAVSIFKLTREQLSTLKAKSKEAGNTIHYSSYEMLAGHVWRSVCKARSLPDDQETKL  280

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL RMD++YLR
Sbjct  281   YIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNDYLR  340

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALD+LE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG 
Sbjct  341   SALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGL  400

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +I+PS   D SLS+A+ L  +HM +F++ LY
Sbjct  401   SFIIPSSTNDGSLSVAIALQHEHMKVFKEFLY  432



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score =   406 bits (1044),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 195/338 (58%), Positives = 247/338 (73%), Gaps = 13/338 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLELRQLIPAVDYSQGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP +K+   +K PG
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPVFDHIEYKPPPAMKTQQPTK-PG  218

Query  710   ANPST-------AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSD  567
             ++          ++ ++T +QL  LK  S  +G+T     YE+LA H+WR VC+AR L D
Sbjct  219   SDSDNAAAAAAVSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPD  278

Query  566   DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRM  387
             DQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RM
Sbjct  279   DQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRM  338

Query  386   DDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
             D++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  
Sbjct  339   DNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGG  398

Query  206   ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  399   IAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  436



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score =   406 bits (1044),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 245/333 (74%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+LELR+L+P+VD S  +S++ L + QVT FKCGGVSLG G+ H ++DG 
Sbjct  104   SVLDDFGDFAPTLELRRLIPAVDYSAGVSTYALLVLQVTYFKCGGVSLGVGMQHHVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LR+RDPP PAF H EY   P +K+   S  PG
Sbjct  164   SGLHFINTWSDMARGLDLTIPPFIDRTLLRSRDPPQPAFHHIEYQPAPPMKTPLQSAKPG  223

Query  710   ANPST--AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             A  +T  ++ ++T  QL +LK+ S   G+T     YE+ + H+WRCVC+AR L DDQ TK
Sbjct  224   AADTTTVSIFRLTRDQLNILKSKSKEAGNTVSYSSYEMFSGHVWRCVCKARELPDDQDTK  283

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFT TP+A +G+L ++P   +A RI  ALVRMDD YL
Sbjct  284   LYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQSKPTWYAASRIHDALVRMDDNYL  343

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I +EG
Sbjct  344   RSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGQPIFMGPGGIAFEG  403

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPS   D SLSLA+ L ++HM  F +LLY
Sbjct  404   LAFVLPSATNDGSLSLAISLQSEHMKSFSRLLY  436



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/329 (57%), Positives = 246/329 (75%), Gaps = 6/329 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             +DDFGDF P+LELR+L+P+VD S  I S+PL + QVT FKCGGVSLG G+ H  +DG S 
Sbjct  102   VDDFGDFAPTLELRQLIPTVDYSQGIESYPLLVLQVTHFKCGGVSLGVGMQHHAADGASG  161

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHFI TW+D+ARGL + +PPFIDRT+LRAR+PP P F+H EY  PP LK+ P  +   ++
Sbjct  162   LHFINTWSDMARGLDLTVPPFIDRTLLRAREPPQPQFQHVEYQPPPALKA-PQPQNVTSD  220

Query  704   PSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              + ++ K++  Q++ LK  S  +G+T     YE+LA H+WRC C ARGL++DQ TKLYIA
Sbjct  221   TAVSIFKLSRDQISALKAKSKEDGNTVAYSSYEMLAGHVWRCACRARGLTEDQETKLYIA  280

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGRSRL P+LP G+ GNVIFTATP+A +G+L ++P+  +A +I  AL RMD++YLRSAL
Sbjct  281   TDGRSRLRPSLPTGYFGNVIFTATPIAVAGDLQSKPVWFAASKIHGALGRMDNDYLRSAL  340

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  ++
Sbjct  341   DYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFM  400

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             LPSP  D SLS+A+ L  +HM LF++ LY
Sbjct  401   LPSPENDGSLSIAISLQEEHMKLFKEFLY  429



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 245/331 (74%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + + DFGDF P+LEL++L+P+VD SG IS++PL + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   SVVADFGDFAPTLELKQLIPTVDYSGGISTYPLLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY  PP +K+   +  P 
Sbjct  160   SGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPPPAMKTVLETSKPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K+T  QL  LK  +   G     S+YE+LA H+WR  C+ARGL DDQ TKLY
Sbjct  220   ST-AVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +GE+ ++P   +A +I  +LVRMD++YLRS
Sbjct  279   IATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALD+LE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS   D SLS+A+ L A+HM LF+K +Y
Sbjct  399   FIIPSSTNDGSLSVAISLQAEHMKLFEKFIY  429



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/335 (58%), Positives = 247/335 (74%), Gaps = 9/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+L+LR+L+P++D S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLQLRQLIPAIDYSQGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSK--L  717
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP + +   S+   
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPVFDHIEYKPPPAMNNNTPSQPTK  219

Query  716   PGANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQT  558
             PG++P+ A  + K+T  QL  LK  S  +G+T     YE+LA H+WR VC+AR L +DQ 
Sbjct  220   PGSDPTAAVSIFKLTRDQLTTLKAKSKEDGNTVNYSSYEMLAGHVWRSVCKARSLPEDQE  279

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RMD+E
Sbjct  280   TKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNE  339

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSALD+LE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  I Y
Sbjct  340   YLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAY  399

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             EG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  400   EGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  434



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/338 (58%), Positives = 247/338 (73%), Gaps = 13/338 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  124   AVIDDFGDFAPTLELRQLIPAVDYSQGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  183

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP +K+   +K PG
Sbjct  184   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPVFDHIEYKPPPAMKTQQPTK-PG  242

Query  710   ANPST-------AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSD  567
             ++          ++ ++T +QL  LK  S  +G+T     YE+LA H+WR VC+AR L D
Sbjct  243   SDSDNAAAAAAVSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPD  302

Query  566   DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRM  387
             DQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RM
Sbjct  303   DQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRM  362

Query  386   DDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
             D++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  
Sbjct  363   DNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGG  422

Query  206   ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  423   IAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  460



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score =   406 bits (1043),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 195/338 (58%), Positives = 247/338 (73%), Gaps = 13/338 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  127   AVIDDFGDFAPTLELRQLIPAVDYSQGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  186

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP +K+   +K PG
Sbjct  187   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPVFDHIEYKPPPAMKTQQPTK-PG  245

Query  710   ANPST-------AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSD  567
             ++          ++ ++T +QL  LK  S  +G+T     YE+LA H+WR VC+AR L D
Sbjct  246   SDSDNAAAAAAVSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPD  305

Query  566   DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRM  387
             DQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RM
Sbjct  306   DQETKLYIATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRM  365

Query  386   DDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
             D++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  
Sbjct  366   DNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGG  425

Query  206   ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             I YEG  +I+PS   D SLS+A+ L  DHM +F+  LY
Sbjct  426   IAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  463



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score =   405 bits (1040),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 244/336 (73%), Gaps = 8/336 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  I S+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRQLIPAVDYSQGIQSYALLVLQITHFKCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSK-LP  714
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTLK  P +  + 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPQFPHVEYQPPPTLKVTPENTPIS  219

Query  713   GANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTT  555
              A P T+  + K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL+ DQ T
Sbjct  220   EAVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLAHDQET  279

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++ ++P+  +A ++  AL RMD++Y
Sbjct  280   KLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKLHDALARMDNDY  339

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+H++DFGWG P+ MGP  I YE
Sbjct  340   LRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYE  399

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  +ILPSP  D S S+A+ L A+HM LF+K LY F
Sbjct  400   GLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDF  435



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 246/331 (74%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDF DF P+ EL++L+P+VD SG IS++ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   SVIDDFADFAPTSELKQLIPTVDYSGGISTYALLVLQVTYFKCGGVSLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY  PP++K+   +  P 
Sbjct  160   SGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFYHVEYQPPPSMKTVLETSKPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
             +  + ++ K++  QL+ LK  ++ +G     S+YE+LAAH+WR  C+AR L DDQ TKLY
Sbjct  220   ST-AVSIFKLSRDQLSTLKAKANEDGNNISYSSYEMLAAHVWRSTCKARELPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSR  P LPPG+ GNVIFTATP+A +GE+ ++P   +A +I  ALVRMD++YL+S
Sbjct  279   IATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTCYAAGKIHDALVRMDNDYLKS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +ILPSP  D S+S+A+ L A HM LF+K +Y
Sbjct  399   FILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 247/335 (74%), Gaps = 9/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               IDDFGDF P+L+LR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  113   VVIDDFGDFAPTLKLRQLIPAVDYSQGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  172

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRT+LRARDPP P F+H EY  PP++K+ P ++   
Sbjct  173   SGLHFINTWSDVARGLDVSIPPFIDRTLLRARDPPRPVFEHIEYKPPPSMKTSPHNQPTK  232

Query  710   AN----PSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQT  558
             A+     + ++ K+T +QL  LK  S   G+T     YE+LA H+WR VC+AR L DDQ 
Sbjct  233   ADSEATAAVSIFKLTREQLVTLKAKSKEAGNTINYSSYEMLAGHVWRSVCKARSLPDDQE  292

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL RMD+E
Sbjct  293   TKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNE  352

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I Y
Sbjct  353   YLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAY  412

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             EG  +I+PS   D SLS+A+ L  +HM +F++LLY
Sbjct  413   EGLSFIIPSSTNDGSLSVAIALQHEHMKVFKELLY  447



>gb|AEO00530.1| hydroxycinnamoyl transferase [Nicotiana benthamiana]
Length=369

 Score =   402 bits (1032),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/334 (57%), Positives = 242/334 (72%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  I S+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  34    GVVDDFGDFAPTLELRQLIPAVDYSQGIQSYALLVLQITHFKCGGVSLGVGMQHHAADGA  93

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKL-P  714
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTLK  P +   P
Sbjct  94    SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPQFPHVEYQPPPTLKVTPENTTNP  153

Query  713   GANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTT  555
                P T+  + K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL+ DQ T
Sbjct  154   EIVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLAHDQET  213

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++ ++P+  +A ++  AL RMD++Y
Sbjct  214   KLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKLHDALARMDNDY  273

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+H++DFGWG P+ MGP  I YE
Sbjct  274   LRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYE  333

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             G  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  334   GLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLY  367



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score =   404 bits (1038),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 247/335 (74%), Gaps = 9/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               IDDFGDF P+L+LR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   VVIDDFGDFAPTLKLRQLIPAVDYSQGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRT+LRARDPP P F+H EY  PP++K+ P ++   
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTLLRARDPPRPVFEHIEYKPPPSMKTSPHNQPTK  219

Query  710   AN----PSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQT  558
             A+     + ++ K+T +QL  LK  S   G+T     YE+LA H+WR VC+AR L DDQ 
Sbjct  220   ADSEATAAVSIFKLTREQLVTLKAKSKEAGNTINYSSYEMLAGHVWRSVCKARSLPDDQE  279

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL RMD+E
Sbjct  280   TKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNE  339

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I Y
Sbjct  340   YLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAY  399

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             EG  +I+PS   D SLS+A+ L  +HM +F++LLY
Sbjct  400   EGLSFIIPSSTNDGSLSVAIALQHEHMKVFKELLY  434



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   404 bits (1037),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 251/335 (75%), Gaps = 8/335 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P++EL++L+P V+ S DISS+ L + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTMELKQLIPKVNYSEDISSYALLVLQVTFFKCGGVSLGVGMQHHVADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK--SGPLSKL  717
             + LHFI TW+D+ARGL +A+PPFIDRT+LRAR+PP P F+H EY  PP LK  SG ++  
Sbjct  160   AGLHFINTWSDVARGLDIALPPFIDRTLLRARNPPTPKFQHIEYQQPPPLKDTSGIMNG-  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                + S A+ K+T +QL +LK  +   G     S+YE+L+ HIWRC C+AR L++DQ TK
Sbjct  219   EKNDFSVAIFKLTKEQLDILKGKARENGNKVSYSSYEMLSGHIWRCACKARNLTEDQGTK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P+LPPG+ GNVIFT TP+A +G+++++P   +A  I  AL RMDDEYL
Sbjct  279   LYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVSKPTYYAASVIHEALGRMDDEYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL+ LVRG++ F  PN+ I SW+RLP+H++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLELQPDLTALVRGAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               +ILPS  KD SLS+A+ L  DHM  F+K+LY+ 
Sbjct  399   LAFILPSSAKDGSLSVALGLQPDHMVRFEKMLYEL  433



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 242/333 (73%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               I DFGDF P+LE+RKL+P+VD S  ISS+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  100   GVIGDFGDFAPTLEMRKLIPAVDYSQGISSYALLVLQITYFKCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI  W+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPT+++     +P 
Sbjct  160   SGLHFINAWSDMARGLDLTIPPFIDRTLLRARDPPQPTFPHIEYQPPPTMRTKNNETVPD  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
              +   ++ K+T  Q+  LK  S  +G     S+YE++A H+WRCVC+ARGL +DQ TKLY
Sbjct  220   TD--VSIFKLTRDQINSLKAKSKDDGNAIGYSSYEMMAGHLWRCVCKARGLPEDQETKLY  277

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P+LPPG+ GNVIFT TP+A +G+L ++P   +A RI  AL RMD++YLRS
Sbjct  278   IATDGRARLKPSLPPGYFGNVIFTTTPIAVAGDLQSKPAWYAASRIHDALTRMDNDYLRS  337

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  338   ALDYLELQPDLKALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLS  397

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             ++LPSP  D SLS+A+ L A+HM LF K LY+ 
Sbjct  398   FVLPSPTNDGSLSVAISLQAEHMKLFAKYLYEI  430



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 242/331 (73%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              ++DD+GDF P+LELR+L+P+VD S  IS++ L + QVT+FKCGGVSLG G+ H ++DG 
Sbjct  103   GSVDDYGDFAPNLELRRLIPAVDYSQGISTYALLVLQVTKFKCGGVSLGVGMQHHVADGF  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + +PPFIDRT+LRARDPP P FKH EY   P +K+        
Sbjct  163   SGLHFINTWSDMARGLDITLPPFIDRTLLRARDPPQPQFKHIEYQPAPAMKTYGAGHY-A  221

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
                  ++ K+T +QL  LK  S  +G+T     YE+LA H+WRC C AR L +DQ TKLY
Sbjct  222   TETVVSIFKLTREQLTTLKAKSKEDGNTVTYSSYEMLAGHVWRCACLARSLPEDQDTKLY  281

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P LP G+ GNVIFTATP+A +G+L ++P+  +A +I  AL RMD+EYLRS
Sbjct  282   IATDGRARLQPPLPQGYFGNVIFTATPLAVAGDLESKPVWYAASKIHDALARMDNEYLRS  341

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  342   ALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  401

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSP  D SLS+A+ L A+HM LF+KLLY
Sbjct  402   FVLPSPANDGSLSVAISLQAEHMKLFEKLLY  432



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 243/332 (73%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DDFGDF P+LELR+L+PSVD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   ASVDDFGDFAPTLELRQLIPSVDYSAGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI  W+D+ARGL ++I PFIDRT+LRARDPP P F H EY   P +K+      PG
Sbjct  160   SGLHFINAWSDVARGLDISISPFIDRTLLRARDPPEPVFDHVEYKPAPAMKTPLPPTKPG  219

Query  710   ANP-STAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
             +   + ++ K+T  QL  LK  S  +G+T     YE+LA H+WR VC+AR L  DQ TKL
Sbjct  220   SEQVAVSIFKLTRDQLNTLKGKSREDGNTVNYSSYEMLAGHVWRSVCKARALPHDQETKL  279

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGRSRL P+LPPG+ GNVIFT TP+A +G+L+++P   +A RI  ALVRMD+EYLR
Sbjct  280   YIATDGRSRLQPSLPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHDALVRMDNEYLR  339

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG 
Sbjct  340   SALDYLELQPDLKALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGL  399

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +I+PS   D SLS+A+ L +D M LFQ+LLY
Sbjct  400   SFIIPSSTNDASLSVAIALPSDQMKLFQELLY  431



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/329 (58%), Positives = 246/329 (75%), Gaps = 7/329 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDDFGDF P+LEL++L+P++D SG IS++PL + Q+T FKCGGVSLG G+ H ++DG S 
Sbjct  102   IDDFGDFAPTLELKQLIPTIDYSGGISTYPLLVLQITHFKCGGVSLGVGMQHHVADGFSG  161

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHF+ TW+D ARGL + IPPFIDRT+LR+RDPP PAF+H EY  PP LK    S      
Sbjct  162   LHFVNTWSDFARGLDLTIPPFIDRTLLRSRDPPQPAFEHIEYQPPPPLKHPLKSS--SET  219

Query  704   PSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              + ++ K+T  QL +LK  +  +G+T     YE+LA H+WR  C ARGL+ DQ TKLYIA
Sbjct  220   TAVSIFKLTRDQLNILKAKAKEDGNTINYSSYEMLAGHVWRSACIARGLTADQETKLYIA  279

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
             TDGR+RL P LPPG+ GNVIFTATP+A +G+L ++P+  +A RI  ALVRMD++YLRSAL
Sbjct  280   TDGRARLRPPLPPGYFGNVIFTATPMAVTGDLQSKPIWYAASRIHDALVRMDNDYLRSAL  339

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  +I
Sbjct  340   DYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFI  399

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +PSP  D SLS+A+ L  +HM LF+KL+Y
Sbjct  400   IPSPTNDGSLSVAISLQTEHMKLFEKLIY  428



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score =   402 bits (1032),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 193/331 (58%), Positives = 243/331 (73%), Gaps = 10/331 (3%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             +DDFGDF P+L+LR+L+P+VD S  I S+ L + Q+T FKCGGVSLG G+ H  +DG S 
Sbjct  103   VDDFGDFAPTLKLRRLIPAVDYSQGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGFSG  162

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHFI TW+D+ARGL + IPPFI+RT+LRARDPP P F H EY  PPTLK+   ++   A 
Sbjct  163   LHFINTWSDMARGLDLTIPPFINRTLLRARDPPLPQFPHIEYQPPPTLKNIAKTE---AV  219

Query  704   PSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             P TA  + K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL +DQ +KLY
Sbjct  220   PETAVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLEEDQGSKLY  279

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G+L ++P+  +A +I  AL +MD++YLRS
Sbjct  280   IATDGRSRLRPILPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALAQMDNDYLRS  339

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  340   ALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  399

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +ILPSP  D SLS+A+ L ADHM LF+K LY
Sbjct  400   FILPSPTNDGSLSVAISLQADHMKLFEKYLY  430



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   401 bits (1031),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 248/335 (74%), Gaps = 8/335 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P++EL++L+P V+ S DISS+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTMELKQLIPKVNYSEDISSYPLLVLQVTFFKCGGVSLGVGMQHHVADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK--SGPLSKL  717
             + +HFI TW+D+ARGL + +PPFIDRT+LRAR+PP P F+H EY  PP LK  SG ++  
Sbjct  160   AGIHFINTWSDVARGLDITLPPFIDRTLLRARNPPTPKFQHIEYQQPPPLKDTSGIMNGE  219

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                  S A+ K+T +QL +LK  +   G     S+YE+L+ HIWRC C+AR L++DQ TK
Sbjct  220   KNGF-SVAIFKLTKEQLEILKGKARENGNNIAYSSYEMLSGHIWRCACKARNLAEDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P++PPG+ GNVIFT TP+A +G+++++P   +A  I  AL RMDDEYL
Sbjct  279   LYIATDGRNRLRPSIPPGYFGNVIFTTTPMAVAGDIISKPTYYAASVIHEALGRMDDEYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL+ LVRGS+ F  PN+ I SW+RLP+H++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLELQPDLTALVRGSHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               ++LPS   D SLS+A+ L  DHM  F K+LY+ 
Sbjct  399   LAFVLPSSANDGSLSVALGLQPDHMARFAKMLYEI  433



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 243/332 (73%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   GVVDDFGDFAPTLELRQLIPAVDYSRGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V++PPFIDRT+LRARDPP P F H EY  PP++K+      PG
Sbjct  160   SGLHFINTWSDVARGLDVSMPPFIDRTLLRARDPPRPVFDHIEYKPPPSMKTHQQPTKPG  219

Query  710   AN-PSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
             ++  + ++ K+T +QL  LK  S   G+T     YE+LA H+WR VC+AR L DDQ TKL
Sbjct  220   SDGAAVSIFKLTREQLNTLKAKSKEAGNTIHYSSYEMLAGHVWRSVCKARSLPDDQETKL  279

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGR+RL P  PPG+ GNVIFT TP+A +G+L+T+P   +A RI +AL RMD+EYLR
Sbjct  280   YIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMTKPTWYAASRIHNALSRMDNEYLR  339

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALD+LE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG 
Sbjct  340   SALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGL  399

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +I+PS   D SLS+A+ L  +HM +F+  LY
Sbjct  400   SFIIPSSANDGSLSVAIALQHEHMKVFKDFLY  431



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 244/334 (73%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLNLRQLIPEVDHSAGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKL  717
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P++K  PL  SK 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMKI-PLDPSKS  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
                N + ++ K+T  QL  LK  S  +G+T     YE+LA H+WR V +ARGL +DQ TK
Sbjct  219   GPENTTVSIFKLTRDQLVALKAKSKEDGNTVSYSSYEMLAGHVWRSVGKARGLPNDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A +I   LVRMDD YL
Sbjct  279   LYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGQIHDFLVRMDDNYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
               ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  399   LSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 242/331 (73%), Gaps = 7/331 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDDFG+F P+ ELR+L+PSVD S  ISS+ L + Q+T FKCGGVSLG G+ H  +DG S 
Sbjct  115   IDDFGEFAPTPELRRLIPSVDYSAGISSYSLLILQLTYFKCGGVSLGVGVQHHSADGFSG  174

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF+H EY   P +K+   +K   ++
Sbjct  175   LHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPRPAFEHVEYKPAPAMKTAQPTKDSQSS  234

Query  704   PSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             P TA  M K+T +QL  LKT S   G+T     Y +L+ H+WRC C+AR L +DQ TKLY
Sbjct  235   PETAVGMFKMTREQLNTLKTKSKENGNTINYSSYAMLSGHVWRCACKARELPEDQETKLY  294

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G++ ++P   +A RI   L RMD++YLRS
Sbjct  295   IATDGRSRLQPPLPPGYFGNVIFTATPMAMAGDIQSKPTWYAASRIHDTLARMDNDYLRS  354

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QP LS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I++EG  
Sbjct  355   ALDYLELQPSLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIMFEGLA  414

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSP  D SLS+A+ L   HM  F+KLLY
Sbjct  415   FMLPSPANDGSLSVAIGLQPQHMKAFEKLLY  445



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 242/335 (72%), Gaps = 10/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  I S+ L + Q+T+FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGIESYALLVLQITQFKCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTLK+     +P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPQFPHVEYQPPPTLKTTE-ENVPN  218

Query  710   ANP----STAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQT  558
             A      S ++ K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL+ DQ 
Sbjct  219   AETVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLTQDQE  278

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYIATDGR+RL P+LPPG+ GNVIFTATPVA +G+L ++P+  +A +I   L  MD++
Sbjct  279   TKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLAIMDND  338

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+H++DFGWG P+ MGP  I Y
Sbjct  339   YLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAY  398

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             EG  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  399   EGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLY  433



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 249/335 (74%), Gaps = 8/335 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P++EL++L+P V+ S DISS+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTMELKQLIPKVNYSEDISSYPLLVLQVTFFKCGGVSLGVGMQHHVADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK--SGPLSKL  717
             + +HFI TW+D+ARGL + +PPFIDRT+LRAR+PP P F+H EY  PP LK  SG ++  
Sbjct  160   AGIHFINTWSDVARGLDITLPPFIDRTLLRARNPPTPKFQHIEYQQPPPLKDTSGIMNG-  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                + S A+ K+T +QL +LK  +   G     S+YE+L+ HIWRC C+AR L++DQ TK
Sbjct  219   EKTDISVAIFKLTKEQLEILKGKARENGNNIAYSSYEMLSGHIWRCACKARNLAEDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR+RL P++PPG+ GNVIFT TP+A +G+++++P   +A  I  AL RMDDEYL
Sbjct  279   LYIATDGRNRLRPSIPPGYFGNVIFTTTPMAVTGDIISKPTYYAASVIHEALGRMDDEYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL+ LVRG++ F  PN+ I SW+RLP+H++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLELQPDLTALVRGAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               ++LPS   D SLS+A+ L  DHM  F K+LY+ 
Sbjct  399   LAFVLPSSVNDGSLSVALGLQPDHMVRFAKMLYEI  433



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 243/334 (73%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLNLRQLIPDVDHSAGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKL  717
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P+++  PL  SK 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMRI-PLDPSKS  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                N + ++ K++  QL  LK  S  +G     S+YE+LA H+WR V +ARGL DDQ TK
Sbjct  219   GPDNTTVSIFKLSRDQLVALKAKSKEDGNIVSYSSYEMLAGHVWRSVGKARGLPDDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A  I   LVRMDD YL
Sbjct  279   LYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLVRMDDNYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
               ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  399   LSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  432



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 244/334 (73%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLNLRQLIPEVDHSTGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKL  717
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P++K  PL  SK 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMKI-PLDPSKS  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
                N + ++ K+T  QL  LK  S  +G+T     YE+LA H+WR V +ARGL +DQ TK
Sbjct  219   GPENTTVSIFKLTRDQLVALKAKSKEDGNTVSYSSYEMLAGHVWRSVGKARGLPNDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A +I   LVRMDD YL
Sbjct  279   LYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGQIHDFLVRMDDNYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
               ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  399   LSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 239/326 (73%), Gaps = 7/326 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               I DFGDF P+LE+RKL+P+VD S  ISS+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  100   GVIGDFGDFAPTLEMRKLIPAVDYSQGISSYALLVLQITYFKCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPT+++     +P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPTFPHIEYQPPPTMRTKNNETVPD  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
              +   ++ K+T  Q+  LK  S  +G     S+YEI+A H+WRCVC+ARGL +DQ TKLY
Sbjct  220   TD--VSIFKLTRDQINSLKAKSKDDGNAIGYSSYEIMAGHLWRCVCKARGLPEDQETKLY  277

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P+LPPG+ GNVIFT TP+A +G+L ++P   +A RI  AL RMD++YLRS
Sbjct  278   IATDGRARLKPSLPPGYFGNVIFTTTPIAVAGDLQSKPAWYAASRIHDALTRMDNDYLRS  337

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  338   ALDYLELQPDLKALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLS  397

Query  185   YILPSPNKDRSLSLAVCLDADHMPLF  108
             ++LPSP  D SLS+A+ L A+HM LF
Sbjct  398   FVLPSPTNDGSLSVAISLQAEHMKLF  423



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 241/335 (72%), Gaps = 10/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  I S+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGIESYALLVLQITHFKCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTL++      P 
Sbjct  160   SGLHFINTWSDMARGLDITIPPFIDRTLLRARDPPQPQFPHVEYQPPPTLEATE-ENAPN  218

Query  710   ANP----STAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQT  558
             A+     S ++ K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL+ DQ 
Sbjct  219   ADTVPETSVSIFKLTRNQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLTQDQE  278

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYIATDGR+RL P+LPPG+ GNVIFTATPVA +G+L ++P+  +A +I   L  MD++
Sbjct  279   TKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLAIMDND  338

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+H++DFGWG P+ MGP  I Y
Sbjct  339   YLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAY  398

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             EG  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  399   EGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLY  433



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 240/333 (72%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+LELR+L+ +VD    IS++ L + QVT FKCGGVSLG G+ H ++DG 
Sbjct  104   SILDDFGDFAPTLELRRLILAVDYFAGISTYALLVLQVTYFKCGGVSLGVGMQHHVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LR RDPP PAF H EY   P +K+   S  PG
Sbjct  164   SGLHFINTWSDIARGLDLTIPPFIDRTLLRGRDPPQPAFHHIEYQPAPLMKTPLQSAKPG  223

Query  710   ANPST--AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             A  +T  ++ ++T  QL +LK+ S   G+T     YE+ + H+WRCVC+A    DDQ TK
Sbjct  224   AADTTTVSIFRLTRDQLNILKSKSKKAGNTVSYSSYEMFSGHVWRCVCKASEFPDDQDTK  283

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFT TP+A +G+L ++P   +A RI  ALVRMDD YL
Sbjct  284   LYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQSKPTWYAASRIHDALVRMDDNYL  343

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I +EG
Sbjct  344   RSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGQPIFMGPGGIAFEG  403

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPS     SLSLA+CL ++HM  F +LLY
Sbjct  404   LAFVLPSATNGGSLSLAICLQSEHMKSFSRLLY  436



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 245/337 (73%), Gaps = 11/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A I+DFGDF+P+LELR+L+PSVD S  I S+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AAIEDFGDFSPTLELRQLIPSVDYSAGIHSYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPP-TLKSGPLS-KL  717
             S LHFI  W+D+ARGL +++PPFIDRT+LRARDPP P F H EY  PP T K+ PL    
Sbjct  160   SGLHFINAWSDVARGLDISLPPFIDRTLLRARDPPLPVFDHIEYKPPPATKKTTPLQPSK  219

Query  716   PGANPSTAM----LKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDD  564
             P  + STA+     K+T  QL+ LK  S  +G+T     YE+LA H+WR VC+AR L DD
Sbjct  220   PLGSDSTAVAVSTFKLTRDQLSTLKGKSREDGNTISYSSYEMLAGHVWRSVCKARALPDD  279

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q TKLYIATDGR+RL P LP G+ GNVIFT TP+A +G+L+++P   +A RI  AL+RMD
Sbjct  280   QETKLYIATDGRARLQPPLPHGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHDALIRMD  339

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             +EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I
Sbjct  340   NEYLRSALDYLELQPDLKSLVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGI  399

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              YEG  +I+PS   D SLSLA+ L  + M +FQ+L Y
Sbjct  400   AYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFY  436



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 240/333 (72%), Gaps = 10/333 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              T+DDFGDF P+LELR+L+P+VD +  I S+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  101   GTVDDFGDFAPTLELRRLIPAVDYTQGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGF  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI  W+D+ARG+ + IP FIDRT+LRARDPP P F H EY  PPTL +   ++   
Sbjct  161   SGLHFINAWSDMARGIDLTIPTFIDRTLLRARDPPLPQFPHIEYQPPPTLNNIAKTE---  217

Query  710   ANPST--AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             A P T  ++ K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL +DQ +K
Sbjct  218   AVPETDVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLEEDQGSK  277

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR RL P LPPG+ GNVIFTATP+A +G+L ++P+  +A +I  AL RMD++YL
Sbjct  278   LYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALARMDNDYL  337

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  338   RSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  397

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D SLS+A+ L ADHM LF+K LY
Sbjct  398   LSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  430



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 241/335 (72%), Gaps = 10/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  I S+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  100   GVVDDFGDFAPTLELRRLIPAVDYSQGIESYALLVLQITHFKCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK----SGPLS  723
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTLK    + P S
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPKFPHIEYQPPPTLKVTAENAPNS  219

Query  722   KLPGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQT  558
             + P    S ++ K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL+ DQ 
Sbjct  220   E-PVPETSVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLAQDQE  278

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYIATDGR+RL P+LP G+ GNVIFTATPVA +G+L ++P+  +A +I   L  MD++
Sbjct  279   TKLYIATDGRARLRPSLPSGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLAIMDND  338

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+H++DFGWG P+ MGP  I Y
Sbjct  339   YLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAY  398

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             EG  +ILPSP  D S S+A+ L A+HM LF+K LY
Sbjct  399   EGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLY  433



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 242/336 (72%), Gaps = 11/336 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               IDDFGDF P+LELRKL+P+VD +  I S+ L + QVT FKCGGVSLG G+ H  +DG 
Sbjct  100   GVIDDFGDFAPTLELRKLIPAVDYTLGIESYSLLVLQVTYFKCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+DLARGL +A+PPFIDRT+LR+RDPP PAF H EY   P +K+ P +  P 
Sbjct  160   SGLHFINTWSDLARGLDLAVPPFIDRTLLRSRDPPQPAFDHIEYQPAPPMKTAP-TPTPT  218

Query  710   ANPST-----AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQ  561
              + S      ++ K+T  Q+  LK  S  +G+T     YE+L+ H+WRCVC+ARGL DDQ
Sbjct  219   DDESVPETTVSIFKLTRDQVNALKGKSKEDGNTVNYSSYEMLSGHVWRCVCKARGLPDDQ  278

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLYIATDGR+RL P+LP G+ GNVIFT TP+A +G+L ++P   +A +I  AL RMDD
Sbjct  279   DTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDLQSKPTWYAASKIHDALARMDD  338

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             +YL+SALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I 
Sbjct  339   DYLKSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIA  398

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             YEG  ++LPSP  D SLS+ + L A+HM LF K LY
Sbjct  399   YEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLY  434



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 247/335 (74%), Gaps = 8/335 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P++EL++L+P V+ S DISS+ L + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTMELKQLIPKVNYSEDISSYALLVLQVTFFKCGGVSLGVGMQHHVADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK--SGPLSKL  717
             + LHFI TW+D+ARGL + +PPFIDRT+LRAR+PP P F H EY  PP LK  SG ++  
Sbjct  160   AGLHFINTWSDVARGLDITLPPFIDRTLLRARNPPIPKFHHVEYQQPPPLKDTSGIMNG-  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                + S A+ ++T +QL +LK  +   G     S+YE+L+ HIWRC C+AR L +DQ TK
Sbjct  219   EKNDFSVAIFRLTKEQLDILKGKARENGNKVSYSSYEMLSGHIWRCACKARNLREDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P+LPPG+ GNVIFT TP+A +G+++++P   +A  I   L RMDD+YL
Sbjct  279   LYIATDGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVSKPTYYAASVIHDTLGRMDDDYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL+ LVRG++ F  PN+ I SW+RLP+H++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLELQPDLTALVRGAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               +ILPS  KD SLS+A+ L  DHM  F+K+LY+ 
Sbjct  399   LAFILPSSTKDGSLSVALGLQPDHMVRFEKMLYEI  433



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 242/332 (73%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF PSL LR+L+P VD S  + +FPL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPSLTLRQLIPDVDYSAGVHTFPLLVLQVTFFKCGGASLGVGLQHHVADGS  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             SALHFI TW+D+ARGL + +PPFIDRT+LRARDPP PAF H EY   PT++  P SK   
Sbjct  160   SALHFINTWSDMARGLDLTVPPFIDRTLLRARDPPQPAFDHVEYQPSPTMRI-PSSKPEP  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ KI+   L  LK  S  +G+T     YE+LA H+WR VC+ARGL +DQ TK Y
Sbjct  219   DDTTVSIFKISRDMLVSLKAKSKQDGNTLSYSSYEVLAGHVWRSVCKARGLPEDQETKFY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IA DGRSRL P LPPG+LGNVIFTATP+  +G+L+++P   +A  I  A+VRMDD YL S
Sbjct  279   IAIDGRSRLRPQLPPGYLGNVIFTATPLTVAGDLVSKPTWYAAGMIHDAIVRMDDNYLWS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ +  PNL I SWT+LP++++DFGWG P++MGP  I +EG  
Sbjct  339   ALDYLEMQPDLSALVRGAHTYKCPNLGITSWTKLPIYDADFGWGRPIYMGPGAIAFEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLSLA+ L ++HM LF+K  Y 
Sbjct  399   FVLPSPTNDGSLSLAINLQSEHMKLFKKFFYN  430



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/334 (59%), Positives = 243/334 (73%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLNLRQLIPDVDHSPGIHSFPLLVLQVTFFKCGGASLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKL  717
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P+++  PL  SK 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMRI-PLDPSKS  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
                N + ++ K++  QL  LK  S  +G+T     YE+LA H+WR V +ARGL DDQ TK
Sbjct  219   GPDNTTVSIFKLSRDQLVALKAKSKDDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A  I   LVRMDD YL
Sbjct  279   LYIATDGRSRLRPQLPPGYFGNVIFTATPLAIAGDLLSKPTWYAAGLIHDVLVRMDDNYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
               ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  399   LSFVLPSPTNDGSLSVAIALQSEHMKLFEKYLYE  432



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 240/333 (72%), Gaps = 10/333 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              T+DDFGDF P+LELR+L+P+VD +  I S+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  108   GTVDDFGDFAPTLELRRLIPAVDYTQGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGF  167

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI  W+D+ARG+ + IP FIDRT+LRARDPP P F H EY  PPTL +   ++   
Sbjct  168   SGLHFINAWSDMARGIDLTIPTFIDRTLLRARDPPLPQFPHIEYQPPPTLNNIAKTE---  224

Query  710   ANPST--AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             A P T  ++ K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL +DQ +K
Sbjct  225   AVPETDVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLEEDQGSK  284

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR RL P LPPG+ GNVIFTATP+A +G+L ++P+  +A +I  AL RMD++YL
Sbjct  285   LYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALARMDNDYL  344

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG
Sbjct  345   RSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEG  404

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               +ILPSP  D SLS+A+ L ADHM LF+K LY
Sbjct  405   LSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  437



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 241/331 (73%), Gaps = 6/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDD GDF PSL LR+L+P VD S  + +FPL + QVT F+CGG SLG G+ H ++DG 
Sbjct  141   SVIDDLGDFAPSLTLRQLIPDVDYSAGVHTFPLLVLQVTFFRCGGASLGVGLQHHVADGS  200

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             SALHFI TW+D+ARGL + +PPFIDRT+LRARDPP PAF H EY   PT+K  P SK   
Sbjct  201   SALHFINTWSDMARGLDLTVPPFIDRTLLRARDPPQPAFDHVEYQPSPTMKI-PSSKPDP  259

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ KI+   L  LK  S  +G+T     YE+LA H+WR VC+ARGL DDQ TK Y
Sbjct  260   DDTTVSIFKISHDLLCALKAKSKQDGNTMSYSSYEVLAGHVWRSVCKARGLQDDQETKFY  319

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IA DGRSRL P LPPG+LGNVIFTATP+  +G+LL++P   +A  I  A+VRM+D YL S
Sbjct  320   IAIDGRSRLRPQLPPGYLGNVIFTATPLTVAGDLLSKPTWYAAGMIHDAIVRMNDNYLWS  379

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ +  PNL I SWT+LP++++DFGWG P++MGP  I YEG  
Sbjct  380   ALDYLELQPDLSSLVRGAHTYKCPNLGITSWTKLPIYDADFGWGRPIYMGPGAIAYEGLS  439

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSP  D SLSLA+ L ++HM LFQK  Y
Sbjct  440   FVLPSPTNDGSLSLAIALQSEHMKLFQKFFY  470



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 240/332 (72%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+LELR+L+P+VD S  I ++PL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLELRQLIPAVDYSQGIETYPLLVLQVTHFKCGGASLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP + +        
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPLFDHIEYKPPPPMNTQQHPTNSH  219

Query  710   ANPS-TAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
               P+  ++ K+T  QL  LK  S  +G+T     YE+LA H+WR VC+AR L  DQ TKL
Sbjct  220   TVPADVSIFKLTRDQLCTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPHDQETKL  279

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGRSRL P+ PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RMD+EYLR
Sbjct  280   YIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNEYLR  339

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG PV MGP  I YEG 
Sbjct  340   SALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPVFMGPGGIAYEGL  399

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +I+P+   D S+S+A+ L  DHM +F+  LY
Sbjct  400   SFIIPNSTNDGSVSVAIALQPDHMKVFKDYLY  431



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   395 bits (1016),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 234/333 (70%), Gaps = 31/333 (9%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SGDI S+ L + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPTVDYSGDIGSYSLLILQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H E                 
Sbjct  160   SGLHFINTWSDMARGLDITIPPFIDRTLLRARDPPQPAFHHIE-----------------  202

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
                      IT  QL  LK  S  +G+T     Y +LA H+WRC C+AR L  DQ +K+Y
Sbjct  203   ---------ITRDQLNTLKNKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMY  253

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL PALPPG+ GNVIFT TPVA +GEL+++PL  +A +I +AL RMDDEYLRS
Sbjct  254   IATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRS  313

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL+ LVRG++ F  PN+ I SWTRLP++++DFGWG P+ MGP  I  EG  
Sbjct  314   ALDYLELQPDLTALVRGAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLA  373

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             + LPSP  D SLS+A+ L  DHM LFQK LY+ 
Sbjct  374   FALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  406



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score =   396 bits (1018),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 240/332 (72%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDF P+LELR+L+P+VD S  I ++PL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   AVVDDFGDFAPTLELRQLIPAVDYSQGIETYPLLVLQVTHFKCGGASLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP + +        
Sbjct  160   SGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPLFDHIEYKPPPPMNTQQHPTNSH  219

Query  710   ANPS-TAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
               P+  ++ K+T  QL  LK  S  +G+T     YE+LA H+WR VC+AR L  DQ TKL
Sbjct  220   TVPADVSIFKLTRDQLCTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPHDQETKL  279

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGRSRL P+ PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RMD+EYLR
Sbjct  280   YIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNEYLR  339

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG PV MGP  I YEG 
Sbjct  340   SALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPVFMGPGGIAYEGL  399

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              +I+P+   D S+S+A+ L  DHM +F+  LY
Sbjct  400   SFIIPNSTNDGSVSVAIALQPDHMKVFKDYLY  431



>ref|XP_010462493.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 239/332 (72%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  + +FPL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLTLRQLIPDVDYSAGVHTFPLLVLQVTFFKCGGASLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P+++  P    P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMRI-PSKPGPP  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              N + ++ K++  QL  LK  S  +G+T     YE+LA H+WR V +ARGL DDQ TKLY
Sbjct  219   DNTTVSIFKLSRDQLVALKAKSKQDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +A DGRSRL P LPPG+ GNVIFTATP+  +GELL++P   +A  I   + RMDD YLRS
Sbjct  279   VAIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLSKPTWYAAGLIHDVIARMDDNYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGIPYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  399   FVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 239/331 (72%), Gaps = 10/331 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              ++DD+GDF P+LELR+L+P+VD S  IS++ L + QVT+FKCGGVSLG G+ H ++DG 
Sbjct  103   GSVDDYGDFAPNLELRRLIPAVDYSQGISTYALLVLQVTKFKCGGVSLGVGMQHHVADGF  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + +PPFIDRT+L ARDPP P FKH EY   P +K+        
Sbjct  163   SGLHFINTWSDMARGLDITLPPFIDRTLLLARDPPQPQFKHIEYQPAPAMKT-----YDA  217

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
                  ++ K+T +QL  LK  S  +G+T     YE+LA H+WRC C AR L +DQ TKLY
Sbjct  218   TETVVSIFKLTREQLTTLKAKSKEDGNTVTYSSYEMLAGHVWRCACLARSLPEDQDTKLY  277

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P LP G+ GNVIFT TP A +G+L ++P+  +A +I  AL +MD+EYLRS
Sbjct  278   IATDGRARLQPPLPQGYFGNVIFTTTPQAVAGDLDSKPVWYAASKIHDALAQMDNEYLRS  337

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  338   ALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  397

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             ++LPSP  D SLS+A+ L A+HM LF+KLLY
Sbjct  398   FVLPSPANDGSLSVAISLQAEHMKLFEKLLY  428



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/334 (58%), Positives = 242/334 (72%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPEVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKL  717
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P++K  PL  SK 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFDHVEYQPAPSMKI-PLDPSKS  218

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
                + + ++ K++  QL  LK  +  +G+T     YE+LA H+WR V ++RGL DDQ TK
Sbjct  219   SPDSTTVSIFKLSRDQLVSLKAKAKEDGNTVSYSSYEMLAGHVWRSVGKSRGLPDDQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A  I   L RMDD YL
Sbjct  279   LYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWFAAGLIHDVLARMDDNYL  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  339   RSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEG  398

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
               ++LPSP  D SLS+A+ L  +HM LF+K LY+
Sbjct  399   LSFVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 244/337 (72%), Gaps = 11/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A I+DFGDF+P+LELR+L+PSVD S  I S+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AAIEDFGDFSPTLELRQLIPSVDYSAGIHSYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPP-TLKSGPLS-KL  717
             S LHFI  W+D+ARGL +++PPFIDRT+LRARDPP P F H EY  PP T K+ PL    
Sbjct  160   SGLHFINAWSDVARGLDISLPPFIDRTLLRARDPPLPVFDHIEYKPPPATKKTTPLQPSK  219

Query  716   PGANPSTAM----LKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDD  564
             P  + STA+     K+T  QL+ LK  S  +G+T     YE+LA H+WR VC+AR L DD
Sbjct  220   PLGSDSTAVAVSTFKLTRDQLSTLKGKSREDGNTISYSSYEMLAGHVWRSVCKARALPDD  279

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q TKLYIATDGR+RL P LP G+ GNVIFT T +A +G+L+++P   +A RI  AL+RMD
Sbjct  280   QETKLYIATDGRARLQPPLPHGYFGNVIFTTTRIAVAGDLMSKPTWYAASRIHDALIRMD  339

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             +EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I
Sbjct  340   NEYLRSALDYLELQPDLKSLVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGI  399

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              YEG  +I+PS   D SLSLA+ L  + M +FQ+L Y
Sbjct  400   AYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFY  436



>ref|XP_010501253.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=431

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 239/332 (72%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  + +FPL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLTLRQLIPDVDYSAGVHTFPLLVLQVTFFKCGGASLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P+++  P    P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMRI-PSKPGPP  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              N + ++ K++  QL  LK  S  +G+T     YE+LA H+WR V +ARGL DDQ TKLY
Sbjct  219   DNTTVSIFKLSRDQLVALKAKSKQDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +A DGRSRL P LPPG+ GNVIFTATP+  +GELL++P   +A  I   + RMDD YLRS
Sbjct  279   VAIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLSKPTWYAAGLIHDVIARMDDNYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGIPYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  399   FVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/332 (58%), Positives = 241/332 (73%), Gaps = 8/332 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDDFGDF P+L+LR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG S 
Sbjct  102   IDDFGDFAPTLDLRQLIPDVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADGFSG  161

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKLPG  711
             LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P++K  PL  SK   
Sbjct  162   LHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFDHVEYQPAPSMKI-PLDPSKSSP  220

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ K++  QL  LK  +  +G+T     YE+LA H+WR V +ARGL DDQ TKLY
Sbjct  221   DSTTVSIFKLSRDQLVSLKAKAKEDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLY  280

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A  I   L RMDD YLRS
Sbjct  281   IATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLARMDDNYLRS  340

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG  
Sbjct  341   ALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEGLS  400

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLS+A+ L  +HM LF+K LY+
Sbjct  401   FVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score =   395 bits (1014),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 241/336 (72%), Gaps = 8/336 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF+PSLELR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  121   AAIDDFGDFSPSLELRQLIPAVDYSAGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGA  180

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSK-LP  714
             S LHFI  W+DLARG  +++PPFIDRT+L +RDPP P F H EY  PP + +  L    P
Sbjct  181   SGLHFINAWSDLARGFDISLPPFIDRTLLCSRDPPRPVFDHIEYRPPPAMNTTTLQPPKP  240

Query  713   GANPSTAM--LKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTT  555
             G++ + A+   K++  QL  LK  S  +G     S+YE+LA H+WR VC AR L D+Q T
Sbjct  241   GSDGAVAVSTFKLSRDQLNTLKGKSREDGNSISYSSYEMLAGHVWRSVCRARELPDEQET  300

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYIATDGRSRL P LPPG+ GNVIFT TPVA +G+L+++P   +A RI  AL+RMD+EY
Sbjct  301   KLYIATDGRSRLQPPLPPGYFGNVIFTTTPVAVAGDLISKPTWYAASRIHDALMRMDNEY  360

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALDYLE QPDL  LVRGS+ F  PNL I SW RLP+H++DFGWG PV MGP  I YE
Sbjct  361   LRSALDYLEVQPDLKALVRGSHTFRCPNLGITSWVRLPIHDADFGWGRPVFMGPGGIAYE  420

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  +I+PS   D ++S+A+ L  D M +FQ L Y F
Sbjct  421   GLSFIIPSSTNDGTMSVAIALPPDRMKVFQDLFYDF  456



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score =   394 bits (1011),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 241/332 (73%), Gaps = 8/332 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDDFGDF P+L+LR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG S 
Sbjct  102   IDDFGDFAPTLDLRQLIPDVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADGFSG  161

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKLPG  711
             LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P++K  PL  SK   
Sbjct  162   LHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFDHVEYQPAPSMKI-PLDPSKSSP  220

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ K++  QL  LK  +  +G+T     YE+LA H+WR V +ARGL DDQ TKLY
Sbjct  221   DSTTVSIFKLSRDQLVSLKAKAKEDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLY  280

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A  I   L RMDD YLRS
Sbjct  281   IATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLARMDDNYLRS  340

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG  
Sbjct  341   ALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEGLS  400

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             +++PSP  D SLS+A+ L  +HM LF+K LY+
Sbjct  401   FVVPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_009380783.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=440

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 243/337 (72%), Gaps = 11/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             AT+DDFGDF P++E+++L+P VD +GDISSFPL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  102   ATVDDFGDFAPTMEMKQLIPHVDYTGDISSFPLLVLQVTYFKCGGVSLGVGMQHQVADGF  161

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK------SGP  729
             S LHFI +W+D+ARGL VA+PPF+DR+IL ARDPP P F H EY   P +K      +  
Sbjct  162   SGLHFINSWSDIARGLDVAVPPFMDRSILLARDPPTPCFPHVEYHPAPHMKRHHRPGAED  221

Query  728   LSKLPGANPSTAMLKITPQQLALLKTNS---SHEGSTYEILAAHIWRCVCEARGLSDDQT  558
               + P A  +  + K+T  QL+LLK  +       STY +LAAH+WRC C ARGL  DQ 
Sbjct  222   SVEAPTAAAAVDIFKLTKAQLSLLKLKAPPGPASYSTYALLAAHVWRCACVARGLPPDQP  281

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPL--ASSAKRIRSALVRMD  384
             TK+YIATDGR RL PALP G+ GNVIFT TP+A +GE+  E    A +A RI++AL RMD
Sbjct  282   TKMYIATDGRQRLRPALPEGYFGNVIFTTTPIATAGEVAAEGCGPAPAAGRIQAALARMD  341

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             + YLRSALDYLE QPDL+ LVRG++ F  PN+ + SW RLP+H++DFGWG PV MGP  I
Sbjct  342   EPYLRSALDYLELQPDLAALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGI  401

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              YEG  ++LPSP  D SLSLA+ L ADHM  F+KL+Y
Sbjct  402   AYEGLAFLLPSPTGDGSLSLAISLRADHMLKFRKLIY  438



>ref|XP_010480194.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 239/332 (72%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  + +FPL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLTLRQLIPDVDYSAGVHTFPLLVLQVTFFKCGGASLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P+++  P    P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMRI-PSKPGPP  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ K++  QL  LK  S  +G+T     YE+LA H+WR V +ARGL DDQ TKLY
Sbjct  219   DSTTVSIFKLSRDQLVALKAKSKQDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +A DGRSRL P LPPG+ GNVIFTATP+  +GELL++P   +A  I   + RMDD YLRS
Sbjct  279   VAIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLSKPTWYAAGLIHDVIARMDDNYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG  
Sbjct  339   ALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGIPYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  399   FVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>ref|XP_006307576.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
 gb|EOA40474.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
Length=431

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 241/334 (72%), Gaps = 10/334 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  + +FPL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SVIDDFGDFAPTLTLRQLIPQVDYSAGVHTFPLLVLQVTFFKCGGASLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P+++   +   PG
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMR---IPSKPG  216

Query  710   A--NPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
             +  + + ++ K++  QL  LK  S  +G+T     YE+LA H+WR V +ARGL DDQ TK
Sbjct  217   SPDDATVSIFKLSRDQLVALKAKSKEDGNTISYSSYEMLAGHVWRSVGKARGLPDDQETK  276

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LY+A DGRSRL P LPPG+ GNVIFTATP+  +G+LL++P   +A  I   + RMDD YL
Sbjct  277   LYVAVDGRSRLRPQLPPGYFGNVIFTATPLTVAGDLLSKPTWFAAGMIHDVIARMDDNYL  336

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  337   RSALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGIPYEG  396

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
               ++LPSP  D SLS+A+ L ++HM LF+K LY+
Sbjct  397   LSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 241/333 (72%), Gaps = 6/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TIDDFGDF P+LE RKL+P+VD S  IS++PL + QVT FKCGGVSLG G+ H ++DGL
Sbjct  109   STIDDFGDFAPTLEFRKLIPAVDYSAGISTYPLLVLQVTYFKCGGVSLGVGLEHRVADGL  168

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P +K+G  S +  
Sbjct  169   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQPAFDHIEYQPDPPIKTGTKS-VGD  227

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ ++T +QL +LK  S  +G     +TYE+LA H+WRC   AR L DDQ TKL+
Sbjct  228   ESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARELPDDQETKLH  287

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IA DGRSRL P LPPGF GNV+F   P+A +G+L ++P   +A RI  A+VRMD++YLRS
Sbjct  288   IAVDGRSRLQPQLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASRIHDAVVRMDNDYLRS  347

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG+  F  P L I +W+RLP++++DFGWG P+ MGP  + YEG  
Sbjct  348   ALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPIYDADFGWGRPIFMGPGGMGYEGLA  407

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  408   FVLPSATNDGSLSVAISLQSQHMKSFSKLLYEI  440



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 242/335 (72%), Gaps = 11/335 (3%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             T+DDFGDF P++EL++L+P V  + DIS+FPL + QVT FKCGGVSLG G+ H ++DG S
Sbjct  101   TVDDFGDFAPTMELKQLIPKVVYTDDISAFPLLVLQVTYFKCGGVSLGVGMQHHVADGTS  160

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS-----GPLS  723
              LHFI +W+D+ARGL ++ PPFIDRT+LRARDPP P+F H EY  PP++K+      P++
Sbjct  161   GLHFINSWSDVARGLGISAPPFIDRTLLRARDPPTPSFPHVEYQPPPSMKAAATPPAPVN  220

Query  722   KLPGANPSTA--MLKITPQQLALLKTNS--SHEGSTYEILAAHIWRCVCEARGLSDDQTT  555
              +    P TA  + K T  QL LLK  +      STY + AAH+WRC   AR L  DQ +
Sbjct  221   SVKSGGPVTAVSLFKFTRAQLDLLKAKAPKGSRYSTYALFAAHVWRCASLARELPPDQLS  280

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYIATDGR RL P LP G+ GNVIFTATPVAE  E++      +A RI+++L RMDDEY
Sbjct  281   KLYIATDGRQRLRPQLPAGYFGNVIFTATPVAEMVEVVGS--EGAAGRIQASLARMDDEY  338

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALDYLE QPDL+ LVRG++ F  PN+ + SW RLP+H++DFGWG PV MGP  I YE
Sbjct  339   LRSALDYLEIQPDLAALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYE  398

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             G  ++LPSP+ D SLSLA+ L A+HM  FQKL+Y+
Sbjct  399   GLAFVLPSPDGDGSLSLAISLQAEHMLRFQKLIYE  433



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score =   391 bits (1004),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 241/335 (72%), Gaps = 8/335 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF  +LELRKL+P+VD SG ISS P+ + QVT FKCGGVSLG G+ H ++DG 
Sbjct  107   SVVDDFGDFA-TLELRKLIPTVDYSGGISSDPILVLQVTYFKCGGVSLGVGMQHHVADGF  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+DLARGL V +PPFIDRT+LRAR PP P F H EY  PP L+  P +    
Sbjct  166   SGLHFVNTWSDLARGLDVKLPPFIDRTLLRARSPPRPQFPHIEYQSPPALRVSPETTNSA  225

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG------STYEILAAHIWRCVCEARGLSDDQTTK  552
              + +T ++L++T + L  LKT +  +       S+YEILA H+WRC C ARGLSDDQ TK
Sbjct  226   PDSTTVSILRVTREWLDNLKTQAELDNGNTTRYSSYEILAGHVWRCACRARGLSDDQDTK  285

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             +YIATD R RL P LP G+ GN I T TP+A +G+L+++P++ +A++I  +L RM+D YL
Sbjct  286   VYIATDARMRLSPPLPQGYFGNGILTTTPIAVAGDLISKPVSYAAQKIHESLARMNDNYL  345

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS L RG++ F  PNL I SW RLP+H++DFGWG P++MGP  I YEG
Sbjct  346   RSALDYLELQPDLSALARGAHTFRCPNLGIVSWVRLPIHDADFGWGRPIYMGPGGIAYEG  405

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               YILPSP  D SLS+A+ L  +H+  F+K  Y F
Sbjct  406   LSYILPSPTSDGSLSVAISLQTEHVKPFEKFFYDF  440



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 239/336 (71%), Gaps = 11/336 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               IDDFGDF P+LELRKL+P+VD +  I S+ L + QVT F+CGGVSLG G+ H  +DG 
Sbjct  100   GVIDDFGDFAPTLELRKLIPAVDYTLGIESYSLLVLQVTYFRCGGVSLGVGMQHHAADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+DLARGL + +PPFIDRT+LRARDPP PAF H EY   P +K+ P +  P 
Sbjct  160   SGLHFINTWSDLARGLDLTVPPFIDRTLLRARDPPQPAFDHIEYQPAPPMKTAP-TPTPT  218

Query  710   ANPST-----AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQ  561
              + S      ++ ++T  Q+  LK  S  +G+T     YE+L+ H+WRCV +ARGL DDQ
Sbjct  219   DDESVPETTVSIFRLTRDQVNALKGKSKEDGNTINYSSYEMLSGHVWRCVRKARGLPDDQ  278

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLYIATDGR+RL P+LP G+ GNVIFT TP+A +G+L ++P   +A +I  AL RMDD
Sbjct  279   DTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDLQSKPTWYAASKIHDALARMDD  338

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             +YL+SALDYLE QPDL  LVRG + F  PNL I SW RLP+H++DFGWG P+ MGP  I 
Sbjct  339   DYLKSALDYLELQPDLKALVRGVHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIA  398

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             YEG  ++LPSP  D SLS+ + L A+HM LF K LY
Sbjct  399   YEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLY  434



>ref|XP_003637275.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Medicago truncatula]
Length=432

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/331 (56%), Positives = 239/331 (72%), Gaps = 5/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DDFGDF P+L LR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   ASVDDFGDFAPTLRLRQLIPAVDYSAGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V+IPPFI RT+L ARDPP P F H EY  PP+++         
Sbjct  160   SGLHFINSWSDVARGLDVSIPPFIGRTLLHARDPPRPVFDHIEYKPPPSMQHAKQGSDTS  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             A+ + ++ K+T QQL +LK  S  +G+T     YE+LA H+WR V +AR L  DQ TKLY
Sbjct  220   ASVAVSIFKLTRQQLNILKGKSKEDGNTINYSSYEMLAGHVWRSVSKARALPVDQETKLY  279

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P+LP G+ GNVIFT TP+A + +L+++P   +A RI +AL++MD++YLRS
Sbjct  280   IATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMSKPTWYAASRIHNALLQMDNDYLRS  339

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP++ +DFGWG P+ MGP  I YEG  
Sbjct  340   ALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIYEADFGWGRPIFMGPGGIAYEGLS  399

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS   D SLSLA+ L  D M LFQ+L Y
Sbjct  400   FIIPSSTNDGSLSLAIALPPDQMKLFQELFY  430



>ref|XP_007215395.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
 gb|EMJ16594.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
Length=440

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 242/334 (72%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TI+DFGDF P+LE RKL+P+VD S  IS++PL + QVT FKCGGVSLG G+ H ++DGL
Sbjct  109   STIEDFGDFAPTLEFRKLIPAVDYSAGISTYPLLVLQVTYFKCGGVSLGVGLEHRVADGL  168

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P +K+G  +K  G
Sbjct  169   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQPAFDHIEYQPDPPIKTG--TKAVG  226

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKL  549
                +T ++ ++T +QL +LK  S  +G     +TYEILA H+WRC   AR L DDQ TKL
Sbjct  227   DESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEILAGHVWRCASVARELPDDQETKL  286

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             +IA DGRSRL P LPPGF GNV+F   P+A +G+L ++P   +A  I   +VRMD++YLR
Sbjct  287   HIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASCIHDTVVRMDNDYLR  346

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDLS LVRG++ F  P L I SW+RLP++++DFGWG P+ MGP  + YEG 
Sbjct  347   SALDYLELQPDLSPLVRGAHTFRCPRLGITSWSRLPIYDADFGWGRPIFMGPGGMGYEGL  406

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  407   AFVLPSATNDGSLSVAISLQSQHMQSFSKLLYEI  440



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 241/332 (73%), Gaps = 8/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDD GDF PSL LR+L+P VD S  + + PL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SVIDDLGDFAPSLTLRQLIPDVDYSVGVHTLPLLVVQVTFFKCGGASLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI  W+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P+++  P SK PG
Sbjct  160   SGLHFINAWSDMARGLDLTIPPFIDRTLLRARDPPQPAFDHVEYQPSPSIRI-PSSK-PG  217

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
              + +T ++ KI+   L  LK  S  +G+T     YE+LA H+WR VC+ARGL DDQ TKL
Sbjct  218   PDDNTVSIFKISRDLLLALKGKSKQDGNTVSYSSYEVLAGHVWRSVCKARGLPDDQETKL  277

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             Y+A DGRSRLCP LPPG+ GNVIF+ATP+  +G+LL++P   +A +I   +VRMDD YLR
Sbjct  278   YVAIDGRSRLCPQLPPGYFGNVIFSATPLTLAGDLLSKPTWYAAGKIHDVIVRMDDNYLR  337

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDLS LVR ++ +  PNL I SW RLP++++DFGWG P+ +GP  I YEG 
Sbjct  338   SALDYLEMQPDLSALVRCASTYKCPNLGITSWVRLPMYDADFGWGRPIFVGPGAIAYEGL  397

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              ++LPSP  D SLSLA+ L ++HM LF+K LY
Sbjct  398   SFLLPSPTNDGSLSLAIALQSEHMKLFEKFLY  429



>ref|XP_009789449.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
 ref|XP_009783860.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
Length=435

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/326 (57%), Positives = 236/326 (72%), Gaps = 8/326 (2%)
 Frame = -2

Query  1040  PSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHFIKTWA  861
             P+LELR+L+P+VD S  I S+ L + Q+T FKCGGVSLG G+ H  +DG S LHFI TW+
Sbjct  110   PTLELRQLIPAVDYSQGIQSYALLVLQITHFKCGGVSLGVGMQHHAADGASGLHFINTWS  169

Query  860   DLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKL-PGANPSTA--M  690
             D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTLK  P +   P   P T+  +
Sbjct  170   DMARGLDLTIPPFIDRTLLRARDPPQPQFPHVEYQPPPTLKVTPENTTNPEVVPETSVSI  229

Query  689   LKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLYIATDGRS  525
              K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL+ DQ TKLYIATDGRS
Sbjct  230   FKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLAHDQETKLYIATDGRS  289

Query  524   RLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLEC  345
             RL P+LPPG+ GNVIFT TP+A +G++ ++P+  +A ++  AL RMD++YLRSALDYLE 
Sbjct  290   RLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKLHDALARMDNDYLRSALDYLEL  349

Query  344   QPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPN  165
             QPDL  LVRG++ F  PNL I SW+RLP+H++DFGWG P+ MGP  I YEG  +ILPSP 
Sbjct  350   QPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPT  409

Query  164   KDRSLSLAVCLDADHMPLFQKLLYKF  87
              D S S+A+ L A+HM LF+K LY F
Sbjct  410   NDGSQSVAISLQAEHMKLFEKFLYDF  435



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 239/332 (72%), Gaps = 9/332 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDD GDF PS+ L KL+P VD S  I +FPL + QVT FKCGGVSLG GI H +SDGL
Sbjct  100   SVIDDLGDFAPSVNLSKLVPHVDYSPGIHTFPLLVLQVTFFKCGGVSLGVGIQHHVSDGL  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S++HFI +W+D+ARGL + +PPFIDRT+LRAR+PP P F H EY   P++K+     L  
Sbjct  160   SSIHFINSWSDMARGLDLTLPPFIDRTLLRAREPPHPTFHHVEYQPSPSMKT----PLHP  215

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              N + ++ K++   L  LK  +  +G+T     YE LAAH+WR V +AR   DDQ TKLY
Sbjct  216   DNTTVSIFKLSRDLLVALKAKAKEDGNTVSYSSYETLAAHVWRSVTKARAFPDDQVTKLY  275

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+LGNV+FTATP+A +G+LL++P +  A  I   L RMDDEYLRS
Sbjct  276   IATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDLLSKPTSYVAGLIHDVLARMDDEYLRS  335

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS L+RG+  +  PNL I SW RLP++++DFGWG PV MGP++I +EG  
Sbjct  336   ALDYLEMQPDLSALIRGAQTYNCPNLGITSWVRLPIYDADFGWGRPVFMGPSVIAFEGLS  395

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLSL + L  +HM LF+K LY+
Sbjct  396   FVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>gb|KEH39662.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/331 (56%), Positives = 239/331 (72%), Gaps = 5/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DDFGDF P+L LR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   ASVDDFGDFAPTLRLRQLIPAVDYSAGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V+IPPFI RT+L ARDPP P F H EY  PP+++         
Sbjct  160   SGLHFINSWSDVARGLDVSIPPFIGRTLLHARDPPRPVFDHIEYKPPPSMQHAKQGSDTS  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             A+ + ++ K+T QQL +LK  S  +G+T     YE+LA H+WR V +AR L  DQ TKLY
Sbjct  220   ASVAVSIFKLTRQQLNILKGKSKEDGNTINYSSYEMLAGHVWRSVSKARALPVDQETKLY  279

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P+LP G+ GNVIFT TP+A + +L+++P   +A RI +AL++MD++YLRS
Sbjct  280   IATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMSKPTWYAASRIHNALLQMDNDYLRS  339

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP++ +DFGWG P+ MGP  I YEG  
Sbjct  340   ALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIYEADFGWGRPIFMGPGGIAYEGLS  399

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS   D SLSLA+ L  D M LFQ+L Y
Sbjct  400   FIIPSSTNDGSLSLAIGLPPDQMKLFQELFY  430



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   388 bits (997),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 241/331 (73%), Gaps = 7/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+L+LR+L+P+VD SG I S+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLQLRQLIPAVDYSGGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D++RGL + + P+IDRT+LRARDPP PAF+H EY   P +K+ P+   P 
Sbjct  160   SGLHFVNTWSDMSRGLDLMLQPYIDRTLLRARDPPQPAFRHVEYQPAPPMKN-PVQADPE  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
                + ++ K T +QL LLK  S   G+T     YE+L+ H+WR  C+AR L +DQ TKLY
Sbjct  219   GT-TVSIFKFTREQLNLLKAKSKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKLY  277

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P LP G+ GNVIFT TP+A +GEL++ P   +A +I  AL RMD++YLRS
Sbjct  278   IATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRS  337

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QP++S LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  338   ALDYLEIQPNISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  397

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS + D SLS+A+ L   HM +F+KL +
Sbjct  398   FIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>ref|XP_008228811.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 241/334 (72%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TI+DFGDF P+LE RKL+P+VD S  IS++PL + QVT FKCGGVSLG G+ H ++DGL
Sbjct  109   STIEDFGDFAPTLEFRKLIPAVDYSAGISTYPLLVLQVTYFKCGGVSLGVGLEHRVADGL  168

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P +K+G  +K  G
Sbjct  169   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQPAFDHIEYQPDPPIKTG--TKAVG  226

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKL  549
                +T ++ ++T +QL +LK  S  +G     +TYE+LA H+WRC   AR L DDQ TKL
Sbjct  227   DESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARELPDDQETKL  286

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             +IA DGRSRL P LPPGF GNV+F   P+A +G+L ++P   +A RI   +VRMD++YLR
Sbjct  287   HIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASRIHDTVVRMDNDYLR  346

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDL  LVRG+  F  P L I +W+RLP++++DFGWG P+ MGP  + YEG 
Sbjct  347   SALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPIYDADFGWGRPIFMGPGGMGYEGL  406

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  407   AFVLPSATNDGSLSVAISLQSQHMKSFSKLLYEI  440



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score =   388 bits (997),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 240/335 (72%), Gaps = 10/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+ +L+ L+P+VD SG ISS+PLA+FQVT F+CGGVSLG G+ H   DG 
Sbjct  102   SVIDDFGDFAPTPQLKALIPAVDLSGGISSYPLAVFQVTYFECGGVSLGVGMEHHAVDGA  161

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ +W+D+ARGL + +PPFIDRT++R+RDPP PAF H EYD PP +K+   +    
Sbjct  162   SGLHFVNSWSDVARGLDIKVPPFIDRTLIRSRDPPRPAFDHIEYDAPPIMKNTASANFQK  221

Query  710   ANP-----STAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQ  561
              +      S A  KIT  QL  LK  S  +GS+     YE+L+ H+WRC C+AR L DDQ
Sbjct  222   NSKYQTTTSVANFKITKDQLIALKNKSKEDGSSVSYSSYEMLSGHVWRCACKARALPDDQ  281

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKL++A DGR+RL P LP  + GNVIFT TP+A +G+L+++P+  +A +I   LV+ ++
Sbjct  282   ETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDLVSKPIWYAASQIHKTLVKTNN  341

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYL+SA+DYLE QPDLS LVRG++ F  PNL I SW RLP++++DFGWG P+ MGP  I+
Sbjct  342   EYLKSAIDYLEIQPDLSALVRGAHTFRCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIM  401

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             +EG  Y+LPSP  D SLS+A+ L  +HM  F KL+
Sbjct  402   FEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLI  436



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Cucumis sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   388 bits (997),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 241/331 (73%), Gaps = 7/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDDFGDF P+L+LR+L+P+VD SG I S+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   AVIDDFGDFAPTLQLRQLIPAVDYSGGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D++RGL + + P+IDRT+LRARDPP PAF+H EY   P +K+ P+   P 
Sbjct  160   SGLHFVNTWSDMSRGLDLMLQPYIDRTLLRARDPPQPAFRHVEYQPAPPMKN-PVQADPE  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
                + ++ K T +QL LLK  S   G+T     YE+L+ H+WR  C+AR L +DQ TKLY
Sbjct  219   GT-TVSIFKFTREQLNLLKAKSKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKLY  277

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGR+RL P LP G+ GNVIFT TP+A +GEL++ P   +A +I  AL RMD++YLRS
Sbjct  278   IATDGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRS  337

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QP++S LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  
Sbjct  338   ALDYLEIQPNISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  397

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS + D SLS+A+ L   HM +F+KL +
Sbjct  398   FIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>ref|XP_009146509.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=428

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 238/332 (72%), Gaps = 9/332 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDD GDF PS+ L KL+P VD S  I +FPL + QVT FKCGGVSLG GI H +SDGL
Sbjct  100   SVIDDLGDFAPSVNLSKLVPHVDYSPGIHTFPLLVLQVTFFKCGGVSLGVGIQHHVSDGL  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S++HFI +W+D+ARGL + +PPFIDRT+LRAR+PP P F H EY   P++K      L  
Sbjct  160   SSIHFINSWSDMARGLDLTLPPFIDRTLLRAREPPHPTFHHVEYQPSPSMKI----PLHP  215

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              N + ++ K++   L  LK  +  +G+T     YE LAAH+WR V +AR   DDQ TKLY
Sbjct  216   DNTTVSIFKLSRDLLVALKAKAKEDGNTVSYSSYETLAAHVWRSVTKARAFPDDQVTKLY  275

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+LGNV+FTATP+A +G+LL++P +  A  I   L RMDDEYLRS
Sbjct  276   IATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDLLSKPTSYVAGLIHDVLARMDDEYLRS  335

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS L+RG+  +  PNL I SW RLP++++DFGWG PV MGP++I +EG  
Sbjct  336   ALDYLEMQPDLSALIRGAQTYNCPNLGITSWVRLPIYDADFGWGRPVFMGPSVIAFEGLS  395

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLSL + L  +HM LF+K LY+
Sbjct  396   FVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 239/333 (72%), Gaps = 8/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD GDF  +LELRKL+P+V+ S  ISS P+ + QVT FKCG VSLG G  H ++DG 
Sbjct  107   SVVDDLGDFA-TLELRKLIPAVNYSSGISSDPVLVLQVTYFKCGAVSLGVGTQHHVTDGF  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+DLARGL V +PPFIDRT+LRAR PP P F H EY  PP L+  P +    
Sbjct  166   SGLHFLNTWSDLARGLDVKLPPFIDRTLLRARSPPRPQFPHIEYQSPPALRVSPETTNSA  225

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG------STYEILAAHIWRCVCEARGLSDDQTTK  552
              + ST ++LK+T +QL  LKT +  E       ++YEILA H+WRC C ARGLSDDQ TK
Sbjct  226   PDSSTVSILKVTREQLDALKTQAVLENGNTTRYTSYEILAGHVWRCACRARGLSDDQDTK  285

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L+IATDGR RL P LP G+ GN IFT TP+A +G+L+++P++ +A++I  +L R +D+YL
Sbjct  286   LFIATDGRMRLSPPLPQGYFGNGIFTITPIAVAGDLISKPVSYAAQKIHESLARTNDDYL  345

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS L RG++ F  PNL I SW RLP+H++DFGWG P++MGP  I YEG
Sbjct  346   RSALDYLELQPDLSALARGAHTFRCPNLGITSWVRLPIHDTDFGWGRPIYMGPGGIAYEG  405

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               YILPSP  D SLS+A+ L  +HM  F+K  Y
Sbjct  406   LSYILPSPTSDGSLSVAISLQTEHMKPFEKFFY  438



>emb|CDY44162.1| BnaC01g22120D [Brassica napus]
Length=428

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/332 (56%), Positives = 239/332 (72%), Gaps = 9/332 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDD GDF PS+ L KL+P VD S  I +FPL + QVT FKCGGVSLG GI H +SDGL
Sbjct  100   SVIDDLGDFAPSVNLSKLVPHVDYSPGIHTFPLLVLQVTFFKCGGVSLGVGIQHHVSDGL  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S++HFI +W+D+ARGL + +PPFIDRT+LRAR+PP P F H EY   P++K      L  
Sbjct  160   SSIHFINSWSDMARGLDLTLPPFIDRTLLRAREPPHPTFHHVEYQPSPSMKI----PLHP  215

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
              N + ++ K++   L  LK  +  +G     S+YE LAAH+WR V +AR   DDQ TKLY
Sbjct  216   DNTTVSIFKLSRDLLVALKAKAKEDGNPVSYSSYETLAAHVWRSVTKARAFPDDQVTKLY  275

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P LPPG+LGNV+FTATP+A +G+LL++P +  A  I   L RMDDEYLRS
Sbjct  276   IATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDLLSKPTSYVAGLIHDVLARMDDEYLRS  335

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS L+RG++ +  PNL I SW RLP++++DFGWG PV MGP++I +EG  
Sbjct  336   ALDYLEMQPDLSALIRGAHTYNCPNLGITSWVRLPIYDADFGWGRPVFMGPSVIAFEGLS  395

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLSL + L  +HM LF+K LY+
Sbjct  396   FVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_010094062.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55152.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=432

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 240/335 (72%), Gaps = 10/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+ +L+ L+P+VD SG ISS+PLA+FQVT F+CGGVSLG G+ H   DG 
Sbjct  95    SVIDDFGDFAPTPQLKALIPAVDLSGGISSYPLAVFQVTYFECGGVSLGVGMEHHAVDGA  154

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ +W+D+ARGL + +PPFIDRT++R+RDPP PAF H EYD PP +K+   +    
Sbjct  155   SGLHFVNSWSDVARGLDIKVPPFIDRTLIRSRDPPRPAFDHIEYDAPPIMKNTASANFQK  214

Query  710   ANP-----STAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQ  561
              +      S A  KIT  QL  LK  S  +GS+     YE+L+ H+WRC C+AR L DDQ
Sbjct  215   NSKYQTTTSVANFKITKDQLIALKNKSKEDGSSVSYSSYEMLSGHVWRCACKARALPDDQ  274

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKL++A DGR+RL P LP  + GNVIFT TP+A +G+L+++P+  +A +I   LV+ ++
Sbjct  275   ETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDLVSKPIWYAASQIHKTLVKTNN  334

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYL+SA+DYLE QPDLS LVRG++ F  PNL I SW RLP++++DFGWG P+ MGP  I+
Sbjct  335   EYLKSAIDYLEIQPDLSALVRGAHTFRCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIM  394

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             +EG  Y+LPSP  D SLS+A+ L  +HM  F KL+
Sbjct  395   FEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLI  429



>gb|KFK35521.1| hypothetical protein AALP_AA4G001700 [Arabis alpina]
Length=424

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 239/333 (72%), Gaps = 8/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  I SFPL + QVT FKCGG SLG G+ H  +DG 
Sbjct  91    SVIDDFGDFAPTLTLRQLIPEVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADGF  150

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL--SKL  717
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P ++  PL  S+ 
Sbjct  151   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPAMRI-PLDPSQS  209

Query  716   PGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTK  552
                N + ++ K++  QL  LK  S  + +T     YE+LA H+WR V +ARGL ++Q TK
Sbjct  210   DPDNTTVSIFKLSRDQLLALKAKSKDDANTVSYSSYEMLAGHVWRSVGKARGLPENQETK  269

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A  I   L RMDD YL
Sbjct  270   LYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLSRMDDNYL  329

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  330   RSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEG  389

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPSP  D SLS+A+ L  +HM LF+KLLY
Sbjct  390   LSFVLPSPINDGSLSVAIALQTEHMKLFEKLLY  422



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 239/332 (72%), Gaps = 6/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDD G+F PSL LR+L+P VD S  + + PL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SVIDDLGEFAPSLTLRQLIPDVDYSVGVHTLPLLVLQVTFFKCGGASLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRAR+PP PAF H EY   PT++  P S    
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTVLRARNPPQPAFHHVEYQPSPTMRI-PSSTQGL  218

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ KI+   L  LKT S  +G+T     YE+LA H+WR VC+ARGL DDQ TKLY
Sbjct  219   DDTTVSIFKISRDMLVALKTKSKQDGNTVSYSSYEVLAGHVWRSVCKARGLPDDQETKLY  278

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +A DGRSRL P LPPG+ GNVIF+ATP+  +G+LL++P   +A  I   +VRMDD+YLRS
Sbjct  279   VAIDGRSRLRPQLPPGYFGNVIFSATPLTFAGDLLSKPTWYAAVLIHDVIVRMDDKYLRS  338

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVR ++ +  PNL I SW RLP++++DFGWG P+ +GP  I YEG  
Sbjct  339   ALDYLEMQPDLSALVRCASTYKCPNLGITSWVRLPMYDADFGWGRPIFVGPGAIAYEGLS  398

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLSLA+ L ++HM LF+K LY+
Sbjct  399   FLLPSPTNDGSLSLAISLQSEHMKLFEKFLYE  430



>gb|KEH38242.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 238/331 (72%), Gaps = 5/331 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DDF DF P+L LR+L+P+VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  100   ASVDDFSDFAPTLRLRQLIPAVDYSAGIETYPLLVLQVTHFKCGGVSLGVGMQHHVADGA  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+D+ARGL V+IPPFI RT+L ARDPP P F H EY  PP+++         
Sbjct  160   SGLHFINSWSDVARGLDVSIPPFIGRTLLHARDPPRPVFDHIEYKPPPSMQHAKQGSDTS  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
             A+ + ++ K+T QQL +LK  S  +G+T     YE+LA H+WR V +AR L  DQ TKLY
Sbjct  220   ASVTVSIFKLTRQQLNILKGKSKEDGNTINYSSYEMLAGHVWRSVSKARALPVDQETKLY  279

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSRL P+LP G+ GNVIFT TP+A + +L+++P   +A RI +AL++MD++YLRS
Sbjct  280   IATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMSKPTWYAASRIHNALLQMDNDYLRS  339

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG++ F  PNL I SW RLP++ +DFGWG P+ MGP  I YEG  
Sbjct  340   ALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIYEADFGWGRPIFMGPGGIAYEGLS  399

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +I+PS   D SLSLA+ L  D M LFQ+L Y
Sbjct  400   FIIPSSTNDGSLSLAIALPPDQMKLFQELFY  430



>ref|XP_007215396.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
 gb|EMJ16595.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
Length=440

 Score =   386 bits (992),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 241/334 (72%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TIDDFGDF P+LE RKL+P+VD S  IS++PL + QVT FKCGGVSLG G+ H ++DGL
Sbjct  109   STIDDFGDFAPTLEFRKLIPAVDYSTGISTYPLLVLQVTYFKCGGVSLGVGLEHRVADGL  168

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRAR PP PAF H EY   P +K+G  +K  G
Sbjct  169   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARYPPQPAFDHIEYQPDPPIKTG--TKAVG  226

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKL  549
                +T ++ ++T +QL +LK  S  +G     +TYE+LA H+WRC   AR L DDQ TKL
Sbjct  227   DESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARELPDDQETKL  286

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             +IA DGRSRL P LPPGF GNV+F   P+A +G+L ++P   +A  I   +VRMD++YLR
Sbjct  287   HIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASCIHDTVVRMDNDYLR  346

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDLS LVRG++ F  P L I SW+RLP++++DFGWG P+ MGP  + YEG 
Sbjct  347   SALDYLELQPDLSPLVRGAHTFRCPRLGITSWSRLPIYDADFGWGRPIFMGPGGMGYEGL  406

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              ++LPS   D SLS+A+ L + HM  F KLLY+ 
Sbjct  407   AFVLPSATNDGSLSVAISLQSQHMQSFSKLLYEI  440



>ref|XP_008228828.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=442

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 239/333 (72%), Gaps = 6/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+LE RKL+P+VD S  ISS+PL + QVT FKCGGVSLG G+ H ++DGL
Sbjct  111   SVLDDFGDFAPTLEFRKLIPAVDYSAGISSYPLLVVQVTYFKCGGVSLGVGLEHRVADGL  170

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P +K+G  S +  
Sbjct  171   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQPAFDHIEYQPDPPIKTGTKS-VGD  229

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ ++T +QL +LK  S  +G     +TYE+LA H+WRC   AR L DDQ +KL+
Sbjct  230   ESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARELPDDQESKLH  289

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IA DGRSRL P LPPGF GNVIF++ P+A +G+L ++P   +A RI  A+VRMD++YLRS
Sbjct  290   IAVDGRSRLQPPLPPGFFGNVIFSSAPIAAAGDLKSKPTWYAASRIHDAVVRMDNDYLRS  349

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDL  LVRG+  F  P L I +W+RLP++++DFGWG P  MGP  I YEG  
Sbjct  350   ALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPIYDADFGWGRPTFMGPGGIGYEGLA  409

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             ++LPS   D SLS+ + L +  M  F KLLY+ 
Sbjct  410   FVLPSATNDGSLSVVISLQSQRMKSFSKLLYEI  442



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 237/333 (71%), Gaps = 8/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD GDF  +LELRKL+P+V+ S  ISS PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  107   SVVDDLGDFA-TLELRKLIPAVNYSSGISSDPLLVLQVTYFKCGGVSLGVGMQHHVTDGF  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+DLARGL V +PPFIDRT+LR+  PP P F H EY  PP L+  P +    
Sbjct  166   SGLHFVNTWSDLARGLDVKLPPFIDRTLLRSHSPPRPQFPHIEYQSPPALRVSPETTNSA  225

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG------STYEILAAHIWRCVCEARGLSDDQTTK  552
             ++ ST ++LK+T +QL  LKT +  E       ++YEILA H+WRC C ARGLSDDQ TK
Sbjct  226   SDSSTVSILKVTREQLDALKTQAVLENGNTTRYTSYEILAGHVWRCACRARGLSDDQDTK  285

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L IA DGR RL P LP G+ GN IFT TP+A +G+L+++P+  +A+ I  +L R +D+YL
Sbjct  286   LSIAIDGRMRLSPPLPQGYFGNGIFTITPIAVAGDLISKPVLYAARTIHESLARANDDYL  345

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS L RG++ F  PNL I SW RLP+H++DFGWG P++MGP  I YEG
Sbjct  346   RSALDYLELQPDLSALARGAHTFRCPNLGITSWVRLPIHDADFGWGRPIYMGPGRIAYEG  405

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               YILPSP  D SLS+A+ L  +HM  F+K  Y
Sbjct  406   LSYILPSPTSDGSLSVAISLQTEHMKPFEKFFY  438



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 239/332 (72%), Gaps = 11/332 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+L LR+L+P VD S  I +FPL + QVT F+CGGVSLG G+ H L+DG 
Sbjct  100   SVIDDFGDFAPTLALRQLIPGVDYSAGIHTFPLLVLQVTFFRCGGVSLGVGMQHHLNDGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPF DRT+LRAR+PP PAF H EY   P++ +        
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFFDRTLLRARNPPQPAFHHVEYHPSPSMNN------KH  213

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + ++ K++   L  LK  S  +G+T     YE+LAAH+WR V +ARGL DDQ TKLY
Sbjct  214   DDTTVSIFKLSRDLLVALKAKSKQDGNTVSYSSYEVLAAHVWRSVGKARGLPDDQETKLY  273

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +  DGRSRL P LP G+ GNV+FTATP+  +G+LL++P + +A  I  A+ RMDD+YLRS
Sbjct  274   VPIDGRSRLRPQLPLGYFGNVLFTATPMTVAGDLLSKPTSYAAGMIHDAIARMDDKYLRS  333

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS+LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP  I +EG  
Sbjct  334   ALDYLEMQPDLSELVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGAIAFEGLS  393

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP+ D SLSL + L ++HM LF+K LY+
Sbjct  394   FVLPSPSNDGSLSLVISLQSEHMKLFKKFLYE  425



>gb|AGE10615.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=276

 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 221/277 (80%), Gaps = 6/277 (2%)
 Frame = -2

Query  905  LSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPL  726
            LSDG+S+LHFI TW+D ARGLS+A+PPFIDRT+LRAR PP P F H EY  PP++ +   
Sbjct  1    LSDGVSSLHFINTWSDTARGLSIAVPPFIDRTLLRARTPPTPTFDHVEYHPPPSMNTATA  60

Query  725  SKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQ  561
               P A  STA+LK+T  QL  LK+ + ++G     STYE+LAAH+WRC C+ARGL+ DQ
Sbjct  61   QSSPKAV-STAILKLTLDQLNNLKSTAKNDGTTKDYSTYEVLAAHLWRCACKARGLAKDQ  119

Query  560  TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
             +KLYIATDGR+RLCP LP G+LGNV+FTATP+A SG+L+ EP+  S++RI SAL +MDD
Sbjct  120  MSKLYIATDGRARLCPPLPFGYLGNVVFTATPMAVSGDLVAEPIIDSSRRIHSALTQMDD  179

Query  380  EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             YLRSALDYLE  PDL  LVRG +YFASPNLNINSW+RLPV+++DFGWG P+ MGPA IL
Sbjct  180  GYLRSALDYLELLPDLKALVRGPHYFASPNLNINSWSRLPVYDADFGWGRPIFMGPASIL  239

Query  200  YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
            YEGT+YI+PSP  DRSL LAVCLD  HMPLF+K LY+
Sbjct  240  YEGTIYIIPSPTNDRSLLLAVCLDVGHMPLFKKYLYE  276



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score =   384 bits (985),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 191/334 (57%), Positives = 233/334 (70%), Gaps = 8/334 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             +DDFGDFTPS E+ +L+P VD S  ISSFPL + Q+T F+CGGV LG G  HTL+DG SA
Sbjct  100   MDDFGDFTPSFEMLELVPEVDYSDHISSFPLLILQLTSFRCGGVCLGVGWHHTLADGCSA  159

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPP---TLKSGPLSKLP  714
             +HFI +W+D+ RGLSV IPPFIDRT L A +PP P F H EYD PP   TL      +  
Sbjct  160   MHFINSWSDVTRGLSVHIPPFIDRTPLAAGNPPTPTFHHAEYDPPPSINTLDQNGKYQSS  219

Query  713   GANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKL  549
                  T +LK+T  Q+  LK  S  +      STYE LAAHIWRC+C AR L  DQ T+L
Sbjct  220   EKPACTKILKLTLDQINTLKATSKQQDGATKYSTYETLAAHIWRCMCMARELDADQPTRL  279

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIATDGRSRL P LP G+ GNVIFT T  + SG++ TE L  + KR+R +L RMD+EYLR
Sbjct  280   YIATDGRSRLRPPLPSGYFGNVIFTTTVTSLSGDIKTETLVQTIKRLRESLKRMDNEYLR  339

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALD+L+ QPDL  LVRG   F SPNLN+NSW  LP H++DFGWG P+HMGPA +LYEGT
Sbjct  340   SALDHLQVQPDLGALVRGPTTFKSPNLNVNSWISLPTHDADFGWGRPLHMGPASVLYEGT  399

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             VYIL +P KD  LS+ + L+ D +  F+ LL+ F
Sbjct  400   VYILKTPAKDGGLSVIIRLEDDILQRFETLLFDF  433



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 239/333 (72%), Gaps = 11/333 (3%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             +DDFGDF P++EL++L+P V+ + DIS+FPL + QVT FKCGGVSLG G+ H  +DG S 
Sbjct  102   VDDFGDFAPTMELKRLIPKVEYTDDISAFPLLVLQVTYFKCGGVSLGVGMQHHAADGTSG  161

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGP-----LSK  720
             LHFI +W+D+A GL ++ PPFIDRT+LRARDPP P+F H EY  PP++K+       LS 
Sbjct  162   LHFINSWSDVASGLGISAPPFIDRTLLRARDPPTPSFPHVEYQPPPSMKAAATSPPSLSA  221

Query  719   LPGANPSTA--MLKITPQQLALL--KTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTK  552
             +   +P TA  + K T  QL LL  KT      STY + +AH+WRC   AR L  DQ TK
Sbjct  222   VKSGDPVTAVNLFKFTRAQLDLLKAKTPKGSSYSTYALFSAHVWRCASLARELPPDQLTK  281

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYIATDGR RL P LP G+ GNVIFTATPVA + E+++     +A RI+++L RMDD+YL
Sbjct  282   LYIATDGRQRLRPPLPAGYFGNVIFTATPVAAAAEVVSS--EGAAGRIQASLARMDDQYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSA+DYLE QPDL  LVRG++ F  PN+ + SW RLP+H++DFGWG PV MGP  I YEG
Sbjct  340   RSAVDYLEIQPDLRALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPSP+ D SLSLA+ L A+HM  FQKL+Y
Sbjct  400   LAFVLPSPDGDGSLSLAISLQAEHMLRFQKLIY  432



>ref|XP_007215406.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
 gb|EMJ16605.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
Length=435

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 240/334 (72%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+LE RKL+P+VD S  +SS+PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  104   SVLDDFGDFAPTLEFRKLVPAVDYSAGMSSYPLLVVQVTYFKCGGVSLGVGLEHRVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF HTEY   P +K+G  +K  G
Sbjct  164   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQPAFDHTEYQPDPPIKTG--TKAVG  221

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKL  549
                +T ++ ++T +QL +LK  S  +G     +TYE+LA HIW+C   AR L DDQ TKL
Sbjct  222   DESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHIWKCASVARELPDDQETKL  281

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             +IA DGRSRL P LPPGF GNV+F++ P+A +G+L +EP   +A RI  A+VRMD++YLR
Sbjct  282   HIAVDGRSRLQPPLPPGFFGNVVFSSAPIAATGDLKSEPTWYAASRIHDAVVRMDNDYLR  341

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDL   VRG++ F  P L I +W+RLP++++DFGWG P  MGP  I YEG 
Sbjct  342   SALDYLELQPDLLPHVRGAHTFRCPRLAITNWSRLPIYDADFGWGRPTFMGPGGIGYEGL  401

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              ++LPS   D SLS+ + L +  M  F KLLY+ 
Sbjct  402   AFVLPSATNDGSLSVVISLQSQRMKSFSKLLYEI  435



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 188/338 (56%), Positives = 239/338 (71%), Gaps = 10/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             AT+DD GDF PS +LR+L+P+VD SGDISSFPL L QVT FK GGVSLG    HTL DG 
Sbjct  101   ATLDDLGDFAPSSKLRQLVPTVDYSGDISSFPLVLLQVTSFKHGGVSLGAAFQHTLVDGS  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSG--PLSKL  717
             S  +F+ +W++  RGLS+ + P IDRT+LRAR P  PAF H EYD  P L +    L+  
Sbjct  161   SVCYFMNSWSNTTRGLSITVTPSIDRTLLRARVPSAPAFHHVEYDQSPPLNTSISALNSQ  220

Query  716   PGANPS-TAMLKITPQQLALLKTNSSHEG-------STYEILAAHIWRCVCEARGLSDDQ  561
              G  PS T++ KIT  QL  LK+ ++  G       +TY+IL AH+W CVC+ARGLSDDQ
Sbjct  221   VGPKPSSTSIFKITADQLKTLKSKATMNGNTTKTNRTTYDILTAHVWHCVCKARGLSDDQ  280

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLYI  DGRS+L P LPPG+LGNVIF A   A SG+L +EP A + +RI   + RMDD
Sbjct  281   ATKLYIPIDGRSKLHPPLPPGYLGNVIFIAATTALSGDLQSEPFADTIQRINRMVKRMDD  340

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             +Y+RSALDY+E  PD+  L+RG++ F SPNL+INSW RLP++ +DFGWG P+H+G A ++
Sbjct  341   KYMRSALDYIESVPDMKTLMRGAHTFQSPNLSINSWMRLPLYAADFGWGRPMHVGLANVI  400

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +EG + I+PSP  D SLSL VCL+  HM  F+K LY F
Sbjct  401   HEGKICIVPSPVDDGSLSLVVCLETSHMKQFEKCLYDF  438



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score =   381 bits (978),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 240/342 (70%), Gaps = 17/342 (5%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF PS E   L+P+VD SG ISS+P+ + QVT FK GGVSLG G+ H ++DG 
Sbjct  104   SALDDFGDFAPSPEFHGLIPAVDYSGGISSYPVLVLQVTHFKYGGVSLGVGLNHNVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             +ALH + TW+D+ARGL + IPPFIDRT+L ARDPP P F H EY  PP++K+   S  P 
Sbjct  164   AALHLVNTWSDMARGLGLTIPPFIDRTLLCARDPPRPTFDHIEYKPPPSMKTTSTSA-PQ  222

Query  710   ANPSTAMLKITPQQLALLKTNSS----HEGST------------YEILAAHIWRCVCEAR  579
              + +  + K+T +QL +LK  S     ++G T            +EILA HIWRCVC+AR
Sbjct  223   QSIAAGIFKMTKEQLQVLKAKSKEYLINDGDTSTSSTATINLTSFEILAGHIWRCVCKAR  282

Query  578   GLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSA  399
              L+DDQ T++YIATDGRSRL P LPPG+ GNV+FTA P+A +G++ ++P   +A RI  A
Sbjct  283   ALADDQETRVYIATDGRSRLQPPLPPGYFGNVVFTAAPLATAGDIQSKPTRYAASRIHDA  342

Query  398   LVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHM  219
             L RMD+ YLRSALDYLE QPDL  L RG++ F  PNL I SW RLP+H++DFGWG PV M
Sbjct  343   LARMDNNYLRSALDYLELQPDLMALARGAHTFRCPNLGITSWVRLPIHDADFGWGRPVFM  402

Query  218   GPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             GP  + +EG V +L SP +D SLS+++ L  +H+  F+KL+Y
Sbjct  403   GPGKVSFEGFVIVLRSPIEDGSLSISINLQQEHLKAFEKLIY  444



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 239/334 (72%), Gaps = 11/334 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDD GDF PSL L +L+P+VD S  + + PL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SAIDDLGDFAPSLTLCQLIPNVDYSVGVQTLPLLVLQVTFFKCGGASLGVGMQHHVADGS  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             SALHFI TW+D+ARGL + IPPFIDRT+LRARDPP  AF H EY   P   S P     G
Sbjct  160   SALHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQLAFHHVEYQPSPDXSSKP-----G  214

Query  710   ANPST-AMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKL  549
              + +T ++ KI+ + L  LK  S+ +G+T     YE+LA H+WR V +ARGL DDQ TKL
Sbjct  215   PHDTTVSIFKISRELLLALKAKSNQDGNTVSYSSYEVLAGHVWRAVGKARGLPDDQETKL  274

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             YIA DGRSRL P LPPG+ GNV+FTATP+  +G+L+++P   +A  I   +VRMDDEYLR
Sbjct  275   YIAIDGRSRLRPQLPPGYFGNVVFTATPLTVAGDLVSKPTWYAAGMIHDVIVRMDDEYLR  334

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDLS LVRG++ +  PNL I SW +LP++++DFGWG P+ MGP  I +EG 
Sbjct  335   SALDYLEMQPDLSALVRGAHTYKCPNLGITSWAKLPIYDADFGWGRPLFMGPGAIAFEGL  394

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              ++LPSP  D SLSLA+ L ++HM LF+K LY+ 
Sbjct  395   SFLLPSPTDDGSLSLAISLQSEHMKLFEKFLYEI  428



>ref|NP_001132890.1| LOC100194386 [Zea mays]
 ref|XP_008681252.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 ref|XP_008681253.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 gb|ACF81923.1| unknown [Zea mays]
 gb|ACF84236.1| unknown [Zea mays]
 gb|ACR38175.1| unknown [Zea mays]
 gb|AFW72298.1| anthranilate N-benzoyltransferase protein 1 isoform 1 [Zea mays]
 gb|AFW72299.1| anthranilate N-benzoyltransferase protein 1 isoform 2 [Zea mays]
 gb|AFW72300.1| anthranilate N-benzoyltransferase protein 1 isoform 3 [Zea mays]
 gb|AFW72301.1| anthranilate N-benzoyltransferase protein 1 isoform 4 [Zea mays]
Length=446

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/338 (56%), Positives = 242/338 (72%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             ATID FGDF P++EL++L+P+VD + DISSFPL + QVT FKCGGV++G G+ H ++DG 
Sbjct  110   ATIDYFGDFAPTMELKRLIPTVDFTDDISSFPLLVLQVTHFKCGGVAIGVGMQHHVADGF  169

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGP----LS  723
             S LHFI +WADL RG+ +A+ PFIDR++LRARDPP PA+ H EY   P + S P    L+
Sbjct  170   SGLHFINSWADLCRGVPIAVMPFIDRSLLRARDPPTPAYPHIEYQPAPAMLSEPPQAALT  229

Query  722   KLPGANP-STAMLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P   P + A+ K++  +L  L++   + EG    STY +LAAH+WRC   ARGL  DQ
Sbjct  230   SKPATPPTAVAIFKLSRAELVRLRSQVPAREGAPRFSTYAVLAAHVWRCASLARGLPADQ  289

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL P LP G+ GNVIFTATP+A +G  +T  +A  A  I++AL RMDD
Sbjct  290   PTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLANAGT-VTAGVAEGASVIQAALDRMDD  348

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
              Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  349   GYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  408

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS N+D SLS+A+ L A+HM  F+KL+Y F
Sbjct  409   YEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  446



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 239/333 (72%), Gaps = 6/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TIDDFGDF+ + ELR+L+P VD S  ISS+PL L QVTRF+CGGVSLG  + H+L DG 
Sbjct  101   STIDDFGDFSATQELRQLIPVVDYSQHISSYPLLLLQVTRFRCGGVSLGVAMHHSLVDGA  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S +HFI +W++L RGL + IP  +DR+ L AR PP PAF H EY  PP++K+ P S+   
Sbjct  161   SIIHFINSWSELTRGLQLKIPSSLDRSQLHARHPPTPAFHHIEYLPPPSMKT-PTSQSGP  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + A LKIT  Q+  LK  +  + +T     YE+L  H+WRCVC+ARGL DDQ TKLY
Sbjct  220   THVAVAKLKITVDQINALKAKAEEDSNTLNYSSYEVLVGHVWRCVCKARGLCDDQDTKLY  279

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             +A D RSRL P LP G+ GN     +P+  +G+L ++PLA +  RI   L+RM+DEYLRS
Sbjct  280   MAVDLRSRLRPPLPQGYFGNGTLVTSPIGVAGDLRSKPLAYAVGRIHDQLMRMNDEYLRS  339

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             A+DYLE QPDL+ LVRG++ F  PN+ I +WT+LP++++DFGWG P++MGPA +L+EG  
Sbjct  340   AIDYLELQPDLTALVRGADTFRCPNMGIVNWTQLPIYDADFGWGRPIYMGPATVLHEGMA  399

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YILPSP +D S +LAV L +DHM LF+K+ Y F
Sbjct  400   YILPSPAQDGSATLAVSLQSDHMQLFEKIFYDF  432



>ref|XP_006652479.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Oryza 
brachyantha]
Length=440

 Score =   378 bits (971),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 245/336 (73%), Gaps = 10/336 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DD+GDF P++EL++L+P+V+ + DISSFPL + QVT FKCGGVSLG G+ H ++DG+
Sbjct  105   ASVDDYGDFAPTMELKRLIPTVEYTDDISSFPLLVLQVTYFKCGGVSLGVGMQHHVADGM  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYD-HPPTLKSGPLSKLP  714
             S LHFI +W+DL RG+ +A+ PFIDRT+LRARDPP P++ H EY   P  L S P S + 
Sbjct  165   SGLHFINSWSDLCRGIQIAVMPFIDRTLLRARDPPTPSYPHVEYQPAPAMLSSMPQSVIA  224

Query  713   G-ANPSTA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQT  558
                 P TA  + K++   L  L++   S EG    STY +LAAH+WRCV  ARGL  +Q 
Sbjct  225   KTTTPPTAVDIFKLSRSDLGRLRSQLPSGEGAPRFSTYAVLAAHVWRCVSLARGLPTEQP  284

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  LA  A  I+ AL RM+D+
Sbjct  285   TKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGK-VTSGLADGAAVIQEALDRMNDD  343

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I Y
Sbjct  344   YCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAY  403

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             EG  ++LPS NKD SLS+A+ L A+HM  F+KL+++
Sbjct  404   EGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  439



>gb|KJB56505.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=404

 Score =   377 bits (968),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 228/326 (70%), Gaps = 23/326 (7%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+LELR+L+P+VD SG IS++PL + QVT FKCGG SLG G+ H  +DG 
Sbjct  100   SVIDDFGDFAPTLELRQLIPTVDYSGGISTYPLLVLQVTYFKCGGASLGVGMQHHAADGY  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PP +K  P S  P 
Sbjct  160   SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHVEYQPPPAMKIPPQSTGPE  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIATDG  531
             +  + ++ K+T  QL  LK     +                      DDQ TKLYIATDG
Sbjct  220   ST-AISIFKLTRDQLNALKAKCKED----------------------DDQGTKLYIATDG  256

Query  530   RSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYL  351
             R+RL P LPPG+ GNVIFTATP+A +G+LL++P   +A RI  ALVRMDDEYLRSALDYL
Sbjct  257   RARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDALVRMDDEYLRSALDYL  316

Query  350   ECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPS  171
             E QPDLS LVRG++ F  PNL I SW RLP+H++DFGWG P+ MGP  I YEG  ++LPS
Sbjct  317   ELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIPYEGLSFVLPS  376

Query  170   PNKDRSLSLAVCLDADHMPLFQKLLY  93
             PN D SLS+A+ L  +HM +F+KL Y
Sbjct  377   PNNDGSLSVAISLQTEHMNVFEKLFY  402



>gb|ACG29714.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
 gb|ACG30562.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
Length=447

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 188/339 (55%), Positives = 241/339 (71%), Gaps = 12/339 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             ATID FGDF P++EL++L+P+VD + DISSFPL + QVT FKCGGV++G G+ H ++DG 
Sbjct  110   ATIDYFGDFAPTMELKRLIPTVDFTDDISSFPLLVLQVTHFKCGGVAIGVGMQHHVADGF  169

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS-----GPL  726
             S LHFI +WADL RG+ +A+ PFIDR++LRARDPP PA+ H EY   P + S       L
Sbjct  170   SGLHFINSWADLCRGVPIAVMPFIDRSLLRARDPPTPAYPHIEYQPAPAMLSSEPPQAAL  229

Query  725   SKLPGANP-STAMLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDD  564
             +  P   P + A+ K++  +L  L++   + EG    STY +LAAH+WRC   ARGL  D
Sbjct  230   TSKPATPPTAVAIFKLSRAELVRLRSQVPAREGAPRFSTYAVLAAHVWRCASLARGLPAD  289

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q TKLY ATDGR RL P LP G+ GNVIFTATP+A +G  +T  +A  A  I++AL RMD
Sbjct  290   QPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLANAGT-VTAGVAEGASVIQAALDRMD  348

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             D Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I
Sbjct  349   DGYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGI  408

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              YEG  ++LPS N+D SLS+A+ L A+HM  F+KL+Y F
Sbjct  409   AYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  447



>ref|XP_007216677.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
 gb|EMJ17876.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
Length=442

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 237/334 (71%), Gaps = 8/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +D+FGDF P+LE RKL+P+VD S  ISS+PL + QVT FKCGG+SLG G+ H ++DG 
Sbjct  111   SVLDEFGDFAPTLEFRKLVPAVDYSAGISSYPLLVVQVTYFKCGGLSLGVGLEHRVADGF  170

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P +K+G  +K  G
Sbjct  171   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQPAFDHIEYQPDPPIKTG--TKAVG  228

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKL  549
                +T ++ ++T +QL +LK  S  +G     +TYE+LA HIWRC   AR L DDQ TKL
Sbjct  229   DESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHIWRCASVARELPDDQETKL  288

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             +IA DGRSRL P LPPGF GNV+F+  P+A +G++ ++P   +A RI  A+VRMD+ YLR
Sbjct  289   HIAVDGRSRLQPPLPPGFFGNVVFSGAPIAAAGDIKSKPTWYAASRIHDAVVRMDNNYLR  348

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALDYLE QPDL   VRG++ F  P L I +W+RLP++++DFGWG P  MGP  I YEG 
Sbjct  349   SALDYLELQPDLLPHVRGAHTFRCPRLAITNWSRLPIYDADFGWGRPTFMGPGGIGYEGL  408

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              ++LPS   D SLS+ + L +  M  F KLLY+ 
Sbjct  409   AFVLPSATNDGSLSVVISLQSQRMKSFSKLLYEI  442



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 236/333 (71%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + ++DFGDF P+ E RKL+P VD S  IS++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  107   SVLEDFGDFAPTPEFRKLIPVVDYSAGISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGC  166

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP   F H EY   P  K+ P S   G
Sbjct  167   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQTTFDHVEYQPDPPSKTPPPSTKDG  226

Query  710   ANPST--AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                ST  ++ ++T +QL++LK  S  EG     STYE+LA H+WRC  +AR L DDQ TK
Sbjct  227   DAESTRVSIFRLTREQLSVLKAKSKEEGNSINYSTYEMLAGHVWRCATKARNLPDDQVTK  286

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L++A DGRSRL P LPPGF GNV+F   P A +G+L ++P   +A RI   +VRM+++YL
Sbjct  287   LHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAAGRIHDVVVRMNNDYL  346

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALD+LE QPDLS LVRG++ F  P L I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  347   RSALDFLEVQPDLSALVRGAHTFRCPRLGITSWARLPIYDADFGWGRPIFMGPGGIGYEG  406

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPSP  D SLS+A+ L +DHM  F KLLY
Sbjct  407   LAFVLPSPTNDGSLSVAISLQSDHMKSFAKLLY  439



>ref|XP_012071524.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Jatropha 
curcas]
 gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 241/336 (72%), Gaps = 11/336 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVD--TSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSD  897
             + IDDFGDFTPSL++ +L+P++D  +S DISS+PL   QVT F+CGGV LG  + HT++D
Sbjct  105   SVIDDFGDFTPSLKMMQLVPTMDGYSSEDISSYPLLAVQVTYFRCGGVCLGVCLHHTVAD  164

Query  896   GLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKL  717
             G SA+HFI +W+++ RG S+ + PFI+RT+L AR PP P F H EYD PP++ + P+ KL
Sbjct  165   GTSAIHFINSWSEITRGNSITLSPFIERTLLSARIPPTPTFHHVEYDPPPSMIT-PI-KL  222

Query  716   PGANPSTAMLKITPQQLALLKT------NSSHEGSTYEILAAHIWRCVCEARGLSDDQTT  555
                  ST +L+ITP QL  LK+      N     STYE LAAHIWRC+C+ARGLS+DQ T
Sbjct  223   NAKPTSTKILRITPDQLTTLKSKFKKNENGMVRHSTYETLAAHIWRCMCKARGLSNDQAT  282

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYIATDGR RL P LP G+ GNV+FTAT    S E+ + PL    ++I SAL  MDDEY
Sbjct  283   KLYIATDGRFRLRPPLPRGYFGNVLFTATVKTSSEEVQSNPL-KIVEKIHSALKGMDDEY  341

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSALD+L+ QPDL+ L RG++ F SPNLNI SW +LP+H +DFGW  P+ MGPA +++E
Sbjct  342   LRSALDFLQMQPDLTALKRGASTFRSPNLNIVSWMKLPIHEADFGWSRPIFMGPASVVFE  401

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  Y+LPSP  D SL L +CL+ DH+ LFQ   Y+ 
Sbjct  402   GMGYVLPSPRNDGSLRLIICLETDHIQLFQAYFYEL  437



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 232/335 (69%), Gaps = 13/335 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDD GDFTPS  LR L+P VD S  ISS+PL L QVT FKCGGV LG  I H ++DG 
Sbjct  101   AIIDDLGDFTPSHRLRHLIPVVDHSAHISSYPLLLLQVTYFKCGGVCLGVAIHHMVADGS  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
               +HFI +W+D+ RG+ +AI PF DRTILRARDPP P F H EY  PP L  GP +  P 
Sbjct  161   GCIHFINSWSDITRGIPIAISPFFDRTILRARDPPAPRFSHVEYLPPPPLH-GPSTLKPT  219

Query  710   ANPSTAMLKITPQQLALLKTNSSHEGS---------TYEILAAHIWRCVCEARGLSDDQT  558
                ST +L +TP+ L  LK  S   GS         TYE LAAH+WRC+C+ARGLS DQ 
Sbjct  220   ---STLILHLTPEHLNALKAKSVRHGSPSPSSVKYSTYETLAAHLWRCICKARGLSHDQP  276

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYI TDGR RL P LPPG+ GN +FT+T  A SG+L +E  + + +RIR+A+  M+DE
Sbjct  277   TKLYIPTDGRLRLRPTLPPGYFGNALFTSTLTANSGDLQSEAFSDTVQRIRNAIAGMEDE  336

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSA+DYLE QP+L+ LVRG++ F SPNL + SWTRLP+H+++FGWG P+HMG    ++
Sbjct  337   YLRSAVDYLEMQPNLTALVRGAHTFRSPNLVVGSWTRLPIHDANFGWGRPMHMGLGSGVF  396

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             EG   I  SP KD  LS+ +CL+A  M LF+ LLY
Sbjct  397   EGNACIQRSPTKDNHLSVVICLEAQPMQLFKDLLY  431



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 234/333 (70%), Gaps = 6/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDFTPS  LR+L+P+VD S DISS+PL L QVTRF+CGGV LG G+ H+L DG 
Sbjct  109   SVIDDFGDFTPSPVLRQLIPAVDYSKDISSYPLLLLQVTRFRCGGVCLGVGMHHSLVDGT  168

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S +HFI +W+D+ARGL   IPPF+DR+ LRAR PP P F H E+  PP++K+ P S+   
Sbjct  169   SDIHFINSWSDMARGLQPKIPPFLDRSSLRARQPPTPMFHHIEFLPPPSIKT-PKSQSGP  227

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
              + + A  KIT  Q+  LKTN+         STY +LA H+WRCV +ARGL DDQ T L+
Sbjct  228   TDVAVAKFKITVDQINTLKTNAKENDNTLNYSTYAVLAGHVWRCVSKARGLRDDQDTNLF  287

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             I  DGRSRL P LPPG+ GN I   T  A  GEL ++PL  +  R+   + RM+DEY+RS
Sbjct  288   ITVDGRSRLRPPLPPGYFGNGILLTTSNALCGELRSKPLGYAVGRVHDVVTRMNDEYVRS  347

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             A+DYLE QPDL+  VRG + F SPN  + SW RLP++++DFGWG P+H+GPA++  EG  
Sbjct  348   AIDYLELQPDLTPFVRGPHMFRSPNFWMVSWARLPLYDADFGWGRPIHVGPAVVYSEGLS  407

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YILPSP  D S+ LA+ L +DHM +F+K+LY F
Sbjct  408   YILPSPTNDGSVLLAISLQSDHMEVFRKILYDF  440



>ref|NP_001053225.1| Os04g0500700 [Oryza sativa Japonica Group]
 emb|CAC09509.2| H0711G06.15 [Oryza sativa Indica Group]
 dbj|BAF15139.1| Os04g0500700 [Oryza sativa Japonica Group]
 dbj|BAG96851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99596.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77573.1| hypothetical protein OsI_16514 [Oryza sativa Indica Group]
 gb|EEE61270.1| hypothetical protein OsJ_15346 [Oryza sativa Japonica Group]
Length=442

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/337 (57%), Positives = 241/337 (72%), Gaps = 11/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DD+GDF P++EL++L+P+VD + DISSF L + QVT FKCGGVSLG G+ H ++DG+
Sbjct  106   ASVDDYGDFAPTMELKRLIPAVDYTDDISSFSLLVLQVTYFKCGGVSLGVGMQHHVADGM  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYD-HPPTLKSGPLSKLP  714
             S LHFI +W+DL RG  +AI PFIDRT+LRARDPP P++ H EY   P  L S P S   
Sbjct  166   SGLHFINSWSDLCRGTQIAIMPFIDRTLLRARDPPTPSYPHVEYQPAPAMLSSVPQSVTA  225

Query  713   GAN--PSTA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
                  P TA  + K+T   L  L++   S EG    STY +LAAH+WRCV  ARGL  +Q
Sbjct  226   NKTTPPPTAVDIFKLTRSDLGRLRSQLPSGEGAPRFSTYAVLAAHVWRCVSLARGLPSEQ  285

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  LA  A  I+ AL RM+D
Sbjct  286   PTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGK-VTSGLADGAAVIQEALDRMND  344

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
              Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  345   SYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  404

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             YEG  ++LPS NKD SLS+A+ L A+HM  F+KL+++
Sbjct  405   YEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  441



>ref|XP_004976123.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=439

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 244/337 (72%), Gaps = 10/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A IDD+GDF P++EL++L+P+VD + DIS+FPL + QVT FKCGGVSLG G+ H ++DG+
Sbjct  104   AAIDDYGDFAPTMELKRLIPAVDYTDDISAFPLLVLQVTYFKCGGVSLGVGMQHHVADGM  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+DL RG  +++ PFIDRT+LRARDPP P+F+H EY   P + S     L  
Sbjct  164   SGLHFINSWSDLCRGAQISVMPFIDRTLLRARDPPTPSFQHIEYQPAPAMLSSTPQSLTS  223

Query  710   AN--PSTA--MLKITPQQLALLKTN-SSHEGS----TYEILAAHIWRCVCEARGLSDDQT  558
              +  P+TA  + K+T   L  L++   + EG+    TY +LAAH+W+CV  ARGL+ +Q 
Sbjct  224   ISKPPATAVDIFKLTRSDLGRLRSQLPTGEGAPRFNTYAVLAAHVWKCVSLARGLTPEQP  283

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  LA  A  I+ AL RMD++
Sbjct  284   TKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK-VTSGLAEGAAVIQGALDRMDND  342

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H+++FGWG PV MGP  I Y
Sbjct  343   YCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDANFGWGRPVFMGPGGIAY  402

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             EG  ++LPS N D SLS+A+ L A+HM  F+KL+Y+ 
Sbjct  403   EGLAFVLPSANGDGSLSIAISLQAEHMVKFRKLIYEL  439



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 234/332 (70%), Gaps = 7/332 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+  L  L+P VD S  + +FPL + QVT FKCGG SLG G+ H ++DG 
Sbjct  100   SAIDDFGDFAPTPTLGLLIPHVDYSIGVHTFPLLVLQVTFFKCGGASLGVGMQHHVADGF  159

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             SALHFI TW+D+ARGL + I PFIDRT+LRAR PP  AF H EY   P+++   LS  P 
Sbjct  160   SALHFINTWSDMARGLDLTIQPFIDRTLLRARYPPQAAFHHVEYQPSPSMRI--LSSKPV  217

Query  710   ANPST-AMLKITPQQLALLKTNSSHEG----STYEILAAHIWRCVCEARGLSDDQTTKLY  546
              + +T ++ KI+   L  LK  S+ E     S+YE+LAAH+WR V +ARGL DDQ TKLY
Sbjct  218   PDDTTVSIFKISRDLLVSLKAKSNQENTLSYSSYEVLAAHVWRSVGKARGLPDDQETKLY  277

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IATDGRSR  P LPPGF GNV+F A P+   G+LL++P + +A  I  A+  MDD YLRS
Sbjct  278   IATDGRSRFRPQLPPGFFGNVVFAAAPLTVVGDLLSKPTSYAAGIIHDAIASMDDSYLRS  337

Query  365   ALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTV  186
             ALDYLE QPDLS LVRG+  + SPNL I SW RLP++++DFGWG P+++GP  I YEG  
Sbjct  338   ALDYLEMQPDLSALVRGAQTYKSPNLGITSWARLPMYDADFGWGRPIYVGPGAIAYEGLS  397

Query  185   YILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++LPSP  D SLSLA+ L  +HM LF+K L++
Sbjct  398   FVLPSPTNDGSLSLAIALQPEHMKLFEKFLFE  429



>ref|XP_008353756.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score =   373 bits (958),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 235/333 (71%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+ E RKL+P +D S  IS++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  107   SVLDDFGDFAPTPEFRKLIPVIDYSAGISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGC  166

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP   F H EY   P LK+ P +   G
Sbjct  167   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQTTFDHVEYQPDPPLKTPPPTTKDG  226

Query  710   ANPST--AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                ST  ++ ++T +QL++LK  S  EG     STYE+LA H+WRC  +AR L DD+ TK
Sbjct  227   DAESTTVSIFRLTREQLSVLKAKSKEEGNSINYSTYEMLAGHVWRCASKARNLPDDRVTK  286

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L++A DGRSRL P LPPGF GNV+F   P A +G+L ++P   +A  I   +VR +++YL
Sbjct  287   LHVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAASXIHDVVVRXNNDYL  346

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  P L I SW RLP++++DFGWG P+ MGP  I YEG
Sbjct  347   RSALDYLEVQPDLSALVRGAHTFRCPKLGITSWARLPIYDADFGWGRPIFMGPGGIGYEG  406

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPSP  D SLS+A+ L +DHM  F KLLY
Sbjct  407   LAFVLPSPINDGSLSVAISLQSDHMKSFAKLLY  439



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score =   373 bits (958),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 235/337 (70%), Gaps = 11/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + + DF DF PS ELR+L+P+VD+S DI S+PL + QVTRF CGGV LG G  HTL+DG 
Sbjct  100   SAMGDFADFKPSDELRQLIPTVDSS-DIFSYPLLVLQVTRFTCGGVCLGVGWHHTLADGT  158

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS---GPLSK  720
               LHFI TW+D+ARGL+V  PPFIDRTILR R PP P F H EYD  PT+ +    P+ +
Sbjct  159   GCLHFITTWSDIARGLTVKTPPFIDRTILRGRVPPNPTFHHVEYDPFPTINTPFQNPIRQ  218

Query  719   LPGANPSTAMLKITPQQLALLK------TNSSHEGSTYEILAAHIWRCVCEARGLSDDQT  558
                 + S A LKI    L  LK      T S  E STY IL AHIWRC C+ARGLS DQ 
Sbjct  219   SGSRDISVANLKIPRDLLNTLKAMAKNDTASKTEYSTYVILTAHIWRCACKARGLSYDQA  278

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TK+ I+T+GR+RL P +PPG+ GNVIF ATP+A SG+L +E LA  A+RI  A+ RMDDE
Sbjct  279   TKINISTNGRNRLRPPIPPGYFGNVIFQATPIALSGDLSSERLAHIAERIHKAIKRMDDE  338

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSA+DYLE   DL+ ++R S  + SPNLNI SW R P +++DFGWG PV+M PA   +
Sbjct  339   YLRSAVDYLEKVDDLTTVMRSSETYRSPNLNIVSWVRFPFYDADFGWGKPVYMRPAFA-F  397

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             EG  YILPSP  D +LSL +CL+ DH+  FQKL Y++
Sbjct  398   EGKGYILPSPTNDGTLSLTICLETDHLESFQKLFYEY  434



>ref|XP_004953073.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=518

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/338 (54%), Positives = 242/338 (72%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             AT+DDFGDF P++EL++L+P+V+ + DIS+FPL + QVT FKCGGV++G G+ H ++DG 
Sbjct  182   ATVDDFGDFAPTMELKRLIPTVEYTDDISAFPLLVLQVTHFKCGGVAIGVGMQHHVADGF  241

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS----GPLS  723
             S LHFI +WADL RG+ +A+ P+I+R+ LRARDPP PA+ H EY   P + S     PL+
Sbjct  242   SGLHFINSWADLCRGVPIAVMPYINRSHLRARDPPAPAYPHIEYQPAPAMLSEPPQAPLT  301

Query  722   KLPGANP-STAMLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P A P + A+ +++   L  L++   + EG    STY +LAAH+WRC   ARGL  DQ
Sbjct  302   AKPAAPPTAVAIFRLSRADLGRLRSRIPAREGAPRFSTYAVLAAHVWRCASLARGLPADQ  361

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TK+Y ATDGR RL P LP G+ GNVIFTATP+A++G  +T  +A  A  I+ AL RMDD
Sbjct  362   PTKMYCATDGRQRLQPPLPEGYFGNVIFTATPLADAGT-VTAGVAEGAAVIQEALDRMDD  420

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
              Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  421   GYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  480

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS N+D SLS+A+ L A+HM  F+KL+Y F
Sbjct  481   YEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  518



>gb|AGM90558.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
2 [Panicum virgatum]
Length=446

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 239/338 (71%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             AT+DDFGDF P++EL++L+P+V+ + DIS+FPL + QVT FKCGGV++G G+ H ++DG 
Sbjct  110   ATVDDFGDFAPTMELKRLIPTVEYTDDISAFPLLVVQVTHFKCGGVAIGVGMQHHVADGF  169

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +WADL RG+  A+ P+IDR++LRARDPP P + H EY   P + S P      
Sbjct  170   SGLHFINSWADLCRGVPFAVMPYIDRSLLRARDPPTPVYPHVEYQPAPAMLSEPPQAPLM  229

Query  710   ANPST-----AMLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
             A P+T     A+ +++   L  L++   + EG    STY +LAAH+WRC   ARGL  DQ
Sbjct  230   AKPATPPAAVAIFRLSRADLGRLRSQIPAREGVPRLSTYAVLAAHVWRCASLARGLPADQ  289

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL P LP G+ GNVIFTATP+A++G  +T  +A  A  I++AL RMD+
Sbjct  290   PTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLADAGT-VTAGVAEGAAVIQAALDRMDE  348

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
              Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  349   GYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  408

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS N+D SLS+A+ L A+HM  F+K +Y F
Sbjct  409   YEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKFIYDF  446



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 239/339 (71%), Gaps = 12/339 (4%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             ++DD GDF P+ ELR+L+P VD   DIS +PL L QVT FKCGGVS+G G+ HT +DG S
Sbjct  100   SLDDLGDFRPTTELRQLIPRVDNPMDISPYPLLLLQVTYFKCGGVSVGVGMEHTATDGAS  159

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS----GPL-S  723
               HFI +W+++ARGL + IPPFIDRT+LR+RDPP P F H+E+D PPT+K+    G L S
Sbjct  160   GTHFINSWSEIARGLDITIPPFIDRTLLRSRDPPTPLFPHSEHDPPPTMKAALGNGTLES  219

Query  722   KL-PGANPSTA-MLKITPQQLALLKTNSSH-----EGSTYEILAAHIWRCVCEARGLSDD  564
             K+ P  +PS   M K++  Q+++LK            S++E++A HIWRC+C+AR L DD
Sbjct  220   KVHPKPSPSVVTMFKLSRDQISVLKAKCKDGPDIVSFSSFEVIAGHIWRCICKARQLPDD  279

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q +K+ IA DGRSRL P LPPG+ GN IF  TP+A SG++L++PL  +  ++  +L R +
Sbjct  280   QESKVSIAVDGRSRLNPKLPPGYFGNAIFHITPMAASGDILSKPLIYAVGKLHESLQRAN  339

Query  383   DEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             DEYLRSA+D+LE  P+ S LVRG + F SPNL I SW ++P+H +DFGWG P+ MGP  I
Sbjct  340   DEYLRSAIDFLELHPNKSSLVRGPHTFRSPNLGITSWCQMPIHEADFGWGRPIFMGPGSI  399

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +YEG  Y+LP+P KD S  LAV L  DHM LF+K  Y F
Sbjct  400   IYEGLAYVLPTPEKDGSRFLAVSLLPDHMTLFKKSFYDF  438



>gb|AFF57839.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
1 [Pyrus x bretschneideri]
Length=441

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 233/332 (70%), Gaps = 7/332 (2%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
              ++DFGDF P+ E RKL+P VD S  IS++PL + QVT FKCGGVSLG G+ H ++DG S
Sbjct  108   VLEDFGDFAPTPEFRKLIPVVDYSAGISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGCS  167

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGA  708
              LHF+ TW+D+ARGL + IPPFIDR +LRARDPP   F H EY   P  K+ P S   G 
Sbjct  168   GLHFVNTWSDIARGLDLTIPPFIDRALLRARDPPQTTFDHVEYQPDPPSKTPPPSTKDGD  227

Query  707   NPST--AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKL  549
               ST  ++ ++T +QL++LK  S  EG     STYE+LA H+WRC  +AR L DDQ TKL
Sbjct  228   AESTRVSIFRLTRKQLSVLKAKSKEEGNSINYSTYEMLAGHVWRCATKARNLPDDQVTKL  287

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             ++A DGRSRL P LPPGF GNV+F   P A +G+L ++P   +A RI   +VRM+++YLR
Sbjct  288   HVAVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAAGRIHDVVVRMNNDYLR  347

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             SALD+LE QPDLS LVRG++ F  P L I SW RLP++++DFGWG P+ MGP  I YEG 
Sbjct  348   SALDFLEVQPDLSALVRGAHTFRCPRLGITSWARLPIYDADFGWGRPIFMGPGGIGYEGL  407

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              ++LPSP  D SLS A+ L +DHM  F KLLY
Sbjct  408   AFVLPSPTNDGSLSGAIPLQSDHMKSFAKLLY  439



>ref|XP_003575337.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=442

 Score =   371 bits (953),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 239/340 (70%), Gaps = 13/340 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              T+DD+GDF P++EL++L+P++D +G ISS+PL + QVT FKCGGV+LG G+ H ++DG 
Sbjct  104   GTVDDYGDFAPTMELKRLIPAIDFTGGISSYPLLVVQVTHFKCGGVALGIGMQHHVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL--KSGPLSKL  717
             S LHFI +WADL RG+ +A+ PFIDRT+LRA DPP PA  H EY   P +     P + L
Sbjct  164   SGLHFINSWADLCRGVPIAVMPFIDRTLLRAHDPPTPAHPHIEYQPAPAMLDSEPPQAIL  223

Query  716   PGANP-----STAMLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSD  567
              GA P     +  + K++   L  L+    + EG    STY +L AH+WRC   ARGL+ 
Sbjct  224   AGAKPDQPPAAVDIFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLAP  283

Query  566   DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRM  387
             +Q TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G+++   LA  A  I++AL RM
Sbjct  284   EQPTKLYCATDGRQRLLPPLPEGYFGNVIFTATPLAEAGKVIAS-LADGANTIQAALERM  342

Query  386   DDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
             D+EY RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H +DFGWG PV MGP  
Sbjct  343   DNEYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHEADFGWGRPVFMGPGG  402

Query  206   ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             I YEG  ++LPS ++D SLS+A+ L A+HM  F+K+++ F
Sbjct  403   IAYEGLAFVLPSASRDGSLSVAISLQAEHMEKFRKMIFDF  442



>dbj|BAO20883.1| hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl transferase 
[Panicum virgatum]
Length=438

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 242/337 (72%), Gaps = 10/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +D++GDF P++EL++L+P+VD + DIS+FPL + QVT FKCGGVSLG G+ H ++DG+
Sbjct  103   AAVDNYGDFAPTMELKRLIPAVDYTDDISAFPLLVLQVTYFKCGGVSLGVGMQHHVADGM  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+DL RG  +++ PFIDRT+LRARDPP P+F+H EY   P + S     L  
Sbjct  163   SGLHFINSWSDLCRGAQISVMPFIDRTLLRARDPPTPSFQHIEYQPAPAMLSSTPQSLTS  222

Query  710   AN--PSTA--MLKITPQQLALLKTN-SSHEGS----TYEILAAHIWRCVCEARGLSDDQT  558
              +  P+TA  + K+T   L  L++   + EG+    TY +LAAH+W+CV  AR L  +Q 
Sbjct  223   KSKPPATAVDIFKLTRSDLGRLRSQLPTGEGAPRFNTYAVLAAHVWKCVSLARSLPPEQP  282

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  LA  A  I+ AL RMD++
Sbjct  283   TKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK-VTSGLAEGAAVIQGALDRMDND  341

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I Y
Sbjct  342   YCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVSMGPGGIAY  401

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             EG  ++LPS N D SLS+A+ L A+HM  F+KL+Y+ 
Sbjct  402   EGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLIYEL  438



>ref|XP_009399564.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=444

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/342 (54%), Positives = 236/342 (69%), Gaps = 16/342 (5%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DDFGDF P++EL++L+P VD + DIS+FPL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  101   ASVDDFGDFAPTMELKQLIPKVDYTDDISAFPLLVLQVTYFKCGGVSLGVGMQHHVADGF  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGP------  729
             S LHFI +W+D+ARG+ +A+ PFIDRT+LRARDPP P++ H EY   P +K+ P      
Sbjct  161   SGLHFINSWSDVARGVGIAVRPFIDRTLLRARDPPTPSYPHVEYQPAPPMKNAPPATTSP  220

Query  728   ----LSKLPGANPSTAMLKITPQQLALLKTNSSHEG--STYEILAAHIWRCVCEARGLSD  567
                 +     A  +  + K+T  QL LLK+ ++  G  STY +LAAH+WRCVC AR L  
Sbjct  221   PINSVKAAGAAATAVNIFKLTRAQLNLLKSKAAPGGAFSTYALLAAHVWRCVCVARDLPP  280

Query  566   DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATP----VAESGELLTEPLASSAKRIRSA  399
             DQ TK+YIATDGR RL P LP G+ GNVIFTATP       +        A +A RI+ +
Sbjct  281   DQPTKMYIATDGRQRLRPKLPEGYFGNVIFTATPVALAGEVAAAAAGGGPALAAGRIQES  340

Query  398   LVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHM  219
             L RMD+EYL SALDYLE QPDL  LVRG++ F  PN+ + SW RLP+H++DFGWG PV M
Sbjct  341   LARMDNEYLWSALDYLEMQPDLGALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFM  400

Query  218   GPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             GP  I YEG  ++LPSP  D SLS+A+ L  DHM  FQKL+Y
Sbjct  401   GPGGIAYEGLAFVLPSPTGDGSLSVAISLQPDHMQKFQKLIY  442



>ref|NP_001145871.1| uncharacterized protein LOC100279386 [Zea mays]
 ref|XP_008667774.1| PREDICTED: uncharacterized protein LOC100279386 isoform X1 [Zea 
mays]
 gb|ACF84552.1| unknown [Zea mays]
 gb|ACF86236.1| unknown [Zea mays]
 gb|ACL52770.1| unknown [Zea mays]
 gb|ACN28217.1| unknown [Zea mays]
 tpg|DAA37089.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 1 [Zea 
mays]
 tpg|DAA37090.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 2 [Zea 
mays]
Length=440

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/334 (55%), Positives = 240/334 (72%), Gaps = 10/334 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DD+GDF P++EL++L+P+VD + DIS+F L + QVT FKCGGVSLG G+ H  +DG+
Sbjct  105   ASVDDYGDFAPTMELKRLIPTVDYTDDISAFSLLVLQVTYFKCGGVSLGVGMQHHAADGM  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+DL RG  +++ PFIDRT+LRARDPP P+F+H EY   P + S     L  
Sbjct  165   SGLHFINSWSDLCRGAQISVMPFIDRTLLRARDPPTPSFQHIEYQSAPAMLSSTTQFLAS  224

Query  710   AN--PSTA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQT  558
              +  P+TA  + K+T   L  L++   + EG    STY +LAAH+W+CV  AR L  +Q 
Sbjct  225   KSKPPATAVDIFKLTRSDLGRLRSQLPAGEGAPRFSTYAVLAAHVWKCVSLARSLPPEQP  284

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G++ +E LA  A  I+ AL RMD++
Sbjct  285   TKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGKVTSE-LAEGAAVIQGALDRMDND  343

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I Y
Sbjct  344   YCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAY  403

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             EG  ++LPS N D SLS+A+ L A+HM  F+KL+
Sbjct  404   EGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLI  437



>dbj|BAJ95750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 241/334 (72%), Gaps = 10/334 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             AT+DD+GDF P+++L++L+P VD + DISSFPL + QVT FKCGGVSLG G+ H ++DG+
Sbjct  103   ATVDDYGDFAPTMDLKRLIPPVDYTDDISSFPLLVLQVTYFKCGGVSLGVGMQHHVADGM  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+DL RG+ +A+ PFIDRT++RARDPP P++ H EY   P + S     L G
Sbjct  163   SGLHFINSWSDLCRGVKIAVMPFIDRTLVRARDPPTPSYPHVEYQPAPAMLSSVPQALGG  222

Query  710   --ANPSTA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQT  558
               A P TA  + K+T  +L  L++   + EG    STY +LAAH+WRCV  AR L+ +Q 
Sbjct  223   KPAPPPTAVGIFKLTRSELGRLRSQLPTGEGAPRFSTYAVLAAHVWRCVSLARNLAPEQP  282

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  LA  A  I+ AL RM  +
Sbjct  283   TKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGK-VTSGLAEGAAVIQGALDRMTSD  341

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y +SALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I Y
Sbjct  342   YCQSALDYLEMQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAY  401

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             EG  ++LPS +KD SLS+A+ L A+HM  F+KL+
Sbjct  402   EGLAFVLPSASKDGSLSIAISLQAEHMEKFRKLI  435



>dbj|BAJ93247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 241/334 (72%), Gaps = 10/334 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             AT+DD+GDF P+++L++L+P VD + DISSFPL + QVT FKCGGVSLG G+ H ++DG+
Sbjct  103   ATVDDYGDFAPTMDLKRLIPPVDYTDDISSFPLLVLQVTYFKCGGVSLGVGMQHHVADGM  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+DL RG+ +A+ PFIDRT++RARDPP P++ H EY   P + S     L G
Sbjct  163   SGLHFINSWSDLCRGVKIAVMPFIDRTLVRARDPPTPSYPHVEYQPAPAMLSSVPQALGG  222

Query  710   --ANPSTA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQT  558
               A P TA  + K+T  +L  L++   + EG    STY +LAAH+WRCV  AR L+ +Q 
Sbjct  223   KPAPPPTAVDIFKLTRSELGRLRSQLPTGEGAPRFSTYAVLAAHVWRCVSLARNLAPEQP  282

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  LA  A  I+ AL RM  +
Sbjct  283   TKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGK-VTSGLAEGAAVIQGALDRMTSD  341

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y +SALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I Y
Sbjct  342   YCQSALDYLEMQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAY  401

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             EG  ++LPS +KD SLS+A+ L A+HM  F+KL+
Sbjct  402   EGLAFVLPSASKDGSLSIAISLQAEHMEKFRKLI  435



>ref|XP_002452435.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
 pdb|4KE4|A Chain A, Elucidation Of The Structure And Reaction Mechanism 
Of Sorghum Bicolor Hydroxycinnamoyltransferase And Its Structural 
Relationship To Other Coa-dependent Transferases And Synthases
 pdb|4KEC|A Chain A, Sbhct-complex Form
 gb|EES05411.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
Length=448

 Score =   369 bits (948),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 187/341 (55%), Positives = 238/341 (70%), Gaps = 15/341 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             ATID FGDF P++EL++L+P+VD S D ++FPL + QVT FKCGGV++G G+ H ++DG 
Sbjct  110   ATIDYFGDFAPTMELKRLIPTVDFSDD-TAFPLLVLQVTHFKCGGVAIGVGMQHHVADGF  168

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYD-HPPTLKSGPLSKLP  714
             S LHFI +WADL RG+ +A+ PFIDR++LRARDPP P + H EY   P  L S P     
Sbjct  169   SGLHFINSWADLCRGVPIAVMPFIDRSLLRARDPPAPVYPHVEYQPAPAMLSSEPPQAAL  228

Query  713   GANPST-----AMLKITPQQLALLKTN---SSHEG----STYEILAAHIWRCVCEARGLS  570
              A P+T     A+ K++  +L  L++       EG    STY +LAAH+WRC   ARGL 
Sbjct  229   TAKPATPPAAVAIFKLSRAELGRLRSQVPAREREGAPRFSTYAVLAAHVWRCASLARGLP  288

Query  569   DDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVR  390
              DQ TKLY ATDGR RL P LP G+ GNVIFTATP+A +G + T  +A  A  I++AL R
Sbjct  289   ADQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLANAGTV-TAGVAEGAAVIQAALDR  347

Query  389   MDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPA  210
             MDD Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP 
Sbjct  348   MDDGYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPG  407

Query  209   LILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              I YEG  ++LPS N+D SLS+A+ L A+HM  F+KL+Y F
Sbjct  408   GIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  448



>ref|XP_003580078.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010240077.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=443

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/331 (56%), Positives = 237/331 (72%), Gaps = 10/331 (3%)
 Frame = -2

Query  1055  FGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHF  876
             +GDF P++EL++L+P+VD + DISSFPL + QVT FKCGGVSLG G+ H ++DG+S LHF
Sbjct  113   YGDFAPTMELKRLIPAVDYTDDISSFPLLVLQVTYFKCGGVSLGVGMQHHVADGMSGLHF  172

Query  875   IKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGA--NP  702
             I +W+DL RGL +AI PFIDRT+LRARDPP P++ H EY   P + S     L G    P
Sbjct  173   INSWSDLCRGLQIAIMPFIDRTLLRARDPPTPSYPHVEYQPAPAMLSSAPQVLTGKPMMP  232

Query  701   STA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQTTKLYI  543
              TA  + K+T  +L  L++   S EG    STY +LAAH+WRCV  AR L  +Q TKLY 
Sbjct  233   PTAVDIFKLTRSELGRLRSQLPSGEGAPRFSTYAVLAAHVWRCVSLARSLPPEQPTKLYC  292

Query  542   ATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSA  363
             ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  L   A  I+ AL RM D+Y RSA
Sbjct  293   ATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK-VTSGLEDGATVIQGALDRMSDDYCRSA  351

Query  362   LDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVY  183
             LDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I YEG  +
Sbjct  352   LDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAF  411

Query  182   ILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             ++PS +KD SLS+A+ L A+HM  F+KL+++
Sbjct  412   VIPSSSKDGSLSIAISLQAEHMEKFRKLIFE  442



>gb|ACG47161.1| anthranilate N-benzoyltransferase protein 2 [Zea mays]
Length=442

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 240/334 (72%), Gaps = 10/334 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A++DD+GDF P++EL++L+P+VD + DIS+F L + QVT FKCGGVSLG G+ H  +DG+
Sbjct  105   ASVDDYGDFAPTMELKRLIPTVDYTDDISAFSLLVLQVTYFKCGGVSLGVGMQHHAADGM  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHFI +W+DL RG  +++ PFIDRT+LRARDPP P+F+H EY   P + S     L  
Sbjct  165   SGLHFINSWSDLCRGAQISVMPFIDRTLLRARDPPTPSFQHIEYQPAPAMLSSTTQFLAS  224

Query  710   AN--PSTA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQT  558
              +  P+TA  + K+T   L  L++   + EG    STY +LAAH+W+CV  AR L  +Q 
Sbjct  225   KSKPPATAVDIFKLTRSDLGRLRSQLPAGEGAPRFSTYAVLAAHVWKCVSLARSLPPEQP  284

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G++ +E LA  A  I+ AL RMD++
Sbjct  285   TKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGKVTSE-LAEGAAVIQGALDRMDND  343

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y RSALDYL+ QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I Y
Sbjct  344   YCRSALDYLDLQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAY  403

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             EG  ++LPS N D SLS+A+ L A+HM  F+KL+
Sbjct  404   EGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLI  437



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score =   366 bits (939),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 188/337 (56%), Positives = 231/337 (69%), Gaps = 11/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + + DF DF PS ELR+L+P+VD S DISS+PL + QVTRF CGGV LG G  HTL+DG 
Sbjct  100   SAMGDFVDFKPSDELRQLIPTVDYS-DISSYPLLVLQVTRFTCGGVCLGVGWHHTLADGT  158

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS---GPLSK  720
               LHFI TW+D+ARGL V  PPFIDRTILR R PP P F H EYD  PT+ +    P+ +
Sbjct  159   ECLHFINTWSDIARGLPVKTPPFIDRTILRGRVPPNPTFHHIEYDPFPTINTHFQNPIPE  218

Query  719   LPGANPSTAMLKITPQQLALLKT------NSSHEGSTYEILAAHIWRCVCEARGLSDDQT  558
                 + S A LKI    L  LK        S  E STY IL AHIWRC C+ARGLS+DQ 
Sbjct  219   SGSKDISVANLKIPSDLLNTLKAMAKNDIASKTEYSTYVILTAHIWRCACKARGLSNDQA  278

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TK+ I+TDGR+R  P +PPG+ GNVIF ATP+A SG LL+EPLA +A+RI  A+ RMDDE
Sbjct  279   TKINISTDGRNRFRPPIPPGYFGNVIFQATPIALSGALLSEPLAHTAERIHKAIKRMDDE  338

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSA+DYLE   D + ++R S  + SPNL I SW RLP +++DFGWG PV+M PA   +
Sbjct  339   YLRSAVDYLERVDDFTTVMRSSETYRSPNLTIASWVRLPFYDADFGWGKPVYMRPASA-F  397

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              G  YI PSP  D +LSL + L+ DH+  FQKL Y++
Sbjct  398   VGKGYIQPSPTNDGTLSLTIFLETDHLQSFQKLFYEY  434



>dbj|BAK06288.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   366 bits (939),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 239/338 (71%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              T+DDFGDF P+++L++L+P+VD +G ISS+PL + QVT FKCGGV+LG G+ H ++DG 
Sbjct  105   GTVDDFGDFAPTMDLKRLIPAVDFTGGISSYPLLVAQVTHFKCGGVALGIGMQHHVADGF  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL----KSGPLS  723
             S LHFI +WADL RG+ +A+ PFIDRT+LRARDPP P+  H EY   P +    +   L+
Sbjct  165   SGLHFINSWADLCRGVPIAVMPFIDRTLLRARDPPTPSHPHIEYQPAPAMLDSEEPQALT  224

Query  722   KLPGANPSTA-MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P A P+   + K+    L  L+    + EG    STY +L AH+WRC   ARGLS +Q
Sbjct  225   AKPEAPPTAVDIFKLCRADLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLSPEQ  284

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL PALP G+ GNVIFTATP+A +G+ +T  LA  A  I++AL  MD+
Sbjct  285   PTKLYCATDGRQRLQPALPEGYFGNVIFTATPLAVAGK-VTGSLADGATTIQAALEVMDN  343

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EY RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  344   EYCRSALDYLEMQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  403

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS ++D SLS+A+ L A+HM  F+K+++ F
Sbjct  404   YEGLAFVLPSASRDGSLSVAISLQAEHMEKFRKMIFDF  441



>dbj|BAJ87836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   365 bits (938),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 239/338 (71%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              T+DDFGDF P+++L++L+P+VD +G ISS+PL + QVT FKCGGV+LG G+ H ++DG 
Sbjct  104   GTVDDFGDFAPTMDLKRLIPAVDFTGGISSYPLLVAQVTHFKCGGVALGIGMQHHVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL----KSGPLS  723
             S LHFI +WADL RG+ +A+ PFIDRT+LRARDPP P+  H EY   P +    +   L+
Sbjct  164   SGLHFINSWADLCRGVPIAVMPFIDRTLLRARDPPTPSHPHIEYQPAPAMLDSEEPQALT  223

Query  722   KLPGANPSTA-MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P A P+   + K+    L  L+    + EG    STY +L AH+WRC   ARGLS +Q
Sbjct  224   AKPEAPPTAVDIFKLCRADLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLSPEQ  283

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL PALP G+ GNVIFTATP+A +G+ +T  LA  A  I++AL  MD+
Sbjct  284   PTKLYCATDGRQRLQPALPEGYFGNVIFTATPLAVAGK-VTGSLADGATTIQAALEVMDN  342

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EY RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  343   EYCRSALDYLEMQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  402

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS ++D SLS+A+ L A+HM  F+K+++ F
Sbjct  403   YEGLAFVLPSASRDGSLSVAISLQAEHMEKFRKMIFDF  440



>ref|XP_002446745.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
 gb|EES11073.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
Length=441

 Score =   365 bits (938),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 240/333 (72%), Gaps = 10/333 (3%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             ++DD+GDF P+++L++L+P+VD + DIS+FPL + QVT FKCGG+SLG G+ H ++DG+S
Sbjct  107   SVDDYGDFAPTMDLKRLIPTVDYTDDISAFPLLVLQVTHFKCGGISLGVGMQHHVADGMS  166

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGA  708
              LHFI +W+DL RG  +++ PFIDRT++RARDPP P+F H EY   P + S     L   
Sbjct  167   GLHFINSWSDLCRGAQISVMPFIDRTLIRARDPPTPSFHHIEYQPAPAILSSTPQFLASK  226

Query  707   N--PSTA--MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQTT  555
             +  P+TA  + K+T   L  L++  ++ EG    STY +LAAH+W+CV  AR L  +Q T
Sbjct  227   SKPPATAVDIFKLTRSDLGRLRSQLAAGEGAPRFSTYAVLAAHVWKCVSLARSLPPEQPT  286

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLY ATDGR RL P LP G+ GNVIFTATP+AE+G+ +T  LA  A  I+ AL RMD++Y
Sbjct  287   KLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGK-VTSGLAEGAAVIQGALDRMDNDY  345

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
              RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I YE
Sbjct  346   CRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYE  405

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             G  ++LPS N D SLS+A+ L A+HM  F+KL+
Sbjct  406   GLAFVLPSANGDGSLSIAISLQAEHMEKFRKLI  438



>gb|KJB54947.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=417

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/345 (53%), Positives = 237/345 (69%), Gaps = 13/345 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD   FTPS ELRKL+P+VD SGDISS+PL + QVT FKCGGV LG    HTL+DG 
Sbjct  72    SAMDDLEGFTPSSELRKLVPTVDYSGDISSYPLVMAQVTTFKCGGVCLGIATHHTLTDGT  131

Query  890   SALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS----GPL  726
             +ALHFI +W++LAR L  +++PP IDRT+LRAR PP P F H EYD PP+L +    GP 
Sbjct  132   TALHFINSWSELARALPQISMPPLIDRTLLRARAPPIPRFHHLEYDPPPSLNTCMSLGPN  191

Query  725   SKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQ  561
             +  P    + ++ KIT  QL  LK  SS  G     STY ILAA+IWRC  +ARGLS DQ
Sbjct  192   NHKPS---TVSVFKITQNQLNTLKAKSSEHGNKTNYSTYTILAAYIWRCATKARGLSYDQ  248

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY+ T+GR RL P LP  ++GN +FTA+ +A S  L +EP  ++ +R+   L RMD+
Sbjct  249   PTKLYMPTNGRPRLHPPLPSRYVGNAMFTASLIALSENLQSEPFVNTLERVHGTLRRMDN  308

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYLRSALDYLE  PD++   R  + F  PNLNI +W RL +H++DFGWG P++MGPA I+
Sbjct  309   EYLRSALDYLETLPDITAARRAPDTFQCPNLNIINWIRLSIHDADFGWGRPIYMGPANIV  368

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF*WGYDVL  66
             +EG +Y+LPSP  D SLS+  CL   HM LF+K LY+    +D +
Sbjct  369   HEGKIYLLPSPTDDGSLSVVACLQTAHMKLFEKHLYEGLMSFDKI  413



>ref|XP_002303858.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
 gb|EEE78837.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
Length=315

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/297 (58%), Positives = 216/297 (73%), Gaps = 6/297 (2%)
 Frame = -2

Query  968  LFQVTRFKCGGVSLGTGIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDP  789
            L  VT FKCGGVSLG G+ H  +DG S LHF+ TW+D+ARGL + IPPFIDRT+LRARDP
Sbjct  16   LIAVTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDP  75

Query  788  PCPAFKHTEYDHPPTLKSGPLSKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STY  624
            P PAF H EY  PP +K+   +  P +  + ++ K+T  QL  LK  +   G     S+Y
Sbjct  76   PQPAFHHVEYQPPPAMKTVLETSKPEST-AVSIFKLTRDQLNTLKAKAKEGGNNIGYSSY  134

Query  623  EILAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
            E+LA H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+
Sbjct  135  EMLAGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEI  194

Query  443  LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
             ++P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RL
Sbjct  195  QSKPTWYAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRL  254

Query  263  PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            P+H++DFGWG P+ MGP  I YEG  +I+PS   D SLS+A+ L A+HM LF+K +Y
Sbjct  255  PIHDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAISLQAEHMKLFEKFIY  311



>dbj|BAC78635.1| hydroxyanthranilate hydroxycinnamoyltransferase 3 [Avena sativa]
Length=440

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/338 (53%), Positives = 236/338 (70%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P++ L++L+P+VD +G ISS+PL + QVT FKCGGV+LG G+ H ++DG 
Sbjct  104   GAVDDFGDFAPTMGLKRLIPTVDFTGGISSYPLLVVQVTHFKCGGVALGIGMQHHVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL----KSGPLS  723
             S LHFI +W+DL RG+ +A+ PFIDRT+LRARDPP P   H EY   P +    +   L+
Sbjct  164   SGLHFINSWSDLCRGVPIAVMPFIDRTLLRARDPPVPTHPHIEYQPAPAMLGSEEPQALA  223

Query  722   KLPGANPSTA-MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P + P+   + K++   L  L+    + EG    STY +L AH+WRC   ARGL+ +Q
Sbjct  224   GKPESPPTAVDIFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLAPEQ  283

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G++ T  LA  A  I+ AL +MDD
Sbjct  284   PTKLYCATDGRQRLTPTLPDGYFGNVIFTATPLAEAGKV-TGSLADGATTIQDALEKMDD  342

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EY  SALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  343   EYCHSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  402

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS N+D SLS+A+ L A+HM  F+K+++ F
Sbjct  403   YEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKMIFDF  440



>ref|NP_001047408.1| Os02g0611800 [Oryza sativa Japonica Group]
 dbj|BAD19683.1| putative hydroxyanthranilate hydroxycinnamoyltransferase 3 [Oryza 
sativa Japonica Group]
 dbj|BAF09322.1| Os02g0611800 [Oryza sativa Japonica Group]
 gb|EAY86657.1| hypothetical protein OsI_08038 [Oryza sativa Indica Group]
 dbj|BAG96596.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/338 (54%), Positives = 237/338 (70%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             AT+DDFGDF P+++L++L+P+VD +  ISSFP+ + QVT FKCGGV+LG G+ H ++DG 
Sbjct  106   ATVDDFGDFAPTMDLKRLIPTVDYTDGISSFPILVLQVTHFKCGGVALGVGMQHHVADGF  165

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS----GPLS  723
             S LHFI +WADL RG+ +A+ PFIDRT++RARDPP P+  H EY   P + +      L+
Sbjct  166   SGLHFINSWADLCRGVPIAVMPFIDRTLVRARDPPAPSHPHVEYQPAPAMLAPEPPQALT  225

Query  722   KLPGANPSTA-MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P   P+   + K++   L  L++     EG    STY +LAAH+WRC   ARGL  +Q
Sbjct  226   AKPAPPPTAVDIFKLSRSDLGRLRSQLPRGEGAPRYSTYAVLAAHVWRCASLARGLPAEQ  285

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL P+LP G+ GNVIFTATP+AE+G  +T  LA  A  I+SAL RMD 
Sbjct  286   PTKLYCATDGRQRLQPSLPDGYFGNVIFTATPLAEAGR-VTGSLADGAATIQSALDRMDS  344

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
              Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  345   GYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  404

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS + D SLS+A+ L A+HM  F+K+++ F
Sbjct  405   YEGLAFVLPSASGDGSLSVAISLQAEHMEKFRKMIFDF  442



>gb|EYU21749.1| hypothetical protein MIMGU_mgv1a006630mg [Erythranthe guttata]
Length=437

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 240/343 (70%), Gaps = 26/343 (8%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRK-LLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
               +DDFGDF PSLELR+ L+P VD +   S++PL L QVT FKCGGV+LG G+ H ++DG
Sbjct  102   GVVDDFGDFAPSLELRRRLIPVVDYTQGFSTYPLLLLQVTHFKCGGVTLGVGMQHHVADG  161

Query  893   LSALHFIKTWADLARGLSVA-IPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKL  717
              S LHFI TW+D+ARGL+ A +PPFIDR+IL ARDPP P F+H EY +PP          
Sbjct  162   FSGLHFINTWSDMARGLAAATVPPFIDRSILCARDPPRPQFEHIEYHYPPK---------  212

Query  716   PGANPST---AMLKITPQQLALLKT----------NSSHEGSTYEILAAHIWRCVCEARG  576
             P A+ +T   ++ K+TP QL  LK+          N+    ++++++ AHIWRCV  ARG
Sbjct  213   PPADETTTTVSLFKLTPDQLNNLKSKFKSSDDEINNAVSSYTSFQMVVAHIWRCVTRARG  272

Query  575   LSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSAL  396
             L   Q TKLYI+TDGRSRL PALPPG+ GNVIFTA PVA SG++L+EP+  +A +IR+AL
Sbjct  273   LPRAQETKLYISTDGRSRLRPALPPGYFGNVIFTAAPVAVSGDILSEPVTYAAGKIRAAL  332

Query  395   VRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMG  216
              RMDDEY+RSALDYLE Q D+  + RG   F  P+L + SW RLPV+++DFGWG PV+MG
Sbjct  333   ARMDDEYMRSALDYLELQGDVKAVARGPQTFTCPDLGVISWVRLPVYDADFGWGKPVYMG  392

Query  215   PALILYEGTVYILPSP--NKDRSLSLAVCLDADHMPLFQKLLY  93
             P  + YEG  +++P P  N++  L +A+ L   H+ +F++LLY
Sbjct  393   PGGLAYEGRCFLMPPPPANEEGGLLVAMSLQKQHVEIFKELLY  435



>gb|KJB54946.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score =   364 bits (935),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 236/343 (69%), Gaps = 13/343 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD   FTPS ELRKL+P+VD SGDISS+PL + QVT FKCGGV LG    HTL+DG 
Sbjct  100   SAMDDLEGFTPSSELRKLVPTVDYSGDISSYPLVMAQVTTFKCGGVCLGIATHHTLTDGT  159

Query  890   SALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS----GPL  726
             +ALHFI +W++LAR L  +++PP IDRT+LRAR PP P F H EYD PP+L +    GP 
Sbjct  160   TALHFINSWSELARALPQISMPPLIDRTLLRARAPPIPRFHHLEYDPPPSLNTCMSLGPN  219

Query  725   SKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQ  561
             +  P    + ++ KIT  QL  LK  SS  G     STY ILAA+IWRC  +ARGLS DQ
Sbjct  220   NHKPS---TVSVFKITQNQLNTLKAKSSEHGNKTNYSTYTILAAYIWRCATKARGLSYDQ  276

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY+ T+GR RL P LP  ++GN +FTA+ +A S  L +EP  ++ +R+   L RMD+
Sbjct  277   PTKLYMPTNGRPRLHPPLPSRYVGNAMFTASLIALSENLQSEPFVNTLERVHGTLRRMDN  336

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYLRSALDYLE  PD++   R  + F  PNLNI +W RL +H++DFGWG P++MGPA I+
Sbjct  337   EYLRSALDYLETLPDITAARRAPDTFQCPNLNIINWIRLSIHDADFGWGRPIYMGPANIV  396

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF*WGYD  72
             +EG +Y+LPSP  D SLS+  CL   HM LF+K LY+    +D
Sbjct  397   HEGKIYLLPSPTDDGSLSVVACLQTAHMKLFEKHLYEGLMSFD  439



>dbj|BAC78634.1| hydroxyanthranilate hydroxycinnamoyltransferase 2 [Avena sativa]
Length=440

 Score =   364 bits (935),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 236/338 (70%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
              T+DDFGDF P++ L++L+P+VD +G ISS+PL + QVT FKCGGV+LG G+ H ++DG 
Sbjct  104   GTVDDFGDFAPTMGLKRLIPTVDFTGGISSYPLLVAQVTHFKCGGVALGIGMQHHVADGF  163

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL----KSGPLS  723
             S LHFI +W+D+ RG+ +A+ PFIDRT+LRARDPP P   H EY   P +    +   L+
Sbjct  164   SGLHFINSWSDICRGVPIAVMPFIDRTLLRARDPPVPTHPHIEYQPAPAMLGSEEPQALA  223

Query  722   KLPGANPSTA-MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P + P+   + K++   L  L+    + EG    STY +L AH+WRC   ARGL+ +Q
Sbjct  224   GKPESPPTAVDIFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASMARGLAPEQ  283

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL P LP G+ GN IFTATP+AE+G++ T  LA  A  I+ AL +MDD
Sbjct  284   PTKLYCATDGRQRLTPTLPDGYFGNAIFTATPLAEAGKV-TGSLADGATTIQEALEKMDD  342

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EY  SALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  343   EYCHSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  402

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS N+D SLS+A+ L A+HM  F+K+++ F
Sbjct  403   YEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKMIFDF  440



>gb|AEN02914.1| HCT1 [Populus nigra]
Length=297

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 215/294 (73%), Gaps = 6/294 (2%)
 Frame = -2

Query  959  VTRFKCGGVSLGTGIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCP  780
            VT FKCGGVSLG G+ H  +DG S LHF+ TW+D+ARGL + IPPFIDRT+LRARDPP P
Sbjct  1    VTYFKCGGVSLGVGMQHHAADGFSGLHFVNTWSDMARGLDLTIPPFIDRTLLRARDPPQP  60

Query  779  AFKHTEYDHPPTLKSGPLSKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEIL  615
            AF H EY  PP +K+   +  P +  + ++ K+T  QL  LK  +   G     S+YE+L
Sbjct  61   AFHHVEYQPPPAMKTVLETSKPEST-AVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEML  119

Query  614  AAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTE  435
            A H+WR  C+ARGL DDQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +GE+ ++
Sbjct  120  AGHVWRSACKARGLPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSK  179

Query  434  PLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVH  255
            P   +A +I  +LVRMD++YLRSALD+LE QPDLS LVRG++ F  PNL I SW RLP+H
Sbjct  180  PTWCAAGKIHDSLVRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIH  239

Query  254  NSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            ++DFGWG P+ MGP  I YEG  +I+PS   D S+S+A+ L A+HM LF+K +Y
Sbjct  240  DADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAISLQAEHMKLFEKFIY  293



>emb|CAE01635.3| OSJNBa0029H02.19 [Oryza sativa Japonica Group]
Length=484

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/354 (54%), Positives = 241/354 (68%), Gaps = 28/354 (8%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQ-----------------VTRFKC  942
             A++DD+GDF P++EL++L+P+VD + DISSF L + Q                 VT FKC
Sbjct  106   ASVDDYGDFAPTMELKRLIPAVDYTDDISSFSLLVLQCTTQRVNGKNLFASVAKVTYFKC  165

Query  941   GGVSLGTGIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTE  762
             GGVSLG G+ H ++DG+S LHFI +W+DL RG  +AI PFIDRT+LRARDPP P++ H E
Sbjct  166   GGVSLGVGMQHHVADGMSGLHFINSWSDLCRGTQIAIMPFIDRTLLRARDPPTPSYPHVE  225

Query  761   YD-HPPTLKSGPLSKLPGAN--PSTA--MLKITPQQLALLKTN-SSHEG----STYEILA  612
             Y   P  L S P S        P TA  + K+T   L  L++   S EG    STY +LA
Sbjct  226   YQPAPAMLSSVPQSVTANKTTPPPTAVDIFKLTRSDLGRLRSQLPSGEGAPRFSTYAVLA  285

Query  611   AHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEP  432
             AH+WRCV  ARGL  +Q TKLY ATDGR RL P LP G+ GNVIFTATP+AE+G++ T  
Sbjct  286   AHVWRCVSLARGLPSEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGKV-TSG  344

Query  431   LASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHN  252
             LA  A  I+ AL RM+D Y RSALDYLE QPDLS LVRG++ F  PNL + SW RLP+H+
Sbjct  345   LADGAAVIQEALDRMNDSYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHD  404

Query  251   SDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             +DFGWG PV MGP  I YEG  ++LPS NKD SLS+A+ L A+HM  F+KL+++
Sbjct  405   ADFGWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  458



>ref|XP_002979061.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
 gb|EFJ20018.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
Length=451

 Score =   363 bits (932),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 238/346 (69%), Gaps = 21/346 (6%)
 Frame = -2

Query  1070  ATIDDFG-DFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
             A++D++  DF P +  ++L+PSVD + DI SFPL + Q+TRFKCGG SLG G+ H ++DG
Sbjct  103   ASVDEYARDFAPDVSFQRLIPSVDYTQDIGSFPLLVLQITRFKCGGASLGVGMEHHVADG  162

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK-----SGP  729
             +S + FI TWA +ARG    I P+IDRT+LRA  PP P F H EY  PP LK     +G 
Sbjct  163   MSGITFINTWAAMARGEDPKIVPYIDRTLLRANKPPVPKFPHVEYHPPPLLKQAAATNGH  222

Query  728   LSKLPGANPSTA----------MLKITPQQLALLKTNSSHEG-----STYEILAAHIWRC  594
                   A P T           + K T +QL  LK+ ++ E      S+YE+L+ HIWR 
Sbjct  223   SVSNGKAKPHTGDDAPPRIAVGLFKFTKEQLQALKSQATDEETNTTYSSYEMLSGHIWRS  282

Query  593   VCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAK  414
             +C ARGL DDQ TKLYIATDGR+R+ P LP  + GNVIFT TP+A +G+L++ PL  +A 
Sbjct  283   MCLARGLDDDQETKLYIATDGRARVVPPLPKHYFGNVIFTCTPMALAGDLVSRPLYYAAS  342

Query  413   RIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWG  234
              I +A+ RM+DEYLRSALDYLE QPDL KLVRG++ F SPNL I SW+RLPV+++DFGWG
Sbjct  343   VIHNAVSRMNDEYLRSALDYLELQPDLYKLVRGAHTFRSPNLGITSWSRLPVYDADFGWG  402

Query  233   TPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
              PV MGPA+I +EG VY+LPS   D SLS+++ L  +HMP F++L+
Sbjct  403   RPVFMGPAVIAFEGLVYVLPSGTGDGSLSISLGLQPEHMPRFEQLI  448



>ref|XP_002991534.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
 gb|EFJ07456.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
Length=449

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 237/344 (69%), Gaps = 19/344 (6%)
 Frame = -2

Query  1070  ATIDDFG-DFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
             A++D++  DF P +  ++L+PSVD + DI SFPL + Q+TRFKCGG SLG G+ H ++DG
Sbjct  103   ASVDEYARDFAPDVSFQRLIPSVDYTQDIGSFPLLVLQITRFKCGGASLGVGMEHHVADG  162

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK--------  738
             +S + FI TWA +ARG    I P+IDRT+LRA  PP P F H EY  PP LK        
Sbjct  163   MSGITFINTWAAMARGEDPKIVPYIDRTLLRANKPPIPKFPHVEYHPPPLLKHAAATNGH  222

Query  737   -SGPLSKLPGANP----STAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVC  588
              +G      G +     +  + K T +QL  LK+ ++ E      S+YE+L+ HIWR +C
Sbjct  223   SNGKAKPQAGDDAPPRIAVGLFKFTKEQLQALKSQATDEETNTTYSSYEMLSGHIWRSMC  282

Query  587   EARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRI  408
              ARGL DDQ TKLYIATDGR+R+ P LP  + GNVIFT TP+A +G+L++ PL  +A  I
Sbjct  283   LARGLDDDQETKLYIATDGRARVVPPLPKHYFGNVIFTCTPMALAGDLVSRPLYYAASVI  342

Query  407   RSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTP  228
               A+ RM+DEYLRSALDYLE QPDL KLVRG++ F SPNL I SW+RLPV+++DFGWG P
Sbjct  343   HDAVSRMNDEYLRSALDYLELQPDLYKLVRGAHTFRSPNLGITSWSRLPVYDADFGWGRP  402

Query  227   VHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLL  96
             V MGPA+I +EG VY+LPS   D SLS+++ L  +HMP F++L+
Sbjct  403   VFMGPAVIAFEGLVYVLPSGTGDGSLSISLGLQPEHMPRFEQLI  446



>ref|XP_006382509.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
 gb|ERP60306.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
Length=444

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/342 (53%), Positives = 231/342 (68%), Gaps = 15/342 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TID+ GDFTP  E+ + +P VD S +I S+PL L Q T FKCGGV LG G+ H L DG 
Sbjct  104   STIDELGDFTPHFEMLQFIPEVDRS-NIFSYPLLLLQATLFKCGGVCLGVGLHHILGDGT  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK---SGPLSK  720
             SA+HFI +W+++ARGLSV IPPFIDRT+L AR PP PA  H EYD PP L    SG  + 
Sbjct  163   SAIHFINSWSEIARGLSVTIPPFIDRTLLDARVPPFPAMHHVEYDPPPPLNTHISGDQTL  222

Query  719   LPGANPS---TAMLKITPQQLALLKTNSSHE--------GSTYEILAAHIWRCVCEARGL  573
                +NP      +L IT  QL  LK  S  +         ST+E LAAHIW+C C+ARG+
Sbjct  223   EIQSNPEPTCAKILTITFDQLRTLKNKSRKDVADGSTINYSTFETLAAHIWQCTCKARGI  282

Query  572   SDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALV  393
             ++DQ TKL+I TDGRSRL P LP G+ GNV+FTA  +  SGE+ ++PL  +  +IR AL 
Sbjct  283   TNDQATKLHIPTDGRSRLNPPLPAGYCGNVLFTAAILGLSGEIQSKPLVDTIAKIRGALK  342

Query  392   RMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGP  213
             RMD+EYLRSA+DYL+ Q DL  L RG + F SPNLNI SW  +P++++DFGWG P  MGP
Sbjct  343   RMDNEYLRSAIDYLQVQADLEALKRGPHTFKSPNLNIVSWMTMPIYDADFGWGRPYFMGP  402

Query  212   ALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             A++ +EG  YI   PN D SL +  CL+++HM LF+K  Y F
Sbjct  403   AIVGFEGMAYIARCPNNDGSLMIFTCLESNHMELFKKFFYDF  444



>ref|XP_009394928.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=441

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/339 (55%), Positives = 234/339 (69%), Gaps = 13/339 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             A +DDFGDF P++EL++L+P VD + DI++FPL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  101   AAVDDFGDFAPTMELKQLIPKVDYTDDIAAFPLLVLQVTYFKCGGVSLGVGMQHHVADGF  160

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK---SGPLSK  720
             S LHFI +W+D+ARG+ V + PFIDRT+LRARDPP P+F H EY   P LK   S P + 
Sbjct  161   SGLHFINSWSDIARGVGVRVQPFIDRTLLRARDPPTPSFPHVEYQPAPPLKTAPSTPPTS  220

Query  719   LPGANP------STAMLKITPQQLALLKTNSSHEG--STYEILAAHIWRCVCEARGLSDD  564
              P  NP      + ++ K+T  QL LLK  +   G  STY +LAAH+WRC C AR L  D
Sbjct  221   PPSVNPAKLGSVAVSIFKLTRAQLNLLKAKAPPGGTYSTYALLAAHVWRCACVARDLPPD  280

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPV--AESGELLTEPLASSAKRIRSALVR  390
             Q TK+YIATDGR RL P  P G+ GNVIFTATP+  A          A +A  I+ +L R
Sbjct  281   QPTKMYIATDGRQRLVPPPPEGYFGNVIFTATPMAEAGEVAAAGGGPAPTAGTIQESLTR  340

Query  389   MDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPA  210
             MDD Y+RSALDYLE QPDL+ LVRG++ F  PN+ + SW RLP+H++DFGWG PV MGP 
Sbjct  341   MDDAYVRSALDYLEMQPDLAALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPG  400

Query  209   LILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              I YEG  ++LPSP  D SLS+A+ L  DHM  F+KL+Y
Sbjct  401   GIAYEGLAFVLPSPTADGSLSVAISLQPDHMLEFRKLIY  439



>dbj|BAC78633.1| hydroxyanthranilate hydroxycinnamoyltransferase 1 [Avena sativa]
Length=441

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 234/338 (69%), Gaps = 11/338 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P++ L++L+P+VD +G ISS+PL + QVT FKCGGV+LG  + H ++DG 
Sbjct  105   GAVDDFGDFVPTMGLKRLIPTVDFTGGISSYPLLVVQVTHFKCGGVALGIAMQHHVADGF  164

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL----KSGPLS  723
             S LHFI +W+DL RG+ +A+ PFIDRT+LRARDPP P   H EY   P +    +   L+
Sbjct  165   SGLHFINSWSDLCRGVPIAVMPFIDRTLLRARDPPVPTHPHIEYQPAPAMLGSEEPQALA  224

Query  722   KLPGANPSTA-MLKITPQQLALLKTN-SSHEG----STYEILAAHIWRCVCEARGLSDDQ  561
               P + P+   + K++   L  L+    + EG    STY +L AH+WRC   ARGL+ +Q
Sbjct  225   GKPESPPTAVDIFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLAPEQ  284

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKLY ATDGR RL P  P G+ GNVIFTATP+AE+G++ T  LA  A  I+ AL +MDD
Sbjct  285   PTKLYCATDGRQRLTPTHPDGYFGNVIFTATPLAEAGKV-TGSLADGATTIQDALEKMDD  343

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EY  SALDYLE QPDLS LVRG++ F  PNL + SW RLP+H++DFGWG PV MGP  I 
Sbjct  344   EYCHSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIA  403

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             YEG  ++LPS N+D SLS+A+ L A+HM  F+K+++ F
Sbjct  404   YEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKMIFDF  441



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 232/342 (68%), Gaps = 16/342 (5%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TID+ GDFTP  E+ + +P VD S  I S+PL L Q T FKCGGV LG G+ H L DG 
Sbjct  104   STIDEVGDFTPHSEMLQFIPEVDRSS-IFSYPLLLAQATFFKCGGVCLGVGLHHILGDGT  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK---SGPLSK  720
             SA+HFI +W+++ARGLSV  PPFIDRT+L AR PP PA  H EYD PPTL    SG  + 
Sbjct  163   SAIHFINSWSEIARGLSVTTPPFIDRTLLDARVPPVPAMHHVEYDPPPTLNTHNSGDQTL  222

Query  719   LPGANPS---TAMLKITPQQLALLKTNSSHEG--------STYEILAAHIWRCVCEARGL  573
                +NP      +L IT  QL  LK N S +G        ST+E LAAHIW+C C+ARG+
Sbjct  223   EIQSNPKPTCAKILTITFDQLRTLK-NKSRKGVVDGTINYSTFETLAAHIWQCTCKARGI  281

Query  572   SDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALV  393
             S+DQ TKL+I TDGRSRL P LP G+ GN +FT   +  SGE+ ++PL  +  +IR AL 
Sbjct  282   SNDQATKLHIPTDGRSRLNPPLPAGYCGNALFTTAVLGLSGEIQSKPLVHTITKIRGALK  341

Query  392   RMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGP  213
             RMD+EYLRSA+DYL  QP+L  L RG + F +PN+NI SW  +P++++DFGWG P  MGP
Sbjct  342   RMDNEYLRSAIDYLHVQPNLEALKRGPHTFNNPNINIVSWMTMPIYDADFGWGRPSFMGP  401

Query  212   ALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             A++L+EG  YI  SP+ D S  + +CL+++HM LF+K  Y F
Sbjct  402   AVVLFEGMAYITRSPSNDGSFMIFICLESNHMELFKKFFYDF  443



>ref|XP_002324532.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
 gb|EEF03097.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
Length=440

 Score =   359 bits (921),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 229/337 (68%), Gaps = 11/337 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + + DF  F PS ELR+L+P+VD S DISS+PL + QVTRF CGGV LG G  HTL+DG 
Sbjct  100   SAMGDFVGFKPSDELRQLIPTVDYS-DISSYPLLVLQVTRFTCGGVCLGVGWQHTLADGT  158

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS---GPLSK  720
               LHFI TW+D+ARGL V  PPFIDRTILR R PP P F H EYD  PT+ +    P+ +
Sbjct  159   ECLHFINTWSDIARGLPVKTPPFIDRTILRGRVPPNPTFHHIEYDPYPTINTPFQNPIPE  218

Query  719   LPGANPSTAMLKITPQQLALLKT------NSSHEGSTYEILAAHIWRCVCEARGLSDDQT  558
                 + S A LKIT   L  LK        S  E STY IL AHIWRC C+ARGLS+DQ 
Sbjct  219   SGSKDISVANLKITSDLLNTLKAMAKNDIASKTEYSTYVILTAHIWRCACKARGLSNDQA  278

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKL I T+GR R  P L PG+ GNV F ATP+A SG LL+EPLA +A+RI  A+ RMDDE
Sbjct  279   TKLSIPTNGRDRFRPPLQPGYFGNVTFLATPIALSGALLSEPLAHTAERIHKAIKRMDDE  338

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             YLRSA+DYLE   DL+ ++R S  + SPNL+I +W RLP +++DFGWG PV+M PA   +
Sbjct  339   YLRSAVDYLEKVDDLTTVMRSSETYRSPNLHIVNWVRLPFYDADFGWGKPVYMRPASA-F  397

Query  197   EGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
              G  YI PSP  D +LSL + L+ DH+  FQKL Y++
Sbjct  398   VGKGYIQPSPTNDGTLSLTIFLETDHLQSFQKLFYEY  434



>gb|KHG20214.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=436

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 226/331 (68%), Gaps = 8/331 (2%)
 Frame = -2

Query  1055  FGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHF  876
              GDFT + +  +L+P VD SG ISS+PL + QVT+FKCGGVSLG GI HTL DG +ALHF
Sbjct  106   IGDFTENSQGLRLVPKVDYSGGISSYPLIVLQVTKFKCGGVSLGVGIQHTLGDGAAALHF  165

Query  875   IKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANPS-  699
             I +WAD +RGL+ AI PFIDRT+LRARDPP P   H EYD  P LKS   S+     PS 
Sbjct  166   INSWADTSRGLTPAIVPFIDRTLLRARDPPTPKLHHVEYDPSPALKSALKSQSDDHKPSI  225

Query  698   TAMLKITPQQLALLKT-------NSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              +  ++T  QL  LK        N   + S++ ILAAHIWRCV +ARGLS DQ TKLY  
Sbjct  226   VSTFELTADQLNTLKAKANVANANGGIKYSSFNILAAHIWRCVSKARGLSADQDTKLYFP  285

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
              DGR RL P LPPG+ GNVIFT   +AE+G+L TE    + KRI   L +++DEYLRSA+
Sbjct  286   VDGRYRLDPPLPPGYFGNVIFTTALIAEAGDLETESFTDTIKRIHERLNQINDEYLRSAI  345

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DY+E  PDL+ LVRG + F  PNL +  W  LP++ +DFGWG P++MGP  ++ EG +Y+
Sbjct  346   DYIEKVPDLNTLVRGPHTFRCPNLVVVPWNWLPIYEADFGWGRPIYMGPGNVVQEGKIYM  405

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP  D SL+LA  L+  HM +F+KL+Y+ 
Sbjct  406   LPSPANDGSLTLAARLEIPHMKVFEKLIYEI  436



>ref|XP_008228885.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=381

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 224/315 (71%), Gaps = 6/315 (2%)
 Frame = -2

Query  1016  LPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHFIKTWADLARGLSV  837
             +P+VD S  ISS+PL + QVT FKCGGVSLG G+ H ++DGLS LHF+ TW+D+ARGL +
Sbjct  68    VPAVDYSAGISSYPLLVVQVTYFKCGGVSLGVGLEHRVADGLSGLHFVNTWSDIARGLDL  127

Query  836   AIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANPSTAMLKITPQQLALL  657
              IPPFIDRT+LRARDPP PAF H EY   P +K+G  S +   + + ++ ++T +QL +L
Sbjct  128   TIPPFIDRTLLRARDPPQPAFDHIEYQPDPPIKTGTKS-VGDESATVSIFRLTREQLNIL  186

Query  656   KTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFL  492
             K  S  +G     +TYE+LA H+WRC   AR L DDQ +KL+IA DGRSRL P +PPGF 
Sbjct  187   KAKSKEDGNTINYTTYEMLAGHVWRCASVARELPDDQESKLHIAVDGRSRLQPPIPPGFF  246

Query  491   GNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGS  312
             GNV+F++ P+A +G+L ++P   +A RI  A+VRMD++YLRSALDYLE QPDL  LVRG+
Sbjct  247   GNVVFSSAPIAAAGDLKSKPTWYAASRIHDAVVRMDNDYLRSALDYLELQPDLLPLVRGA  306

Query  311   NYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCL  132
               F  P L I +W+RLP++++DFGWG P  MGP  I YEG  ++LPS   D SLS+ + L
Sbjct  307   RTFRCPRLAITNWSRLPIYDADFGWGRPTFMGPGGIGYEGLAFVLPSATNDGSLSVVISL  366

Query  131   DADHMPLFQKLLYKF  87
              +  M  F KLLY+ 
Sbjct  367   QSQRMKSFSKLLYEI  381



>gb|EPS67512.1| hypothetical protein M569_07262 [Genlisea aurea]
Length=448

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/343 (51%), Positives = 224/343 (65%), Gaps = 29/343 (8%)
 Frame = -2

Query  1040  PSLELRKLLPSVDTSGDISSFPLALFQV--------------------TRFKCGGVSLGT  921
             P+LELRKL+P+VD S  IS FPL + QV                    T F+CGGVSLG 
Sbjct  110   PTLELRKLIPAVDYSKAISDFPLLVLQVRLLHLSCRWGTDLGFDFIQVTYFRCGGVSLGV  169

Query  920   GIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL  741
             G+ H + DG S LHF+ TWAD ARGL + +PPFIDRT+LRA   P P F+H EY  PP +
Sbjct  170   GMQHHVVDGASGLHFVNTWADFARGLDLTVPPFIDRTLLRAGKRPDPKFQHVEYQPPPEM  229

Query  740   KSGPLSKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARG  576
              S      P    + ++ K+T QQL  L+     +      S+Y ++A H+WRC CEAR 
Sbjct  230   TS----DAPLTETAVSIFKLTRQQLDSLRAKCGSDQQQAVYSSYVLVAGHVWRCACEARS  285

Query  575   LSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSAL  396
             L DDQ TK+YIA DGRSRL P LPPG+ GN +FTATP+A +G+++ + L  SA +I  A+
Sbjct  286   LPDDQKTKVYIAIDGRSRLRPPLPPGYFGNALFTATPIAAAGDVIGKSLRHSATKIHEAI  345

Query  395   VRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMG  216
              RMDDEYLRSALDYLE QPDL  LVRG++ +  PNL I SW RLP+H +DFGWG P+ MG
Sbjct  346   ARMDDEYLRSALDYLELQPDLKALVRGAHTYRCPNLGITSWARLPIHEADFGWGRPIFMG  405

Query  215   PALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             P  I +EG  ++LPSP+ D SLS+A+ L  DH+ +F KL Y+ 
Sbjct  406   PGGIAFEGLSFVLPSPDNDGSLSVAISLQKDHLNVFHKLFYQL  448



>ref|XP_004507047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cicer 
arietinum]
Length=435

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/329 (51%), Positives = 237/329 (72%), Gaps = 6/329 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDDFGDF  +L+  +L+P VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG+S 
Sbjct  106   IDDFGDFASTLQHCQLIPVVDYSSGIRTYPLLVLQVTYFKCGGVSLGVGMHHHVADGISG  165

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
             LHFI TW+D+ARGL V++PPFIDRT+LRARDPP PAF+H EY  PP +K+ P ++   A 
Sbjct  166   LHFINTWSDVARGLDVSVPPFIDRTLLRARDPPRPAFEHIEYKPPPIMKTTPKNQDTEAT  225

Query  704   PSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              + ++ K+T +Q+A LK  S  +G     S++EILA H+WR VC+AR L DDQ TK  I 
Sbjct  226   AAVSIFKLTCKQIATLKAKSKEDGKTINFSSFEILAGHVWRSVCKARSLPDDQETKFSIP  285

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
              DGRSRL P LP G+LGNVIFT + +A +G+L+++P   +A +I +AL++ ++EYLRS++
Sbjct  286   IDGRSRLQPPLPQGYLGNVIFTISTIAITGDLMSKPTWYAASKIHNALLQANNEYLRSSI  345

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE Q DL  ++   +     N+ +NSW+RLP++++DFGWG P++MGP  I  +G  +I
Sbjct  346   DYLELQSDLGAVLGSIDALKRQNIFMNSWSRLPIYDADFGWGRPIYMGPCKIC-DGLSFI  404

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +PS   D SLS+A+ L  +HM +F++LLY
Sbjct  405   VPSSINDGSLSVAISLQHEHMEVFKELLY  433



>gb|KJB71577.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
 gb|KJB71579.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=436

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 224/331 (68%), Gaps = 8/331 (2%)
 Frame = -2

Query  1055  FGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHF  876
              GDFT + ++ +L+P VD S  ISS+PL L QVT+FKCGGV LG GI HTL DG +ALHF
Sbjct  106   IGDFTENHQVLRLVPKVDYSEGISSYPLILLQVTKFKCGGVCLGVGIQHTLGDGAAALHF  165

Query  875   IKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANPS-  699
             I +WAD +RGL+ AI PFIDRT+LRARDPP P   H EYD  P LKS   S+     PS 
Sbjct  166   INSWADTSRGLTPAIAPFIDRTLLRARDPPTPKLHHVEYDPSPALKSALKSQSDDHKPSI  225

Query  698   TAMLKITPQQLALLKT-------NSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              +  K+T  QL  LK        N   + S++ ILAAHIWRCV +ARGL  DQ TKLY  
Sbjct  226   VSTFKLTADQLNTLKAKANVANANGGIKYSSFNILAAHIWRCVSKARGLPADQDTKLYFP  285

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
              DGR RL P LPPG+ GNVIFT   +A++G L TE    + KRI   L +++DEYLRSA+
Sbjct  286   VDGRYRLDPPLPPGYFGNVIFTTALIAQAGNLETESFTDTIKRIHERLNQINDEYLRSAI  345

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DY+E  PDL+ LVRG + F  PNL +  W  LP++ +DFGWG P++MGP  ++ EG +Y+
Sbjct  346   DYIEKVPDLNTLVRGPHTFRCPNLVVVPWNWLPIYEADFGWGRPIYMGPGNVVQEGKIYV  405

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP  D SL+LA  L+  HM +F+KL+Y+F
Sbjct  406   LPSPTNDGSLTLAARLEIPHMKVFEKLIYEF  436



>ref|XP_011036967.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 229/341 (67%), Gaps = 14/341 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TID+ GDFTP +E+ + +P VD S +I S+PL L Q T FKCGGV LG G+ H L DG 
Sbjct  104   STIDELGDFTPHIEMLQFIPDVDRS-NIFSYPLLLLQATFFKCGGVCLGVGLHHILGDGT  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK---SGPLSK  720
             SA+HFI +W+ +ARGLS+  PPFIDRT+L AR PP PA  H EYD PP L    SG  + 
Sbjct  163   SAIHFINSWSVIARGLSLTTPPFIDRTLLDARVPPIPAMHHVEYDPPPPLNTHHSGDPTL  222

Query  719   LPGANPS---TAMLKITPQQLALLKTNSSHEG-------STYEILAAHIWRCVCEARGLS  570
                +NP      +L IT  QL  LK  S  +        ST+EILAAHIW+C C+ARG++
Sbjct  223   EIQSNPKPTCAKILTITSDQLRTLKNKSRKDVVDGTINYSTFEILAAHIWQCTCKARGIT  282

Query  569   DDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVR  390
             +DQ TKL+I TDGRSRL P LP G+ GNV+FT   +  SGE+ ++PL  +  +IR AL R
Sbjct  283   NDQATKLHIPTDGRSRLNPPLPAGYCGNVLFTTAILGLSGEIQSKPLVHTIAKIRGALKR  342

Query  389   MDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPA  210
             MD+EYLRSA+DYL+ Q DL  L RG   F SPNLNI SW  +P++++DFGWG P  MGPA
Sbjct  343   MDNEYLRSAIDYLQVQADLEALKRGPRTFKSPNLNIVSWMAMPIYDADFGWGRPYFMGPA  402

Query  209   LILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             ++ +EG  YI   P+ D SL +  CL+++HM LF++  Y F
Sbjct  403   IVGFEGMAYIARCPSNDGSLMIFTCLESNHMELFKEFFYDF  443



>ref|XP_009365251.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 233/333 (70%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +++FGDF P+ E RKL+P VD S  IS++PL + QVT FKCGGVSLG G+ H ++DG 
Sbjct  107   SVLENFGDFAPTPEFRKLIPVVDYSAGISTYPLFVVQVTYFKCGGVSLGVGLEHRVADGC  166

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+ TW+D+ARGL + IPPFIDRT+L ARDPP P F   EY   P LK  P     G
Sbjct  167   SGLHFVNTWSDIARGLDLTIPPFIDRTLLCARDPPQPTFDPVEYQPDPPLKIPPPCTKDG  226

Query  710   ANPST--AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
              + ST  ++ ++T +QL++LK  S  EG     STYE+LA H+WRC  +AR L DDQ TK
Sbjct  227   DSESTTVSIFRLTREQLSVLKAKSKEEGNTINYSTYEMLAGHVWRCASKARNLPDDQVTK  286

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L+IA DGRSRL P LP GF GNV+F   P+A  G+L ++P   +A RI   +VRM+++YL
Sbjct  287   LHIAVDGRSRLQPPLPIGFFGNVVFAGAPLATVGDLKSKPTWYAASRIHDIVVRMNNDYL  346

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE QPDLS LVRG++ F  P L I SW RLP++ +DFGWG P+ MGP  I YEG
Sbjct  347   RSALDYLEVQPDLSALVRGAHTFGCPKLGITSWVRLPIYEADFGWGGPMFMGPGGIGYEG  406

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPSP  D SLS+A+ L +DHM  F KLLY
Sbjct  407   LSFVLPSPTSDGSLSVAISLKSDHMESFAKLLY  439



>gb|KJB71596.1| hypothetical protein B456_011G132100 [Gossypium raimondii]
Length=437

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 223/331 (67%), Gaps = 8/331 (2%)
 Frame = -2

Query  1055  FGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHF  876
              GDFT + ++  L+P VD S  ISS+PL + QVT+FKCGGV LG GI HTL DG +ALHF
Sbjct  106   IGDFTENHQVLSLVPKVDYSEGISSYPLIVLQVTKFKCGGVCLGVGIQHTLGDGAAALHF  165

Query  875   IKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANPS-  699
             I +WAD +RGL+ AI PFIDRT+LRARDPP P   H EYD  P L S   S+     PS 
Sbjct  166   INSWADTSRGLTPAIAPFIDRTLLRARDPPTPKLHHVEYDPSPALMSASKSQSDDHKPSI  225

Query  698   TAMLKITPQQLALLKT-------NSSHEGSTYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
              + L++T  QL  LK        N   + S++ ILAAHIWRCV +ARGL  DQ TKLY  
Sbjct  226   VSTLELTADQLNTLKAKAKVANANGGVKYSSFNILAAHIWRCVSKARGLPADQDTKLYFP  285

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
              DGR RL P LPPG+ GNVIFT   +A++G+L TE    + KRI   L +++DEYLRSA+
Sbjct  286   VDGRYRLDPPLPPGYFGNVIFTTALIAQAGDLETESFTDTIKRIHERLNQINDEYLRSAI  345

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DY+E  PDL+ LVRG + F  PNL +  W  LP++ +DFGWG P++MGP  ++ EG +YI
Sbjct  346   DYIEKVPDLNTLVRGPHTFRCPNLVVVPWNWLPIYEADFGWGCPIYMGPGNVVQEGKIYI  405

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             LPSP  D SLSLA  L+  HM  F+KLLY+F
Sbjct  406   LPSPVNDGSLSLATRLETPHMKAFEKLLYEF  436



>ref|XP_007011894.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
 gb|EOY29513.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
Length=543

 Score =   356 bits (914),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 223/319 (70%), Gaps = 10/319 (3%)
 Frame = -2

Query  1067  TIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             TIDD GDF P  +L +L+P+VD SGDISSFPL L QVT FK GGV LG    HTL D  S
Sbjct  101   TIDDLGDFAPRSKLGQLVPTVDYSGDISSFPLVLLQVTSFKHGGVCLGAAFQHTLVDARS  160

Query  887   ALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGA  708
              ++F+K+W+++ RGL + + PFIDRT+LRAR PP PAF H EYD  P L +   +    A
Sbjct  161   VIYFMKSWSNITRGLPINVTPFIDRTLLRARVPPAPAFHHVEYDPSPPLNTSISTPNCQA  220

Query  707   NP---STAMLKITPQQLALLKTNSSHEG-------STYEILAAHIWRCVCEARGLSDDQT  558
              P   ST++ KIT  QL  L++ ++  G       +TY +L AH+WRCVC+ARGLSDDQ 
Sbjct  221   GPKPSSTSIFKITADQLKTLESKATMNGNTTRANRTTYHVLTAHLWRCVCKARGLSDDQV  280

Query  557   TKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDE  378
             TKLYI  DGRS+L P +PPG+LGNVIF A   A SG L +EP A + +RI   + RMDD+
Sbjct  281   TKLYIPIDGRSKLHPPIPPGYLGNVIFIAATTALSGVLQSEPFADTIQRINRTVKRMDDK  340

Query  377   YLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILY  198
             Y+RSAL+Y+E  PD+  LVRG++ F SPNLNIN W RLPV+ +DFGWG P+H+G A ++ 
Sbjct  341   YMRSALEYIESVPDMETLVRGAHTFQSPNLNINGWMRLPVYAADFGWGRPMHVGLANVID  400

Query  197   EGTVYILPSPNKDRSLSLA  141
             EG +YI+PSP  D SLSL 
Sbjct  401   EGQIYIIPSPVDDGSLSLV  419



>ref|XP_011036823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 229/341 (67%), Gaps = 14/341 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TID+ GDFTP  E+ + +P VD S  I S+PL L Q T FKCGGV LG G+ H L DG 
Sbjct  104   STIDEVGDFTPHSEMLQFIPEVDRSS-IFSYPLLLAQATFFKCGGVCLGVGLHHILGDGT  162

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLK---SGPLSK  720
             SA+HFI +W+++ARGLS+  PPFIDRT+L AR PP PA  H EYD PPTL    SG  + 
Sbjct  163   SAIHFINSWSEIARGLSLTTPPFIDRTLLDARVPPIPAMHHVEYDPPPTLNTHNSGDQTL  222

Query  719   LPGANPS---TAMLKITPQQLALLKTNSSHEG-------STYEILAAHIWRCVCEARGLS  570
                +NP      +L IT  QL  LK  S  +        ST+E LAAHIW+C C+ARG++
Sbjct  223   EIQSNPKPTCAKILIITSDQLRTLKNKSRKDVVDGTINYSTFETLAAHIWQCTCKARGIT  282

Query  569   DDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVR  390
             +DQ TKL+I TDGRSRL P LP G+ GN +FT   +  SGE+ ++PL  +  +IR AL R
Sbjct  283   NDQATKLHIPTDGRSRLNPPLPAGYCGNALFTTAILGLSGEIQSKPLVHTIAKIRGALKR  342

Query  389   MDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPA  210
             MD+EYLRSA+DY + Q DL  L RG + F +PN+NI SW  +P++++DFGWG P  MGPA
Sbjct  343   MDNEYLRSAIDYSQVQTDLEALKRGPHTFNNPNINIVSWMTMPIYDADFGWGRPSFMGPA  402

Query  209   LILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             ++L+EG  YI  SP+ D S  + +CL+++HM LF++  Y F
Sbjct  403   VVLFEGMAYITRSPSNDGSFMVFICLESNHMELFKEFFYDF  443



>gb|EAZ23787.1| hypothetical protein OsJ_07497 [Oryza sativa Japonica Group]
Length=463

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 237/359 (66%), Gaps = 32/359 (9%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQV---------------------T  954
             AT+DDFGDF P+++L++L+P+VD +  ISSFP+ + QV                     T
Sbjct  106   ATVDDFGDFAPTMDLKRLIPTVDYTDGISSFPILVLQVLQLYIFCLGSIYDPIIEFRQVT  165

Query  953   RFKCGGVSLGTGIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAF  774
              FKCGGV+LG G+ H ++DG S LHFI +WADL RG+ +A+ PFIDRT++RARDPP P+ 
Sbjct  166   HFKCGGVALGVGMQHHVADGFSGLHFINSWADLCRGVPIAVMPFIDRTLVRARDPPAPSH  225

Query  773   KHTEYDHPPTLKS----GPLSKLPGANPSTA-MLKITPQQLALLKTN-SSHEG----STY  624
              H EY   P + +      L+  P   P+   + K++   L  L++     EG    STY
Sbjct  226   PHVEYQPAPAMLAPEPPQALTAKPAPPPTAVDIFKLSRSDLGRLRSQLPRGEGAPRYSTY  285

Query  623   EILAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGEL  444
              +LAAH+WRC   ARGL  +Q TKLY ATDGR RL P+LP G+ GNVIFTATP+AE+G +
Sbjct  286   AVLAAHVWRCASLARGLPAEQPTKLYCATDGRQRLQPSLPDGYFGNVIFTATPLAEAGRV  345

Query  443   LTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRL  264
              T  LA  A  I+SAL RMD  Y RSALDYLE QPDLS LVRG++ F  PNL + SW RL
Sbjct  346   -TGSLADGAATIQSALDRMDSGYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRL  404

Query  263   PVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             P+H++DFGWG PV MGP  I YEG  ++LPS + D SLS+A+ L A+HM  F+K+++ F
Sbjct  405   PIHDADFGWGRPVFMGPGGIAYEGLAFVLPSASGDGSLSVAISLQAEHMEKFRKMIFDF  463



>emb|CAD88491.1| hydroxycinnamoyl-CoA hydroxycinnamoyltransferase [Nicotiana benthamiana]
Length=319

 Score =   346 bits (887),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 209/286 (73%), Gaps = 8/286 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
               +DDFGDF P+LELR+L+P+VD S  I S+ L + Q+T FKCGGVSLG G+ H  +DG 
Sbjct  34    GVVDDFGDFAPTLELRQLIPAVDYSQGIQSYALLVLQITHFKCGGVSLGVGMQHHAADGA  93

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKL-P  714
             S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP P F H EY  PPTLK  P +   P
Sbjct  94    SGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPQFPHVEYQPPPTLKVTPENTTNP  153

Query  713   GANPSTA--MLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSDDQTT  555
                P T+  + K+T  Q+  LK  S  +G+T     YE+LA H+WR  C ARGL+ DQ T
Sbjct  154   EIVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGLAHDQET  213

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYIATDGRSRL P+LPPG+ GNVIFT TP+A +G++ ++P+  +A ++  AL RMD++Y
Sbjct  214   KLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKLHDALARMDNDY  273

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGW  237
             LRSALDYLE QPDL  LVRG++ F  PNL I SW+RLP+H++DFGW
Sbjct  274   LRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGW  319



>gb|KJB54948.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/338 (53%), Positives = 231/338 (68%), Gaps = 15/338 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD   FTPS ELRKL+P+VD SGDISS+PL + QVT FKCGGV LG    HTL+DG 
Sbjct  100   SAMDDLEGFTPSSELRKLVPTVDYSGDISSYPLVMAQVTTFKCGGVCLGIATHHTLTDGT  159

Query  890   SALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS----GPL  726
             +ALHFI +W++LAR L  +++PP IDRT+LRAR PP P F H EYD PP+L +    GP 
Sbjct  160   TALHFINSWSELARALPQISMPPLIDRTLLRARAPPIPRFHHLEYDPPPSLNTCMSLGPN  219

Query  725   SKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQ  561
             +  P    + ++ KIT  QL  LK  SS  G     STY ILAA+IWRC  +ARGLS DQ
Sbjct  220   NHKPS---TVSVFKITQNQLNTLKAKSSEHGNKTNYSTYTILAAYIWRCATKARGLSYDQ  276

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKL + T+GR RL P LP  +LGNVIF A+ +A SG L +EP  ++  R+  AL RMD+
Sbjct  277   PTKLLMPTNGRPRLHPPLPSSYLGNVIFMASSIALSGNLQSEPFVNTLGRVHGALARMDN  336

Query  380   EYLRSALDYLECQPDLSKLVRGS-NYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALI  204
             EYLRSA+DYLE  PD+ K  RG    +  P+L IN W+RLP+H++DFGWG P++ GP  +
Sbjct  337   EYLRSAIDYLETLPDI-KAARGKPETYQCPSLFINKWSRLPLHDADFGWGRPLYAGPPNV  395

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             + EG ++++PSP  D SLSL  CL   HM  F++ LY+
Sbjct  396   VSEGQIFLVPSPTDDGSLSLVACLQTPHMKPFEEQLYQ  433



>gb|KHN22398.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=540

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 228/344 (66%), Gaps = 28/344 (8%)
 Frame = -2

Query  1052  GDFTPSLELRKLLPSVDTSGDISSFPLA------------LFQVTRFKCGGVSLGTGIFH  909
             GD  PS     +L   +  G IS F L+              QVT FKCGGVSLG G+ H
Sbjct  199   GDIKPS----NVLIDSEWRGKISDFGLSRIKVEEIINLSTCVQVTYFKCGGVSLGVGMQH  254

Query  908   TLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGP  729
              ++DG S LHFI  W+D+ARGL +++PPFIDRT+LRARDPP P F H EY  PP +K+  
Sbjct  255   HVADGASGLHFINAWSDVARGLDISLPPFIDRTLLRARDPPHPVFDHIEYKPPPAMKTPL  314

Query  728   LSKLPGANP-------STAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCE  585
               +L  + P       + + +K+T  QL+ LK  S  +G     S+YE+LA H+WR VC+
Sbjct  315   QQQLQSSKPVGSDSAVAVSTVKLTRDQLSTLKGKSREDGNRISYSSYEMLAGHVWRSVCK  374

Query  584   ARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIR  405
             AR L DDQ TKLYIATDGR+RL P L PG+ GNVIFT TP+A +G+L+++P   +A RI 
Sbjct  375   ARALPDDQETKLYIATDGRARLQPPLTPGYFGNVIFTTTPIAVAGDLMSKPTWFAASRIH  434

Query  404   SALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPV  225
              AL+RMD+EYLRSALDYLE QPDL  LVRG++ F  PNL I SW RLP+H++DFGWG P+
Sbjct  435   DALIRMDNEYLRSALDYLELQPDLKVLVRGAHTFRCPNLGITSWARLPIHDADFGWGRPI  494

Query  224   HMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              MGP  I YEG  +I+PS   D S+S+A+ L  + M +FQ+L Y
Sbjct  495   FMGPGGIAYEGLSFIIPSSTNDGSMSVAIALPPEQMKVFQELFY  538



>gb|EPS67739.1| hypothetical protein M569_07035, partial [Genlisea aurea]
Length=428

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 225/332 (68%), Gaps = 12/332 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDT-SGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
               +DD  DFT + E  +L+P+VD  S DIS+ P+ + QVT FKCGGVS+G G  H ++DG
Sbjct  101   GVVDDLCDFTATSEFHRLVPNVDYFSEDISASPILVSQVTYFKCGGVSVGVGTDHRVADG  160

Query  893   LSALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKL  717
              + LH + TW+D ARG  + +IPPF+DRT+LRARD P P F H EY  PP +KS      
Sbjct  161   FAGLHLVNTWSDFARGCHATSIPPFLDRTLLRARDHPNPKFPHVEYLPPPQMKSA-----  215

Query  716   PGANPST--AMLKITPQQLALLKTNSSHEG-STYEILAAHIWRCVCEARGLSDDQTTKLY  546
               A P T  A+ K+T +Q+A LK        STY ILAAHIWRC C AR L +DQ T+L 
Sbjct  216   -AAAPETVEAIFKLTRKQIASLKAQHGDNTLSTYVILAAHIWRCACSARALPEDQETQLD  274

Query  545   IATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRS  366
             IA +GRSRL P LPP + GN IFTATP++ +G++  +PL  SA +I+ AL RMDDEYLRS
Sbjct  275   IAVNGRSRLRPPLPPAYFGNAIFTATPLSVAGDVTGKPLRHSAAKIQEALWRMDDEYLRS  334

Query  365   ALDYLECQP-DLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             ALDYLE +  +L  LVRG   F  PNL I SW RLPVH +DFGWG PV MGPA I YEG 
Sbjct  335   ALDYLELRRLELKGLVRGRESFRCPNLGIVSWIRLPVHEADFGWGKPVFMGPAGIGYEGL  394

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
              Y++PSP  D SLS+A+CL  DH+  F+K LY
Sbjct  395   CYVIPSPADDGSLSVAICLLEDHVEAFRKSLY  426



>ref|XP_006826688.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Amborella 
trichopoda]
 gb|ERM93925.1| hypothetical protein AMTR_s00137p00072760 [Amborella trichopoda]
Length=455

 Score =   346 bits (888),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/329 (51%), Positives = 218/329 (66%), Gaps = 7/329 (2%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDDFGDF P++EL++L P VD + DISSFPL L QVT FKCGGVSL   +   + DG S 
Sbjct  123   IDDFGDFAPTMELKRLAPKVDYTEDISSFPLVLIQVTFFKCGGVSLCVSVQRHVVDGAST  182

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
              HFI TW+D+ RG+ V  PPFIDRT+LRAR PP PAF H E+   PT+K+         +
Sbjct  183   NHFINTWSDITRGVGVIRPPFIDRTLLRARVPPNPAFPHVEFQEAPTMKTRIAEA--HVS  240

Query  704   PSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIA  540
             P  A+  ITP  L  LK  +  +G     +TYE+LA H+WRCVC+AR L  DQ TK+YIA
Sbjct  241   PVVAIFDITPTWLDRLKRKAQEDGGTASYTTYEVLAGHVWRCVCQARNLQSDQPTKMYIA  300

Query  539   TDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSAL  360
              + RSRL P LPP + GN +F A P+  SG+L+++PL  +A++I  A+VRMD+EYLRSAL
Sbjct  301   ANCRSRLQPPLPPEYFGNAVFAAAPLVMSGDLMSKPLKFAAEKIHEAIVRMDNEYLRSAL  360

Query  359   DYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYI  180
             DYLE  PD   + RG++ F  PN+ + SW + P + +DFGWG PV MGPA + +EG  ++
Sbjct  361   DYLELLPDPDAVKRGAHTFECPNIGVISWAKQPSYEADFGWGRPVFMGPAGMAHEGQAFV  420

Query  179   LPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             L SP  D  L LA+ L  D M  F++  Y
Sbjct  421   LRSPKGDSYLCLAISLHEDCMRRFRQYFY  449



>gb|KJB68257.1| hypothetical protein B456_010G234800 [Gossypium raimondii]
Length=417

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 224/334 (67%), Gaps = 7/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD   FTP  +LRKL+P+ D SGDISS+PL + QVT  KCGGV LG    HTL+DG 
Sbjct  72    SAMDDLDGFTPCSKLRKLVPTADYSGDISSYPLIMAQVTTLKCGGVCLGIATHHTLTDGT  131

Query  890   SALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
               LHFI +W+++ARGL  +++PP IDRT+LRAR PP P F H EYD PP+L +       
Sbjct  132   MTLHFINSWSEMARGLPQISMPPVIDRTLLRARVPPIPRFHHLEYDRPPSLYTSTSLGPN  191

Query  713   GANPSTA-MLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                PST  + KIT  QL  LK  S   G     STY IL A+IWRC  +A  LS DQ TK
Sbjct  192   NHKPSTVYVFKITQNQLNTLKAKSWEHGNKTNYSTYTILVAYIWRCATKAWDLSYDQPTK  251

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L++ TDGR RL P LP  +LGN +F A+ +A SG L +EP  ++ +R+   L RM++EYL
Sbjct  252   LHMPTDGRPRLHPPLPSTYLGNAMFAASLIALSGNLQSEPFVNTLERVHGTLQRMNNEYL  311

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE  PD++   R  + +  PNL+IN WTRL ++++DFGWG P++MGPA +++EG
Sbjct  312   RSALDYLETLPDITVARRTPDTYHCPNLSINKWTRLSLYDADFGWGRPIYMGPANVVHEG  371

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
              +YILPSP  D SLSL  CL   HM LF+K LY+
Sbjct  372   KIYILPSPTNDGSLSLVACLQTAHMKLFEKHLYE  405



>gb|KJB68253.1| hypothetical protein B456_010G234500 [Gossypium raimondii]
Length=445

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/334 (51%), Positives = 226/334 (68%), Gaps = 7/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD   FTP  +LRKL+P+ D SGDISS+PL + QVT  KCGGV LG    HTL+DG 
Sbjct  100   SAMDDLDGFTPCSKLRKLVPTADYSGDISSYPLIMAQVTTLKCGGVCLGIATHHTLTDGT  159

Query  890   SALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
             +A HFI +W+++ARGL S+++PP IDRT+LRAR PP P F H EYD PP+L +       
Sbjct  160   TAFHFINSWSEMARGLPSISMPPLIDRTLLRARVPPTPRFHHLEYDPPPSLNTSTSLGHN  219

Query  713   GANPS-TAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                PS  ++ KIT  QL  LK  S   G     ST+ ILAA+IWRC  +ARGLS DQ TK
Sbjct  220   NHKPSIVSVFKITQNQLNTLKAKSWEHGNKTNYSTFTILAAYIWRCATKARGLSYDQPTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L +  +GR RL P LP  ++GN +F A+ +A SG L +E   ++ +R+   L RM++EYL
Sbjct  280   LNMPINGRPRLHPPLPSTYVGNAVFAASLIALSGNLQSESFVNTLERVYGTLKRMNNEYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE  PD++ + R  + +  PNLNIN WTRL ++++DFGWG P++MGPA +++EG
Sbjct  340   RSALDYLETLPDITAVRRKPDTYQCPNLNINKWTRLSIYDADFGWGRPIYMGPANVVHEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
              +YIL SP  D SLSL  CL   HM LF+K LY+
Sbjct  400   KIYILSSPTDDGSLSLVACLQTAHMKLFEKHLYE  433



>ref|XP_008228829.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=443

 Score =   345 bits (885),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 173/338 (51%), Positives = 227/338 (67%), Gaps = 14/338 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + IDDFGDF P+ +   L+P++D SG ISS+P+ + Q+T FKCGGVSLG G+ H ++DG+
Sbjct  106   SAIDDFGDFAPTPDFLTLIPTIDYSGGISSYPILVLQITYFKCGGVSLGVGMEHRVADGV  165

Query  890   SALHFIKTWADLARG-LSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
             S LHF+ TW+D+ARG LS   PPF+DRT+LRARDPP PAF H EY   P +K  P   L 
Sbjct  166   SGLHFVNTWSDIARGDLSNIKPPFMDRTLLRARDPPQPAFPHIEYQPSPQMK--PSDNLK  223

Query  713   G-ANPSTAMLKITPQQLALLKTNSSHEG---------STYEILAAHIWRCVCEARGLSDD  564
               +N +T++ K+T +QL +L   S  +G         S++E+LA HIWRC C+AR L DD
Sbjct  224   STSNITTSIFKLTRKQLNILIDKSKEDGGNNINTINYSSFEMLAGHIWRCACKARKLQDD  283

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q TKL IATD RSRL P LPP F GN +F  TP+A +G+L ++P   +   +  ALVRMD
Sbjct  284   QDTKLLIATDARSRLQPPLPPHFFGNAVFRTTPIAVAGDLQSKPTWYATSFVHDALVRMD  343

Query  383   DEYLRSALDYLEC-QPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
             D+Y RS LDYLE   P LS+L+ G      PNL INSW RLP+H++DFGWG P+ MGP  
Sbjct  344   DDYFRSVLDYLELHHPCLSELITGPLSICCPNLRINSWARLPIHDADFGWGRPIFMGPGA  403

Query  206   ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             I ++G  ++LPS   D SLSL + L ++ M  F  LLY
Sbjct  404   IPFDGMSFLLPSATNDGSLSLVISLKSEDMKSFSTLLY  441



>gb|KJB68256.1| hypothetical protein B456_010G234800 [Gossypium raimondii]
Length=445

 Score =   345 bits (885),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 224/334 (67%), Gaps = 7/334 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD   FTP  +LRKL+P+ D SGDISS+PL + QVT  KCGGV LG    HTL+DG 
Sbjct  100   SAMDDLDGFTPCSKLRKLVPTADYSGDISSYPLIMAQVTTLKCGGVCLGIATHHTLTDGT  159

Query  890   SALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
               LHFI +W+++ARGL  +++PP IDRT+LRAR PP P F H EYD PP+L +       
Sbjct  160   MTLHFINSWSEMARGLPQISMPPVIDRTLLRARVPPIPRFHHLEYDRPPSLYTSTSLGPN  219

Query  713   GANPSTA-MLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                PST  + KIT  QL  LK  S   G     STY IL A+IWRC  +A  LS DQ TK
Sbjct  220   NHKPSTVYVFKITQNQLNTLKAKSWEHGNKTNYSTYTILVAYIWRCATKAWDLSYDQPTK  279

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L++ TDGR RL P LP  +LGN +F A+ +A SG L +EP  ++ +R+   L RM++EYL
Sbjct  280   LHMPTDGRPRLHPPLPSTYLGNAMFAASLIALSGNLQSEPFVNTLERVHGTLQRMNNEYL  339

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE  PD++   R  + +  PNL+IN WTRL ++++DFGWG P++MGPA +++EG
Sbjct  340   RSALDYLETLPDITVARRTPDTYHCPNLSINKWTRLSLYDADFGWGRPIYMGPANVVHEG  399

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
              +YILPSP  D SLSL  CL   HM LF+K LY+
Sbjct  400   KIYILPSPTNDGSLSLVACLQTAHMKLFEKHLYE  433



>ref|XP_007156887.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
 gb|ESW28881.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
Length=424

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/324 (51%), Positives = 224/324 (69%), Gaps = 10/324 (3%)
 Frame = -2

Query  1049  DFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHFIK  870
              FT +   R L+P+VD S  I ++PL + QVT F+CGGVSLG GI H L+DG S LHFI 
Sbjct  104   QFTHNFHNRNLIPAVDYSAGIETYPLVVLQVTHFRCGGVSLGVGIEHRLADGASGLHFIN  163

Query  869   TWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANPSTAM  690
             +W+D+ARG+ +++PPFIDR +LRARD P PAF H EY   P     P++         ++
Sbjct  164   SWSDVARGIPISVPPFIDRNLLRARDQPQPAFPHHEYQLSP-----PITTTTNTTAVASI  218

Query  689   LKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTKLYIATDGRS  525
              K++ +QL +LK  S  +G     STYE+LAAHIWRC+ +ARGL +DQ T+LYI T+GRS
Sbjct  219   FKLSREQLNILKGKSKEDGNTVNFSTYEMLAAHIWRCLSKARGLPEDQETRLYIPTNGRS  278

Query  524   RLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLEC  345
             RL P LPPG+LGN IF+  P A +G+L+++P   +A +I +AL RMD+EY+RSALDYL+ 
Sbjct  279   RLQPPLPPGYLGNAIFSTIPKAFAGDLVSKPTWYAANKIHNALARMDNEYMRSALDYLQL  338

Query  344   QPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPN  165
             QPDL+ L+  ++    PN+ INSW + P++++DFGWG P+ M PA I++EG   ILPSP 
Sbjct  339   QPDLNSLLPIAHTSRYPNVRINSWAKFPIYDADFGWGRPIFMRPAWIVHEGQSMILPSPT  398

Query  164   KDRSLSLAVCLDADHMPLFQKLLY  93
              D +L L + L   HM LFQ+ LY
Sbjct  399   NDGNLYLVINLPPHHMKLFQEFLY  422



>gb|EMT08585.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=445

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 233/351 (66%), Gaps = 27/351 (8%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQ--------------VTRFKCGGV  933
             AT+ D+GDF P++EL++L+P+VD + +IS FPL L Q              VT FKCGGV
Sbjct  95    ATVADYGDFAPTMELKRLIPAVDYTEEIS-FPLVLLQKLMQLVSLNAHRQKVTYFKCGGV  153

Query  932   SLGTGIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDH  753
             SLG    H ++DG+S LHFI +W++L RG  +A+ PFIDRT++RARDPP P + H EY  
Sbjct  154   SLGVATQHHVADGMSGLHFINSWSNLCRGAQIAVMPFIDRTLIRARDPPTPFYPHVEYHP  213

Query  752   PPTLKSGPLSKLPG----ANPSTA--MLKITPQQLALLKT-----NSSHEGSTYEILAAH  606
              P + S     LP      +P TA  + K+T   +  L++     +     STY +L+AH
Sbjct  214   SPAMLSSKPQDLPSNSKRTSPDTAVDIFKLTSSDIGRLRSQLPTGDDMPRLSTYTLLSAH  273

Query  605   IWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLA  426
             +WRCV  +RGL  DQ TKLY A DGR RL P LP GFLGNV+FTATP+ E+G++ T  LA
Sbjct  274   VWRCVSLSRGLPSDQPTKLYCAIDGRKRLKPPLPDGFLGNVLFTATPIVEAGKV-TRGLA  332

Query  425   SSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSD  246
              +AK I+  L RM+D+Y RSALDYLE QPDLS LVRG+  +  PNL I SW  LPVHN+D
Sbjct  333   DAAKIIQMELDRMNDDYCRSALDYLELQPDLSALVRGAQTYRCPNLGITSWVNLPVHNAD  392

Query  245   FGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             FGWG P+ MGP  + +EG  Y+LPS + D SLS+A+ L ADHM  F++L++
Sbjct  393   FGWGRPMFMGPGGVAFEGLAYVLPSAHNDGSLSIAISLQADHMKKFRQLIF  443



>gb|KJB68255.1| hypothetical protein B456_010G234700, partial [Gossypium raimondii]
Length=463

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/337 (51%), Positives = 231/337 (69%), Gaps = 13/337 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DD   FTP  +LRKL+P+ D SGDISS+PL + QVT  KCGGV LG    HTL+DG 
Sbjct  118   SAMDDLDGFTPCSKLRKLVPTADYSGDISSYPLIMAQVTTLKCGGVCLGIATHHTLTDGT  177

Query  890   SALHFIKTWADLARGL-SVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS----GPL  726
             +ALHFI +W+++ARGL  +++PP IDRT+LRAR PP P F H EYD PP+L +    GP 
Sbjct  178   TALHFINSWSEMARGLPEISMPPLIDRTLLRARVPPIPRFHHLEYDRPPSLYTSTSLGPN  237

Query  725   SKLPGANPSTAMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQ  561
             +  P    + ++ KIT  QL  LK  S   G     ST+ ILAA+IWRC  +A GLS DQ
Sbjct  238   NHKPL---TVSVFKITQNQLNTLKAKSWEHGNKTNCSTFTILAAYIWRCATKAWGLSYDQ  294

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
              TKL++ T+GR RL P LP  +LGN +F A+ +A SG L ++P  ++ +R+   L RM++
Sbjct  295   PTKLHMPTNGRPRLHPPLPSTYLGNAMFAASLIALSGNLQSKPFVNTLERVHGTLQRMNN  354

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYLRSALDYLE  PD++   R  + +  PNL+IN WTRL ++++DFGWG P++MGPA ++
Sbjct  355   EYLRSALDYLETLPDITVARRTPDTYHCPNLSINKWTRLSLYDADFGWGRPIYMGPANVV  414

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             +EG +YILPSP  D SLSL  CL   HM LF+K LY+
Sbjct  415   HEGKIYILPSPTDDGSLSLVACLQTAHMKLFEKHLYE  451



>ref|XP_002529412.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF33008.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=404

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/335 (51%), Positives = 230/335 (69%), Gaps = 11/335 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +++DD GD   +L++ +L+P++D S  ISSFPL + Q T F CGGVSLG    H L+DG 
Sbjct  74    SSMDDLGDVMVNLKIPQLIPTLDFSNGISSFPLFVVQATTFTCGGVSLGIRFHHVLADGS  133

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             +AL+FI TW D+ARGLS+ + P IDRTILR++DPP P F+H E+  P TL +   +    
Sbjct  134   AALYFINTWCDVARGLSINVSPMIDRTILRSQDPPNPKFQHLEFGKPLTLNT---NSTKN  190

Query  710   ANPSTAMLKITPQQLALLKT---NSSHEG----STYEILAAHIWRCVCEARGLSDDQTTK  552
                S  +LK TP QL  LKT   ++S +G    S+YEIL AHIWRC C AR L+DDQ TK
Sbjct  191   QTNSIEILKFTPDQLNTLKTKVNSNSKDGRTKYSSYEILTAHIWRCTCRARNLADDQATK  250

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             LYI+ DGRSRL P LP  + GNV F  T +A  G+LL+EPL ++A+RIR A+ RMDDEYL
Sbjct  251   LYISVDGRSRLQPQLPHSYFGNVTFPTTSIALCGDLLSEPLMATAERIRKAIRRMDDEYL  310

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSA+DYL+   DL+ ++RG +    PNL+I SW  LP + +DFG G P+++ PA  L EG
Sbjct  311   RSAVDYLQVLDDLTPVMRGPDACRCPNLHIISWMWLPFYEADFGMGKPIYVRPANPL-EG  369

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               Y++P+P  DR+ +L++CL+ DHM  FQKL Y F
Sbjct  370   KGYVIPTPGDDRNWALSICLETDHMHSFQKLFYDF  404



>ref|XP_007216058.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
 gb|EMJ17257.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
Length=443

 Score =   343 bits (879),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/338 (51%), Positives = 226/338 (67%), Gaps = 14/338 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +DDFGDF P+ +   L+P++D SG ISS+P+   Q+T FKCGGVSLG G+ H ++DG+
Sbjct  106   SAVDDFGDFAPTPDFLTLIPTIDYSGGISSYPILALQITYFKCGGVSLGVGMDHRVADGV  165

Query  890   SALHFIKTWADLARG-LSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
             S LHF+  W+D+ARG LS   PPF+DRT+LRARDPP PAF H EY   P +K  P   L 
Sbjct  166   SGLHFVNAWSDIARGDLSNIKPPFMDRTLLRARDPPQPAFPHIEYQPSPQMK--PSDNLK  223

Query  713   G-ANPSTAMLKITPQQLALLKTNSSHEG---------STYEILAAHIWRCVCEARGLSDD  564
               +N +T++ K+T +QL +LK  S  +G         S++E+LA HIWRC C+AR L DD
Sbjct  224   STSNITTSIFKLTRKQLNILKDKSKKDGGNNINTINYSSFEMLAGHIWRCACKARKLPDD  283

Query  563   QTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMD  384
             Q TKL IATD RSRL P LPP F GN +F  TP+A +G+L ++P   +   +  ALVRMD
Sbjct  284   QDTKLLIATDARSRLQPPLPPYFFGNAVFRTTPIAVAGDLQSKPTWYATSFVHDALVRMD  343

Query  383   DEYLRSALDYLEC-QPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
             D+Y RS LDYLE   P LS+L+ G      PNL INSW R+P+H++DFGWG P+ MGP  
Sbjct  344   DDYFRSVLDYLELHHPCLSELITGPPSICCPNLRINSWARMPIHDADFGWGRPIFMGPGA  403

Query  206   ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             I ++G  ++LPS   D SLSL + L ++ M  F  LLY
Sbjct  404   IPFDGMSFLLPSATNDGSLSLVISLKSEDMKSFSTLLY  441



>gb|EYU21745.1| hypothetical protein MIMGU_mgv1a006579mg [Erythranthe guttata]
Length=438

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 236/338 (70%), Gaps = 18/338 (5%)
 Frame = -2

Query  1064  IDDFGD-FTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLS  888
             +DDFG+ F+P+ ELR L+P+VD S DIS++PL + QVT FKCGGVSLG GI H + DGLS
Sbjct  103   LDDFGEYFSPTSELRCLVPAVDYSLDISAYPLLVLQVTHFKCGGVSLGVGIQHHVVDGLS  162

Query  887   ALHFIKTWADLARGLSV-AIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
              +HF+ TW+D+ARG    A+PP IDR ILRAR+PP   F+H EY +PPT  S    +   
Sbjct  163   GIHFMNTWSDMARGHGAPALPPSIDRNILRARNPPRSEFEHIEYHYPPTPASSDEDR--S  220

Query  710   ANPSTAMLKITPQQLALLKT-------NSSHEGSTYEILAAHIWRCVCEARGLSDDQTTK  552
                + ++LK++  QL  LK+       NSS+  ++YE++AAHIWRC   AR L+ +Q TK
Sbjct  221   TTTAVSVLKLSNNQLNSLKSKFKSPDGNSSY--TSYEMVAAHIWRCATTARRLAPEQETK  278

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             +YIATDGRSRL P  PPG+ GNV+FTA PVA SG++  +P+  +A +IR AL RMDDEY+
Sbjct  279   VYIATDGRSRLLPPPPPGYFGNVVFTAAPVAASGDIRAQPVGYAAGKIRDALARMDDEYM  338

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYLE Q D+  LVRG + F  PN+ I SW R+P + +DFGWG PV++GP ++ YEG
Sbjct  339   RSALDYLELQDDVKALVRGPHTFRCPNMGITSWVRMPAYVADFGWGGPVYVGPGMVAYEG  398

Query  191   TVYILPSP---NKD--RSLSLAVCLDADHMPLFQKLLY  93
               Y+LP P   NKD    L + + L  +HM +F++LLY
Sbjct  399   LCYLLPPPRSANKDGGGGLLVVISLQKEHMEMFEELLY  436



>ref|XP_007214866.1| hypothetical protein PRUPE_ppa019948mg [Prunus persica]
 gb|EMJ16065.1| hypothetical protein PRUPE_ppa019948mg [Prunus persica]
Length=449

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 230/340 (68%), Gaps = 14/340 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +T+DDFGDF PS     L+P +D +  IS++P+ + QVT FKCGGVSLG  I H ++DG+
Sbjct  108   STVDDFGDFAPSPNFLPLIPPIDYAAGISAYPILVLQVTYFKCGGVSLGVAIEHRIADGV  167

Query  890   SALHFIKTWADLARG-LSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
             SALHF+ TW+ +ARG LS   PPF+DRT+LRARDPP P F HTEY   P +KS     L 
Sbjct  168   SALHFVNTWSRIARGDLSNIKPPFMDRTLLRARDPPEPEFPHTEYHPFPEMKSVSNEHLQ  227

Query  713   G-ANPSTAMLKITPQQLALLKTNSSHEG----------STYEILAAHIWRCVCEARGLSD  567
               +N +T++ + T +QL+LLK  S  +G          +T+E+LA HIWRCVC+AR L D
Sbjct  228   TTSNITTSLFRFTQEQLSLLKAKSKEKGDGQNTSTTNYTTFEMLACHIWRCVCKARKLPD  287

Query  566   DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRM  387
             DQ TKL+I  DGR+RL P LPPGF GNV+F  TP+A +G+L ++P   +A  + SALVR 
Sbjct  288   DQDTKLFIPIDGRNRLRPPLPPGFFGNVLFRTTPIAAAGDLQSKPTWYAASCVHSALVRR  347

Query  386   DDEYLRSALDYLECQ-PDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPA  210
             DD+YLRS LDYLE   P   KLV G      PNL+INSW +LP+H++DFGWG P+ MGP 
Sbjct  348   DDDYLRSVLDYLELHLPCNQKLVTGVPTIQCPNLSINSWIKLPIHDADFGWGRPIFMGPG  407

Query  209   L-ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
                + +G   +LPS   D S+S+ + L ++HM LF KLLY
Sbjct  408   RPFVLDGRCMLLPSTTNDGSISIILGLQSEHMKLFSKLLY  447



>ref|XP_003629304.1| Hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Medicago 
truncatula]
 gb|AET03780.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=420

 Score =   339 bits (870),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 226/334 (68%), Gaps = 18/334 (5%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDDFGDF P+L L +L+P VD S  I ++PL + QVT FKCGGVSLG G+ H ++DG SA
Sbjct  93    IDDFGDFAPTLHLGQLIPIVDYSRGIETYPLLVLQVTYFKCGGVSLGVGMHHYVADGASA  152

Query  884   LHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGAN  705
              HFI TW+D+ RGL  +IPPFIDRT+L ARDPP P F H E+      KS P  K+P   
Sbjct  153   FHFINTWSDVTRGLDASIPPFIDRTLLHARDPPRPIFDHVEF------KSSPSMKIPQQP  206

Query  704   PST-----AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTT  555
             P +     ++ K++ +QL  LK  S   G     +TYE+LA H+WR VC AR L +DQ T
Sbjct  207   PGSVDVTRSIYKLSREQLNKLKDKSKEVGNTINYTTYEMLAGHVWRSVCIARSLPNDQET  266

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYI TDGRSRL P LP G+ GNVIF+ TP+A + +L+++P   +A RI +AL+RMDDEY
Sbjct  267   KLYIPTDGRSRLQPPLPLGYFGNVIFSTTPIALASDLISKPTWYAASRIHNALLRMDDEY  326

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             ++SA+DYLE Q D+  + R  N    PNL I SW + P++++DFGWG P+ MGP    ++
Sbjct  327   MKSAIDYLELQHDIRAIPRNPN-VKCPNLAIISWAKFPIYDADFGWGRPIFMGPGAD-FD  384

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             G  +I+PS   D SLS+ + L  +HM +F++L+Y
Sbjct  385   GQCFIIPSSTNDGSLSVVISLQHEHMEVFKELVY  418



>gb|KHN38057.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=279

 Score =   334 bits (857),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 201/278 (72%), Gaps = 8/278 (3%)
 Frame = -2

Query  911  HTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSG  732
            H ++DG S LHFI TW+D+ARGL V+IPPFIDRTILRARDPP P F H EY  PP +K+ 
Sbjct  3    HHVADGASGLHFINTWSDVARGLDVSIPPFIDRTILRARDPPRPVFDHIEYKPPPAMKT-  61

Query  731  PLSKLPGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGLSD  567
               +   A+ + ++ ++T  QL  LK  S  +G+T     YE+LA H+WR V +AR L D
Sbjct  62   --QQATNASAAVSIFRLTRDQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVSKARALPD  119

Query  566  DQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRM  387
            DQ TKLYIATDGRSRL P  PPG+ GNVIFT TP+A +G+L+++P   +A RI +AL+RM
Sbjct  120  DQETKLYIATDGRSRLQPPTPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRM  179

Query  386  DDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPAL  207
            D++YLRSALDYLE QPDL  LVRG++ F  PNL I SWTRLP+H++DFGWG P+ MGP  
Sbjct  180  DNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGG  239

Query  206  ILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
            I YEG  +I+PS   D SLS+A+ L  DHM LF+  LY
Sbjct  240  IAYEGLSFIIPSSTNDGSLSVAIALQPDHMKLFKDFLY  277



>gb|ACF81845.1| unknown [Zea mays]
 gb|AFW72296.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=319

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 214/305 (70%), Gaps = 11/305 (4%)
 Frame = -2

Query  971  ALFQVTRFKCGGVSLGTGIFHTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARD  792
            +L QVT FKCGGV++G G+ H ++DG S LHFI +WADL RG+ +A+ PFIDR++LRARD
Sbjct  16   SLLQVTHFKCGGVAIGVGMQHHVADGFSGLHFINSWADLCRGVPIAVMPFIDRSLLRARD  75

Query  791  PPCPAFKHTEYDHPPTLKSGP----LSKLPGANPS-TAMLKITPQQLALLKTNS-SHEG-  633
            PP PA+ H EY   P + S P    L+  P   P+  A+ K++  +L  L++   + EG 
Sbjct  76   PPTPAYPHIEYQPAPAMLSEPPQAALTSKPATPPTAVAIFKLSRAELVRLRSQVPAREGA  135

Query  632  ---STYEILAAHIWRCVCEARGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPV  462
               STY +LAAH+WRC   ARGL  DQ TKLY ATDGR RL P LP G+ GNVIFTATP+
Sbjct  136  PRFSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPL  195

Query  461  AESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNI  282
            A +G + T  +A  A  I++AL RMDD Y RSALDYLE QPDLS LVRG++ F  PNL +
Sbjct  196  ANAGTV-TAGVAEGASVIQAALDRMDDGYCRSALDYLELQPDLSALVRGAHTFRCPNLGL  254

Query  281  NSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQK  102
             SW RLP+H++DFGWG PV MGP  I YEG  ++LPS N+D SLS+A+ L A+HM  F+K
Sbjct  255  TSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRK  314

Query  101  LLYKF  87
            L+Y F
Sbjct  315  LIYDF  319



>ref|XP_008381165.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 227/333 (68%), Gaps = 7/333 (2%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +++FGDF P+ E RKL+P VD S  IS++PL + QVT FKCGGVSLG  + H ++DG 
Sbjct  107   SVLENFGDFAPTPEFRKLIPVVDYSAGISTYPLFVVQVTYFKCGGVSLGVXLEHRVADGC  166

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             S LHF+  W+D+ARGL + IPPFIDRT+LRARDPP P F   EY   P LK  P     G
Sbjct  167   SGLHFVNAWSDIARGLDLKIPPFIDRTLLRARDPPQPTFDPVEYQPDPPLKIPPXCTKDG  226

Query  710   ANPST--AMLKITPQQLALLKTNSSHEG-----STYEILAAHIWRCVCEARGLSDDQTTK  552
                ST  ++ ++T +QL++LK  S  EG     STYE+LA+H+W C  +AR L DDQ TK
Sbjct  227   XAESTTVSIFRLTREQLSILKAKSKEEGNTINYSTYEMLASHVWICASKARNLPDDQVTK  286

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L+IA DGRSRL P LP GF GNV+F   P+A   +L ++P    A RI   +VRM+++YL
Sbjct  287   LHIAVDGRSRLQPPLPLGFFGNVVFAGAPLATVRDLKSKPTWYVASRIHDVVVRMNNDYL  346

Query  371   RSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEG  192
             RSALDYL+ QPDLS LVRG + F  P L I SW RLP++ +DFG G P+ MGP  I YEG
Sbjct  347   RSALDYLDVQPDLSALVRGXHTFRCPKLGITSWVRLPIYEADFGXGGPMFMGPGGIGYEG  406

Query  191   TVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
               ++LPSP  D SLS+A+ L +DHM  F KLLY
Sbjct  407   LAFVLPSPTSDGSLSVAISLQSDHMESFAKLLY  439



>dbj|BAH57209.1| AT5G48930 [Arabidopsis thaliana]
Length=283

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/281 (58%), Positives = 205/281 (73%), Gaps = 8/281 (3%)
 Frame = -2

Query  911  HTLSDGLSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSG  732
            H  +DG S LHFI TW+D+ARGL + IPPFIDRT+LRARDPP PAF H EY   P++K  
Sbjct  3    HHAADGFSGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPAFHHVEYQPAPSMKI-  61

Query  731  PL--SKLPGANPSTAMLKITPQQLALLKTNSSHEGST-----YEILAAHIWRCVCEARGL  573
            PL  SK    N + ++ K+T  QL  LK  S  +G+T     YE+LA H+WR V +ARGL
Sbjct  62   PLDPSKSGPENTTVSIFKLTRDQLVALKAKSKEDGNTVSYSSYEMLAGHVWRSVGKARGL  121

Query  572  SDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALV  393
             +DQ TKLYIATDGRSRL P LPPG+ GNVIFTATP+A +G+LL++P   +A +I   LV
Sbjct  122  PNDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGQIHDFLV  181

Query  392  RMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGP  213
            RMDD YLRSALDYLE QPDLS LVRG++ +  PNL I SW RLP++++DFGWG P+ MGP
Sbjct  182  RMDDNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGP  241

Query  212  ALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
              I YEG  ++LPSP  D SLS+A+ L ++HM LF+K L++
Sbjct  242  GGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  282



>ref|XP_007033668.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 10 [Theobroma cacao]
 gb|EOY04594.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 10 [Theobroma cacao]
Length=410

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 222/334 (66%), Gaps = 19/334 (6%)
 Frame = -2

Query  1052  GDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHFI  873
             GDFT S ++ +L+P+VD SG ISS+PL + QVT FKCGG+S+G G+ H+L+DG SAL+FI
Sbjct  84    GDFTDSSQVSRLVPAVDYSGGISSYPLFILQVTSFKCGGISIGVGVHHSLADGTSALNFI  143

Query  872   KTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL----KSGPLSKLPGAN  705
              +W+D+ARG+ + + P  DRT+LRAR PP P F H EY+  P L    +S P S +    
Sbjct  144   NSWSDMARGIPLCLEPLFDRTLLRARVPPTPRFHHIEYEPSPPLITESESHPKSSI----  199

Query  704   PSTAMLKITPQQLALLKTNSSH--------EGSTYEILAAHIWRCVCEARGLSDDQTTKL  549
                ++  IT   +  LK  S          + ST+ +LAAHIWRCV  AR LS+DQ TKL
Sbjct  200   --VSVFNITADHVNTLKAKSQENIADTSTTKFSTFNVLAAHIWRCVTRARFLSNDQPTKL  257

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             Y+A DGRSRL P LP  + GNVIFT   +A +G+L +EP+  + KRI+ AL +MD+EYLR
Sbjct  258   YMAVDGRSRLHPPLPSEYFGNVIFTTATIAVAGDLQSEPITDTEKRIQKALTQMDNEYLR  317

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             S LDY+E  P +  L RGS    SPNL I SW RLP++ +DFGWG PV+M PA +L EG 
Sbjct  318   SILDYMEL-PGVKDLARGSRTIHSPNLGIVSWMRLPIYEADFGWGRPVYMRPAKVLVEGL  376

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             VYI  +P  D SLS+   L+A  M LF +LLYKF
Sbjct  377   VYITRTPKNDGSLSVVTRLEASEMKLFGELLYKF  410



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 224/338 (66%), Gaps = 10/338 (3%)
 Frame = -2

Query  1070  ATIDDF-GDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
             + +DD   DFT   ++ +L+P +D SG ISS+PL   QVT FKCGG+SLG  + HTL DG
Sbjct  100   SIMDDLVQDFTDGSKVPQLVPKIDYSGGISSYPLLGLQVTTFKCGGISLGVAVQHTLLDG  159

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
              S LHFI +WA+   GLS +I PF+DRT+LRAR+PP P F H E++  P+L++   +   
Sbjct  160   SSGLHFINSWANTVGGLSPSISPFLDRTLLRARNPPTPKFHHVEFEPSPSLQTMFSTSES  219

Query  713   GANPS---TAMLKITPQQLALLK------TNSSHEGSTYEILAAHIWRCVCEARGLSDDQ  561
               +P     ++ KIT  QL  LK      +NS+ + STY IL AHIWRC  +AR L +DQ
Sbjct  220   QQSPKPSIVSVFKITTDQLNTLKAKVNESSNSNTKYSTYSILTAHIWRCATKARDLLEDQ  279

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
               KL +  DGR+RL P LPPG+ GNVI  A  VA SG+LL+E    + KRI   L  MDD
Sbjct  280   QLKLTMPVDGRNRLHPPLPPGYFGNVIVMAALVALSGDLLSESFIDTVKRIHKILKEMDD  339

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYLRS++DY+E  PD++ + RG      PNL++NSW  LP+H++DFGWG P+ M PA I+
Sbjct  340   EYLRSSIDYIEKAPDINVIRRGPQTMRCPNLSVNSWIWLPIHDADFGWGRPIFMRPANIV  399

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +EG VYILPSP KD S++L   L+  HM LF KLLY+F
Sbjct  400   HEGKVYILPSPTKDGSVTLVTRLETSHMKLFGKLLYEF  437



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 230/336 (68%), Gaps = 12/336 (4%)
 Frame = -2

Query  1067  TIDDF-GD-FTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
              IDD  GD    S EL +L+P VD   DISS+PL L QVTRFKCGGV  G GI HTL+DG
Sbjct  104   VIDDLIGDTMINSSELWRLVPKVDYFADISSYPLILVQVTRFKCGGVGFGIGIQHTLADG  163

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
              +++HFI + A++ARGL ++  P IDR++L AR PP P F H EYD P ++ +   +K P
Sbjct  164   PTSVHFINSLAEMARGLPLSTRPCIDRSLLLARVPPTPTFHHVEYDPPLSMAA---TKGP  220

Query  713   GANPST--AMLKITPQQLALLKT--NSSHEG---STYEILAAHIWRCVCEARGLSDDQTT  555
              ++P T  ++ K+T  QL  LK   N + +G   STY  LAAHIWRCV +AR L DDQ T
Sbjct  221   RSDPETTVSVFKLTRDQLNTLKAKANKNSDGGVYSTYNSLAAHIWRCVNKARCLLDDQAT  280

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYI  DGRSRL P LPPG+LGNVIF +  +A  G++  E  + +AKRI++ L R DDEY
Sbjct  281   KLYIPIDGRSRLRPPLPPGYLGNVIFMSATIASHGDIQCESFSDTAKRIQNILRRTDDEY  340

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             L+SA+DY+E +P++   VRG+  F  PNL+INSW  LP++++DFGWG P+ +GPA +  +
Sbjct  341   LKSAIDYMEKEPNIKAPVRGARGFQCPNLSINSWMWLPLYDADFGWGRPIWLGPAKVSQD  400

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  YILPSP  D SLS+  CLD  HM +F +L Y+F
Sbjct  401   GKTYILPSPANDGSLSVMSCLDTSHMKIFGQLFYEF  436



>ref|XP_007033659.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 ref|XP_007033660.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033661.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033662.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033663.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033664.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033665.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033666.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033667.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04585.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 gb|EOY04586.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04587.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04588.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04589.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04590.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04591.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04592.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04593.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=433

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 222/334 (66%), Gaps = 19/334 (6%)
 Frame = -2

Query  1052  GDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHFI  873
             GDFT S ++ +L+P+VD SG ISS+PL + QVT FKCGG+S+G G+ H+L+DG SAL+FI
Sbjct  107   GDFTDSSQVSRLVPAVDYSGGISSYPLFILQVTSFKCGGISIGVGVHHSLADGTSALNFI  166

Query  872   KTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTL----KSGPLSKLPGAN  705
              +W+D+ARG+ + + P  DRT+LRAR PP P F H EY+  P L    +S P S +    
Sbjct  167   NSWSDMARGIPLCLEPLFDRTLLRARVPPTPRFHHIEYEPSPPLITESESHPKSSI----  222

Query  704   PSTAMLKITPQQLALLKTNSSH--------EGSTYEILAAHIWRCVCEARGLSDDQTTKL  549
                ++  IT   +  LK  S          + ST+ +LAAHIWRCV  AR LS+DQ TKL
Sbjct  223   --VSVFNITADHVNTLKAKSQENIADTSTTKFSTFNVLAAHIWRCVTRARFLSNDQPTKL  280

Query  548   YIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLR  369
             Y+A DGRSRL P LP  + GNVIFT   +A +G+L +EP+  + KRI+ AL +MD+EYLR
Sbjct  281   YMAVDGRSRLHPPLPSEYFGNVIFTTATIAVAGDLQSEPITDTEKRIQKALTQMDNEYLR  340

Query  368   SALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGT  189
             S LDY+E  P +  L RGS    SPNL I SW RLP++ +DFGWG PV+M PA +L EG 
Sbjct  341   SILDYMEL-PGVKDLARGSRTIHSPNLGIVSWMRLPIYEADFGWGRPVYMRPAKVLVEGL  399

Query  188   VYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             VYI  +P  D SLS+   L+A  M LF +LLYKF
Sbjct  400   VYITRTPKNDGSLSVVTRLEASEMKLFGELLYKF  433



>gb|KHG19404.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Gossypium arboreum]
Length=433

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 230/336 (68%), Gaps = 12/336 (4%)
 Frame = -2

Query  1067  TIDDF-GD-FTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
              IDD  GD    S EL +L+P VD   DISS+PL L QVTRFKCGGV  G GI HTL+DG
Sbjct  101   VIDDLIGDTMINSSELWRLVPKVDYFADISSYPLILVQVTRFKCGGVGFGIGIQHTLADG  160

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
              +++HFI + A++ARGL ++  P IDR++LRAR PP P F H EYD P ++ +   +K P
Sbjct  161   PASVHFINSLAEMARGLPLSTRPCIDRSLLRARVPPTPTFHHVEYDPPLSMAA---TKGP  217

Query  713   GANPST--AMLKITPQQLALLKT--NSSHEG---STYEILAAHIWRCVCEARGLSDDQTT  555
              ++P T  ++ K+T  QL  LK   N + +G   STY  LAAHIWRCV +AR L DDQ T
Sbjct  218   RSDPETTVSVFKLTRDQLNTLKAKANKNSDGGVYSTYNSLAAHIWRCVNKARCLLDDQGT  277

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYI  DGRSRL P LPPG+LGNVIF +  +A  G++ +E  + +AKRI++ L R DDEY
Sbjct  278   KLYIPIDGRSRLRPPLPPGYLGNVIFMSAAIASHGDIQSESFSDTAKRIQNILRRTDDEY  337

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSA+DY+E + ++   VRG+  F  PNL+INSW  LP++++DFGWG P+ +GPA +  +
Sbjct  338   LRSAIDYMEKEHNIKAPVRGARGFQCPNLSINSWMWLPLYDADFGWGRPIWLGPATVSQD  397

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  YILPSP  D SLS+  CLD  HM +F +L  +F
Sbjct  398   GKTYILPSPANDGSLSVMSCLDTSHMKIFGQLFNEF  433



>ref|XP_011011266.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=433

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 227/337 (67%), Gaps = 14/337 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTS-GDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
             +T ++ G+F PS+ELR+L+P+VD++  DIS  PL L QVT FKCGGV LG G  HTL+DG
Sbjct  100   STTEELGEFMPSMELRQLIPTVDSNLEDISPNPLLLLQVTSFKCGGVCLGVGWHHTLADG  159

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP  714
               ALHFI +WA LARGLS+ IPP +DRTILR R PP   F H EYD PPT+ +  LSK  
Sbjct  160   TGALHFINSWAALARGLSITIPPLLDRTILRGRVPPKSIFHHVEYDPPPTMNT--LSKNT  217

Query  713   GANPSTAMLKITPQQLALLKTNSSHEGS-----TYEILAAHIWRCVCEARGL-SDDQTTK  552
              ++ S A  KIT   +  LK  +++  S     TYEILAAHIWR + +AR    +DQ TK
Sbjct  218   KSH-SLANFKITLDHINSLKAKANNVESETKYTTYEILAAHIWRSISKARNFPKNDQKTK  276

Query  551   LYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYL  372
             L I+ DGRSRL P L   + GNVIFTA+P+A SG+LL+E    + +RI   + +MD+EYL
Sbjct  277   LLISVDGRSRLNPPLQSSYFGNVIFTASPIALSGDLLSESFKCTVERIHREIKKMDEEYL  336

Query  371   RSALDYLEC---QPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             RSALDYLE      D++ + RGS   A PNL + SW RLP + +DFGWG P+ M PA  +
Sbjct  337   RSALDYLEEVGDVGDVNTIARGSATCACPNLTVVSWMRLPFYKADFGWGAPLLMRPA-TM  395

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYK  90
             +EG  YI P+P  D S SLA+CL+ DHM  F+KL Y+
Sbjct  396   FEGKGYIHPNPANDGSFSLALCLETDHMESFRKLFYE  432



>gb|KHG08871.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=434

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 213/325 (66%), Gaps = 7/325 (2%)
 Frame = -2

Query  1052  GDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSALHFI  873
             GDFT +     L+P VD SG ISS+PL + QVT+FKCGGV LG G  HTL DG SA+HFI
Sbjct  114   GDFTDN---SHLVPKVDYSGGISSYPLLVLQVTKFKCGGVCLGVGFQHTLGDGTSAIHFI  170

Query  872   KTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPGANPSTA  693
              +WA+ ARG+  AI PFIDRT+LRAR PP P F H EY+ P T      S L  +  ST 
Sbjct  171   NSWAETARGVLPAIAPFIDRTLLRARVPPMPKFHHLEYE-PYTPLKAVESDLKPSTVSTF  229

Query  692   MLKITPQQLALLKTNSSHEGS---TYEILAAHIWRCVCEARGLSDDQTTKLYIATDGRSR  522
              L +        K  ++  G+   +Y ILAAHIWRCV +A GLSDDQ TK+Y   DGRS+
Sbjct  230   KLTVDQLNALKAKAAANSSGTKYRSYNILAAHIWRCVSKAMGLSDDQPTKMYFPVDGRSK  289

Query  521   LCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEYLRSALDYLECQ  342
             L P LPPG+ GNV+F    +A++G+L TE    + KRI   L +++DEYLRSALDY+E  
Sbjct  290   LKPPLPPGYFGNVVFVNALIAQAGDLNTESFLDTIKRIHEGLKQINDEYLRSALDYIETV  349

Query  341   PDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYEGTVYILPSPNK  162
              DLS LVRG   F  PNL +N+W RLP++ +DFGWG P+H GPA  + EG VYILP+P  
Sbjct  350   SDLSTLVRGPYTFRCPNLIVNTWMRLPIYEADFGWGRPIHAGPANAIQEGMVYILPTPIN  409

Query  161   DRSLSLAVCLDADHMPLFQKLLYKF  87
             D SL +   L+  HM   +KLLY+F
Sbjct  410   DGSLLVVARLEISHMSCIEKLLYEF  434



>ref|XP_007027324.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07826.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 217/338 (64%), Gaps = 10/338 (3%)
 Frame = -2

Query  1070  ATIDDF-GDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDG  894
             + +DD   +F    E  +L+P +D SG ISS+PL   QVT FKCGG+SLG    HT+ DG
Sbjct  100   SIMDDLVKEFKDDSEGPQLVPKIDYSGGISSYPLLGLQVTTFKCGGISLGVSTQHTMVDG  159

Query  893   LSALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKS--GPLSK  720
              S LHFI +WA+  RG S  I PF+DRT+LRAR PP P F+H E++  P+L++       
Sbjct  160   SSGLHFINSWANTVRGCSPNIAPFLDRTLLRARHPPIPKFRHVEFEPSPSLQTMFSTSEC  219

Query  719   LPGANPS-TAMLKITPQQLALLK------TNSSHEGSTYEILAAHIWRCVCEARGLSDDQ  561
              P   PS  ++  IT  +L  LK      +NS+ + STY IL AHIWRC  +AR L +DQ
Sbjct  220   QPSPKPSIVSIFTITADKLNALKAKVNGNSNSNTKYSTYSILTAHIWRCATKARDLLEDQ  279

Query  560   TTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDD  381
               KL +  DGR+RL P  PPG++GNVIF A  VA +GELL+E    + KRI   L  MDD
Sbjct  280   QLKLNMPVDGRNRLHPPFPPGYIGNVIFMAALVALAGELLSESFIDTVKRIHKILKEMDD  339

Query  380   EYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALIL  201
             EYLRS +DY+E  PD+  + RGS     P+L INSW  LP+H +DFGWG P+ M PA I+
Sbjct  340   EYLRSEIDYIEKAPDIEAIRRGSQTMRCPSLVINSWILLPIHEADFGWGRPIFMRPANIV  399

Query  200   YEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             +EG VYILPSP KD SL+L   L+  HM LF KLLY+F
Sbjct  400   HEGIVYILPSPTKDGSLTLVTRLETSHMKLFGKLLYEF  437



>gb|EYU24607.1| hypothetical protein MIMGU_mgv1a006502mg [Erythranthe guttata]
Length=441

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 173/343 (50%), Positives = 223/343 (65%), Gaps = 25/343 (7%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDD G F P  +L  L P+VD S  IS++PL L Q+TRFKCGGV LG G  H LSDG +A
Sbjct  103   IDDLGGFAPRPDL-SLNPAVDYSLGISTYPLLLIQLTRFKCGGVCLGHGNQHHLSDGPAA  161

Query  884   LHFIKTWADLARGLSVAI---------PPFIDRTILRARDPPCPAFKHTEYDHPPTLKSG  732
             L F KTW DLAR L+ +          PPF+DRT+LRARDPP P F H EY      + G
Sbjct  162   LRFTKTWFDLARSLATSTATVTTAADAPPFMDRTLLRARDPPQPRFTHIEYH-----RGG  216

Query  731   PLSKLPGANPSTAMLKITPQQLALLKTNSSHEG----------STYEILAAHIWRCVCEA  582
              L  L  +  + ++ K+T  Q+  LK   + +G          +T+E+LA H+WRCV EA
Sbjct  217   NLQPLLASEKTYSVFKLTSDQINALKAKCNVDGGNGPFPAARYTTFEVLAGHVWRCVSEA  276

Query  581   RGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRS  402
             RGL  DQ TKLY++TDGRSRL P LPPG+ GNV F+AT V+  G+L +  +  +A + R 
Sbjct  277   RGLPGDQETKLYVSTDGRSRLSPPLPPGYFGNVNFSATAVSLCGQLRSNNVCFAAGKTRE  336

Query  401   ALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVH  222
             A+ RMDDEYLRSA+DYLE QPD+S + RG   + SPNL I SW RLPV+ +D+GWG PVH
Sbjct  337   AIARMDDEYLRSAIDYLEVQPDISAIARGPGTYNSPNLGIISWLRLPVYEADYGWGNPVH  396

Query  221   MGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +G A    EG  ++LPSP  D SL +++ L  +HM LF+KLL+
Sbjct  397   VGLAAAPPEGKCHLLPSPASDGSLLVSISLAKEHMRLFEKLLF  439



>ref|XP_002529413.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF33009.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=425

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/339 (50%), Positives = 214/339 (63%), Gaps = 12/339 (4%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             + +D+ GDF     LR L+P VD S  I S+PL + QVT F CGGVSLG G  HTL+DG 
Sbjct  88    SAMDELGDFLRDDVLRFLVPKVDYSNAIDSYPLLVLQVTTFTCGGVSLGVGWHHTLADGY  147

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLP-  714
             SALHF  +W+ ++RGL ++IPPF DRT+LR RDPP P F H EYD PP L   P  +   
Sbjct  148   SALHFTMSWSSISRGLPISIPPFHDRTVLRCRDPPAPVFPHIEYDEPPALYISPQDQKEN  207

Query  713   --GANPSTAMLKITPQQLALLKT-----NSSHEGSTYEILAAHIWRCVCEARGLSDDQTT  555
               G++     LKIT  QL  LK      +   + STYEIL AHIWRC C+ARGLSDDQ T
Sbjct  208   QLGSSNYLETLKITADQLETLKAKVKSKDDKTKYSTYEILTAHIWRCACKARGLSDDQET  267

Query  554   KLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             KLYI+ DGR+R  P LP GF GNV+F ATP+A  GE+ +EPL  +A R+   + RMDDEY
Sbjct  268   KLYISVDGRTRFSPPLPSGFFGNVVFHATPIALCGEVASEPLVDTAGRVNKTIKRMDDEY  327

Query  374   LRSALDYLECQPDLSKLVRGSNYFAS--PNLNINSWTRLP-VHNSDFGWGTPVHMGPALI  204
             LRSA+DYLE   D +++           PNL I SW R+P +   DFGWG P+ M  A  
Sbjct  328   LRSAIDYLEEIGDPTRVSERVMKTGGKCPNLKIVSWARMPFLEAHDFGWGKPISMRAA-N  386

Query  203   LYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
               EG  +I+  P+ D +L LA+CL    MP F+KL Y+F
Sbjct  387   PSEGKGHIISCPSGDENLVLAICLGTHQMPAFKKLFYEF  425



>gb|EYU24606.1| hypothetical protein MIMGU_mgv1a005249mg [Erythranthe guttata]
Length=492

 Score =   330 bits (845),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 223/343 (65%), Gaps = 25/343 (7%)
 Frame = -2

Query  1064  IDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGLSA  885
             IDD G F P  +L  L P+VD S  IS++PL L Q+TRFKCGGV LG G  H LSDG +A
Sbjct  154   IDDLGGFAPRPDL-SLNPAVDYSLGISTYPLLLIQLTRFKCGGVCLGHGNQHHLSDGPAA  212

Query  884   LHFIKTWADLARGLSVAI---------PPFIDRTILRARDPPCPAFKHTEYDHPPTLKSG  732
             L F KTW DLAR L+ +          PPF+DRT+LRARDPP P F H EY      + G
Sbjct  213   LRFTKTWFDLARSLATSTATVTTAADAPPFMDRTLLRARDPPQPRFTHIEYH-----RGG  267

Query  731   PLSKLPGANPSTAMLKITPQQLALLKTNSSHEG----------STYEILAAHIWRCVCEA  582
              L  L  +  + ++ K+T  Q+  LK   + +G          +T+E+LA H+WRCV EA
Sbjct  268   NLQPLLASEKTYSVFKLTSDQINALKAKCNVDGGNGPFPAARYTTFEVLAGHVWRCVSEA  327

Query  581   RGLSDDQTTKLYIATDGRSRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRS  402
             RGL  DQ TKLY++TDGRSRL P LPPG+ GNV F+AT V+  G+L +  +  +A + R 
Sbjct  328   RGLPGDQETKLYVSTDGRSRLSPPLPPGYFGNVNFSATAVSLCGQLRSNNVCFAAGKTRE  387

Query  401   ALVRMDDEYLRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVH  222
             A+ RMDDEYLRSA+DYLE QPD+S + RG   + SPNL I SW RLPV+ +DFGWG PVH
Sbjct  388   AIARMDDEYLRSAIDYLEVQPDISAIARGPGTYNSPNLGIISWLRLPVYEADFGWGNPVH  447

Query  221   MGPALILYEGTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLY  93
             +G A    EG  ++LPSP  D SL +++ L  +HM LF+KLL+
Sbjct  448   VGLAAAPPEGKCHLLPSPASDGSLLVSISLAKEHMRLFEKLLF  490



>ref|XP_010093469.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB54093.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=427

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/336 (46%), Positives = 224/336 (67%), Gaps = 11/336 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TIDDFGDF PS +L+KL+P+VD SG +SS+PL + Q+T FKCGGVSLG+ + H   DG 
Sbjct  94    STIDDFGDFAPSPDLKKLVPAVDYSGGLSSYPLMVVQITYFKCGGVSLGSAMEHHTVDGT  153

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             SA+H + +W+ +ARGL + IPPF+DR++L  R+PP P F H EY   PT  S  +  L  
Sbjct  154   SAMHLMNSWSQIARGLDITIPPFLDRSLLDPRNPPQPKFNHIEYQ--PT-NSNKIISLQN  210

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG------STYEILAAHIWRCVCEARGLSDDQTTKL  549
              +  T++ K+T  QL+ +K+ ++  G      ST+E+LA H W+CVC+AR +  D+ T+L
Sbjct  211   HSTITSIFKLTKDQLSTMKSLANKNGQGGVHYSTFEVLAGHTWKCVCKARDVPRDEETRL  270

Query  548   YIATDGR--SRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             Y   +GR  +R  P LP GF GN IF  T +A +G+L T+PL+ +   I   LV+M+++Y
Sbjct  271   YFPVNGRPSTRFQPQLPLGFFGNAIFAGTAIALAGDLQTKPLSYAVSLIHETLVKMNNDY  330

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSA+D++E QPD+S +  G+  + SPN  I SW+R+  H++DFGWG P +MG A I +E
Sbjct  331   LRSAIDHIELQPDISPIRLGARLYQSPNFGITSWSRMGTHDADFGWGRPCYMGIAAISFE  390

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  YI+PS   D   SL + L  +HM +F+K  Y++
Sbjct  391   GKSYIVPSAADDGGFSLIIALHDEHMKVFEKSFYEY  426



>ref|XP_010093468.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB54092.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=427

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/336 (46%), Positives = 223/336 (66%), Gaps = 11/336 (3%)
 Frame = -2

Query  1070  ATIDDFGDFTPSLELRKLLPSVDTSGDISSFPLALFQVTRFKCGGVSLGTGIFHTLSDGL  891
             +TIDDFGDF PS +L KL+P+VD SG +SS+PL + Q+T FKCGGVSLG+ + H   DG 
Sbjct  94    STIDDFGDFAPSPDLEKLVPAVDYSGGLSSYPLMVVQITYFKCGGVSLGSAMEHHTVDGT  153

Query  890   SALHFIKTWADLARGLSVAIPPFIDRTILRARDPPCPAFKHTEYDHPPTLKSGPLSKLPG  711
             SA+H + +W+ +ARGL + IPPF+DR++L  R+PP P F H EY   PT  S  +  L  
Sbjct  154   SAMHLMNSWSQIARGLDITIPPFLDRSLLDPRNPPQPKFNHIEYQ--PT-NSNKIISLQN  210

Query  710   ANPSTAMLKITPQQLALLKTNSSHEG------STYEILAAHIWRCVCEARGLSDDQTTKL  549
              +  T++ K+T  QL+ +K+ ++  G      ST+E+LA H W+CVC+AR +  D+ T+L
Sbjct  211   HSTITSIFKLTKDQLSTMKSLANKNGQGGVHYSTFEVLAGHTWKCVCKARDVPRDEETRL  270

Query  548   YIATDGR--SRLCPALPPGFLGNVIFTATPVAESGELLTEPLASSAKRIRSALVRMDDEY  375
             Y   +GR  +R  P LP GF GN IF  T +A +G+L T+PL+ +   I   LV+M+++Y
Sbjct  271   YFPVNGRPSTRFQPQLPLGFFGNAIFAGTAIALAGDLQTKPLSYAVSLIHETLVKMNNDY  330

Query  374   LRSALDYLECQPDLSKLVRGSNYFASPNLNINSWTRLPVHNSDFGWGTPVHMGPALILYE  195
             LRSA+D++E QPD+S +  G+  + SPN  I SW+R+  H++DFGWG P +MG A I +E
Sbjct  331   LRSAIDHIELQPDISPIRLGARLYQSPNFGITSWSRMGTHDADFGWGRPCYMGIAAISFE  390

Query  194   GTVYILPSPNKDRSLSLAVCLDADHMPLFQKLLYKF  87
             G  YI+PS   D   SL + L  +HM +F+K  Y++
Sbjct  391   GKSYIVPSAADDGGFSLIIALHDEHMKVFEKSFYEY  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2788341287920