BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11070

Length=790
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010913398.1|  PREDICTED: protein disulfide isomerase-like 2-3    372   3e-124   Elaeis guineensis
ref|XP_009606235.1|  PREDICTED: protein disulfide isomerase-like 2-3    372   7e-124   Nicotiana tomentosiformis
ref|XP_002320494.2|  thioredoxin family protein                         369   7e-123   Populus trichocarpa [western balsam poplar]
ref|XP_004491086.1|  PREDICTED: protein disulfide isomerase-like ...    369   8e-123   Cicer arietinum [garbanzo]
ref|XP_011085485.1|  PREDICTED: protein disulfide isomerase-like 2-3    369   1e-122   Sesamum indicum [beniseed]
ref|XP_009804684.1|  PREDICTED: protein disulfide isomerase-like 2-3    368   2e-122   Nicotiana sylvestris
ref|XP_012080662.1|  PREDICTED: protein disulfide isomerase-like 2-3    368   2e-122   Jatropha curcas
ref|XP_011003479.1|  PREDICTED: protein disulfide isomerase-like 2-3    368   3e-122   Populus euphratica
ref|XP_004304072.1|  PREDICTED: protein disulfide isomerase-like 2-3    368   3e-122   Fragaria vesca subsp. vesca
ref|XP_007049203.1|  PDI-like 2-2                                       366   1e-121   Theobroma cacao [chocolate]
ref|XP_003519441.1|  PREDICTED: protein disulfide isomerase-like ...    367   1e-121   Glycine max [soybeans]
ref|XP_009365136.1|  PREDICTED: protein disulfide isomerase-like 2-3    366   1e-121   Pyrus x bretschneideri [bai li]
ref|XP_008456396.1|  PREDICTED: protein disulfide isomerase-like 2-3    366   1e-121   Cucumis melo [Oriental melon]
ref|XP_006357974.1|  PREDICTED: protein disulfide isomerase-like ...    365   2e-121   Solanum tuberosum [potatoes]
ref|XP_011016519.1|  PREDICTED: protein disulfide isomerase-like 2-3    365   3e-121   Populus euphratica
ref|XP_008342147.1|  PREDICTED: protein disulfide isomerase-like 2-3    365   4e-121   Malus domestica [apple tree]
ref|XP_004243508.1|  PREDICTED: protein disulfide isomerase-like 2-3    363   1e-120   Solanum lycopersicum
ref|XP_008805603.1|  PREDICTED: protein disulfide isomerase-like 2-3    363   2e-120   Phoenix dactylifera
gb|KJB42838.1|  hypothetical protein B456_007G169700                    363   2e-120   Gossypium raimondii
ref|NP_001236576.1|  protein disulfide isomerse like protein prec...    362   3e-120   Glycine max [soybeans]
ref|XP_007141667.1|  hypothetical protein PHAVU_008G215100g             361   1e-119   Phaseolus vulgaris [French bean]
ref|XP_008379697.1|  PREDICTED: protein disulfide isomerase-like 2-3    359   7e-119   
ref|XP_002276520.1|  PREDICTED: protein disulfide isomerase-like 2-3    359   8e-119   Vitis vinifera
ref|XP_011100470.1|  PREDICTED: protein disulfide isomerase-like 2-3    358   2e-118   Sesamum indicum [beniseed]
ref|XP_010252582.1|  PREDICTED: protein disulfide isomerase-like 2-3    357   3e-118   Nelumbo nucifera [Indian lotus]
ref|XP_008229815.1|  PREDICTED: protein disulfide isomerase-like 2-3    357   6e-118   Prunus mume [ume]
ref|XP_003616851.1|  Protein disulfide isomerase family                 357   6e-118   Medicago truncatula
ref|XP_010035498.1|  PREDICTED: protein disulfide isomerase-like 2-3    356   1e-117   Eucalyptus grandis [rose gum]
gb|KHN44746.1|  Protein disulfide isomerase-like 2-3                    355   2e-117   Glycine soja [wild soybean]
ref|XP_007215346.1|  hypothetical protein PRUPE_ppa005396mg             356   3e-117   Prunus persica
gb|ACU17741.1|  unknown                                                 353   9e-117   Glycine max [soybeans]
ref|XP_004143192.1|  PREDICTED: protein disulfide isomerase-like 2-3    353   1e-116   Cucumis sativus [cucumbers]
ref|XP_010110229.1|  Protein disulfide-isomerase like 2-2               352   3e-116   
ref|XP_009409223.1|  PREDICTED: protein disulfide isomerase-like ...    351   1e-115   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK43048.1|  unknown                                                 351   1e-115   Lotus japonicus
ref|XP_006469595.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    351   1e-115   
ref|XP_006661300.1|  PREDICTED: protein disulfide isomerase-like ...    349   6e-115   
ref|XP_006829505.1|  PREDICTED: protein disulfide isomerase-like 2-3    348   9e-115   Amborella trichopoda
ref|NP_001063331.1|  Os09g0451500                                       348   1e-114   
gb|KDO59567.1|  hypothetical protein CISIN_1g014216mg                   347   3e-114   Citrus sinensis [apfelsine]
ref|XP_006447669.1|  hypothetical protein CICLE_v10015327mg             347   5e-114   Citrus clementina [clementine]
ref|XP_009409222.1|  PREDICTED: protein disulfide isomerase-like ...    346   6e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010270061.1|  PREDICTED: protein disulfide isomerase-like ...    343   3e-113   
gb|KJB10301.1|  hypothetical protein B456_001G195100                    343   1e-112   Gossypium raimondii
ref|XP_010270060.1|  PREDICTED: protein disulfide isomerase-like ...    343   1e-112   Nelumbo nucifera [Indian lotus]
gb|EYU43141.1|  hypothetical protein MIMGU_mgv1a006693mg                341   6e-112   Erythranthe guttata [common monkey flower]
ref|NP_001105804.1|  protein disulfide isomerase8 precursor             339   4e-111   Zea mays [maize]
gb|KJB10306.1|  hypothetical protein B456_001G195100                    338   6e-111   Gossypium raimondii
ref|XP_004956980.1|  PREDICTED: protein disulfide isomerase-like ...    339   7e-111   Setaria italica
gb|EEC84682.1|  hypothetical protein OsI_31602                          339   7e-111   Oryza sativa Indica Group [Indian rice]
dbj|BAJ84858.1|  predicted protein                                      337   3e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578205.1|  PREDICTED: protein disulfide isomerase-like 2-3    337   5e-110   Brachypodium distachyon [annual false brome]
ref|XP_002460311.1|  hypothetical protein SORBIDRAFT_02g026300          336   1e-109   Sorghum bicolor [broomcorn]
ref|XP_010556968.1|  PREDICTED: protein disulfide-isomerase like ...    335   2e-109   Tarenaya hassleriana [spider flower]
ref|XP_008668262.1|  PREDICTED: uncharacterized protein LOC100381...    335   2e-109   
emb|CBG91909.1|  putative PDI-like protein                              334   4e-109   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010475171.1|  PREDICTED: protein disulfide-isomerase like 2-2    334   7e-109   Camelina sativa [gold-of-pleasure]
emb|CBG91899.1|  putative PDI-like protein                              333   2e-108   Triticum aestivum [Canadian hard winter wheat]
dbj|BAO79454.1|  protein disulfide isomerase family protein 5-1         333   2e-108   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010484503.1|  PREDICTED: protein disulfide-isomerase like ...    332   2e-108   Camelina sativa [gold-of-pleasure]
gb|KHG30032.1|  Protein disulfide-isomerase like 2-2                    332   3e-108   Gossypium arboreum [tree cotton]
gb|ACN39830.1|  unknown                                                 332   4e-108   Picea sitchensis
emb|CBG91908.1|  putative PDI-like protein                              331   7e-108   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006418074.1|  hypothetical protein EUTSA_v10007682mg             330   1e-107   Eutrema salsugineum [saltwater cress]
ref|XP_010688926.1|  PREDICTED: protein disulfide isomerase-like 2-3    331   1e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN38504.1|  Protein disulfide isomerase-like 2-3                    328   4e-107   Glycine soja [wild soybean]
emb|CDP05711.1|  unnamed protein product                                327   3e-106   Coffea canephora [robusta coffee]
ref|NP_171990.3|  protein disulfide-isomerase like 2-2                  327   3e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAF40463.1|AC004809_21  Strong simialrity to the disulfide iso...    327   3e-106   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA40211.1|  TPA: putative thioredoxin superfamily protein          319   3e-106   
ref|XP_002892256.1|  hypothetical protein ARALYDRAFT_470488             326   8e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_006306333.1|  hypothetical protein CARUB_v10012209mg             325   2e-105   Capsella rubella
ref|XP_009119218.1|  PREDICTED: protein disulfide-isomerase like 2-2    324   4e-105   Brassica rapa
emb|CDY18278.1|  BnaC05g03010D                                          321   5e-104   Brassica napus [oilseed rape]
ref|XP_010522374.1|  PREDICTED: protein disulfide-isomerase 2-3-like    319   2e-103   Tarenaya hassleriana [spider flower]
ref|XP_009143922.1|  PREDICTED: protein disulfide-isomerase 2-3         318   1e-102   Brassica rapa
emb|CDY52544.1|  BnaA05g35030D                                          317   2e-102   Brassica napus [oilseed rape]
emb|CDY12149.1|  BnaC04g11790D                                          317   2e-102   Brassica napus [oilseed rape]
ref|XP_002881252.1|  hypothetical protein ARALYDRAFT_482234             315   1e-101   
ref|XP_006294195.1|  hypothetical protein CARUB_v10023191mg             315   3e-101   
gb|KFK31099.1|  hypothetical protein AALP_AA6G068000                    313   6e-101   Arabis alpina [alpine rockcress]
ref|NP_180851.1|  protein disulfide-isomerase like 2-3                  313   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509948.1|  PREDICTED: protein disulfide-isomerase 2-3 i...    312   2e-100   
ref|XP_010469533.1|  PREDICTED: protein disulfide-isomerase 2-3-like    312   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010413931.1|  PREDICTED: protein disulfide-isomerase 2-3-like    310   8e-100   Camelina sativa [gold-of-pleasure]
emb|CDX79497.1|  BnaC03g18330D                                          310   9e-100   
ref|XP_006410429.1|  hypothetical protein EUTSA_v10016663mg             310   2e-99    Eutrema salsugineum [saltwater cress]
gb|KDO59568.1|  hypothetical protein CISIN_1g014216mg                   304   1e-97    Citrus sinensis [apfelsine]
gb|EEE54954.1|  hypothetical protein OsJ_02527                          300   1e-97    Oryza sativa Japonica Group [Japonica rice]
gb|KHG02314.1|  Protein disulfide-isomerase like 2-2                    299   1e-95    Gossypium arboreum [tree cotton]
gb|EMT02125.1|  Protein disulfide-isomerase A6                          295   7e-94    
ref|XP_002973288.1|  hypothetical protein SELMODRAFT_232026             281   3e-88    Selaginella moellendorffii
ref|XP_002976616.1|  hypothetical protein SELMODRAFT_232834             280   4e-88    Selaginella moellendorffii
ref|XP_001780684.1|  predicted protein                                  276   8e-87    
ref|XP_002528963.1|  protein disulfide isomerase, putative              250   1e-77    
ref|NP_001167822.1|  uncharacterized protein LOC100381521               229   1e-71    
gb|KJB42837.1|  hypothetical protein B456_007G169700                    207   7e-61    Gossypium raimondii
gb|KJB10305.1|  hypothetical protein B456_001G195100                    193   1e-55    Gossypium raimondii
gb|EAX00949.1|  protein disulfide isomerase family A, member 6, i...    189   8e-55    Homo sapiens [man]
ref|XP_005327417.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-54    
gb|EMS60416.1|  Protein disulfide isomerase-like 2-3                    190   5e-54    Triticum urartu
ref|XP_010706217.1|  PREDICTED: protein disulfide-isomerase A6          192   5e-54    Meleagris gallopavo [common turkey]
ref|XP_419952.1|  PREDICTED: protein disulfide-isomerase A6 isofo...    192   5e-54    Gallus gallus [bantam]
ref|XP_005044328.1|  PREDICTED: protein disulfide-isomerase A6          192   6e-54    Ficedula albicollis
ref|XP_004696438.1|  PREDICTED: protein disulfide-isomerase A6          192   8e-54    Echinops telfairi [lesser hedgehog tenrec]
gb|KFQ65954.1|  Protein disulfide-isomerase A6                          191   1e-53    Phaethon lepturus
ref|XP_010280693.1|  PREDICTED: protein disulfide-isomerase A6          190   3e-53    Phaethon lepturus
gb|AAB50217.1|  protein disulfide isomerase-related protein 5           189   3e-53    Homo sapiens [man]
ref|XP_002953269.1|  hypothetical protein VOLCADRAFT_105867             190   3e-53    Volvox carteri f. nagariensis
ref|XP_007933283.1|  PREDICTED: protein disulfide-isomerase A6          189   4e-53    Orycteropus afer afer
ref|XP_010336276.1|  PREDICTED: protein disulfide-isomerase A6          193   4e-53    Saimiri boliviensis boliviensis
ref|NP_001253564.1|  protein disulfide-isomerase A6 precursor           189   4e-53    Macaca mulatta [rhesus macaque]
ref|NP_001269636.1|  protein disulfide-isomerase A6 isoform e pre...    189   5e-53    Homo sapiens [man]
ref|XP_011820677.1|  PREDICTED: protein disulfide-isomerase A6 is...    189   5e-53    Mandrillus leucophaeus
ref|XP_004642404.1|  PREDICTED: protein disulfide-isomerase A6          191   5e-53    
ref|XP_004028893.1|  PREDICTED: protein disulfide-isomerase A6 is...    189   5e-53    
ref|NP_001233576.1|  protein disulfide-isomerase A6 precursor           189   5e-53    Pan troglodytes
dbj|BAH12614.1|  unnamed protein product                                189   6e-53    Homo sapiens [man]
ref|XP_003908325.1|  PREDICTED: protein disulfide-isomerase A6 is...    189   6e-53    Papio anubis [baboon]
ref|NP_005733.1|  protein disulfide-isomerase A6 isoform d precursor    189   6e-53    Homo sapiens [man]
ref|NP_001269635.1|  protein disulfide-isomerase A6 isoform c           189   6e-53    Homo sapiens [man]
ref|XP_009181940.1|  PREDICTED: protein disulfide-isomerase A6 is...    189   6e-53    
ref|NP_001193274.1|  protein disulfide-isomerase A6 precursor           188   1e-52    Bos taurus [bovine]
ref|NP_001269634.1|  protein disulfide-isomerase A6 isoform b           189   1e-52    Homo sapiens [man]
ref|XP_007529904.1|  PREDICTED: protein disulfide-isomerase A6          188   1e-52    Erinaceus europaeus [common hedgehog]
dbj|BAG54757.1|  unnamed protein product                                189   1e-52    Homo sapiens [man]
ref|XP_002758076.1|  PREDICTED: protein disulfide-isomerase A6          188   1e-52    Callithrix jacchus [common marmoset]
gb|AAI48887.1|  PDIA6 protein                                           188   1e-52    Bos taurus [bovine]
ref|XP_011820676.1|  PREDICTED: protein disulfide-isomerase A6 is...    189   1e-52    Mandrillus leucophaeus
ref|NP_001126483.1|  protein disulfide-isomerase A6 precursor           188   1e-52    Pongo abelii [orang utan]
ref|XP_004274932.1|  PREDICTED: protein disulfide-isomerase A6          188   1e-52    
gb|ELR58675.1|  Protein disulfide-isomerase A6                          188   1e-52    Bos mutus
ref|XP_004005734.1|  PREDICTED: protein disulfide-isomerase A6 is...    188   1e-52    
ref|XP_005687063.1|  PREDICTED: protein disulfide-isomerase A6          188   2e-52    
emb|CDY53400.1|  BnaAnng12480D                                          185   2e-52    Brassica napus [oilseed rape]
ref|XP_010377997.1|  PREDICTED: protein disulfide-isomerase A6          189   2e-52    Rhinopithecus roxellana
ref|XP_010627358.1|  PREDICTED: protein disulfide-isomerase A6          187   2e-52    
gb|EHH21891.1|  hypothetical protein EGK_05054                          189   2e-52    Macaca mulatta [rhesus macaque]
ref|XP_004310310.1|  PREDICTED: protein disulfide-isomerase A6 is...    187   2e-52    
dbj|BAE88097.1|  unnamed protein product                                181   2e-52    Macaca fascicularis [crab eating macaque]
gb|KFV98779.1|  Protein disulfide-isomerase A6                          187   2e-52    Fulmarus glacialis
ref|XP_004609467.1|  PREDICTED: protein disulfide-isomerase A6          188   2e-52    
dbj|BAC86977.1|  unnamed protein product                                189   2e-52    Homo sapiens [man]
ref|NP_001269633.1|  protein disulfide-isomerase A6 isoform a           188   2e-52    Homo sapiens [man]
gb|KFP75924.1|  Protein disulfide-isomerase A6                          187   2e-52    Acanthisitta chloris
ref|XP_009068583.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-52    Acanthisitta chloris
ref|XP_009585693.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-52    Fulmarus glacialis
ref|XP_003787439.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-52    Otolemur garnettii
ref|XP_006257985.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-52    
gb|EMC90288.1|  Protein disulfide-isomerase A6                          187   3e-52    
ref|XP_006869520.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-52    Chrysochloris asiatica
ref|XP_008160636.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-52    Eptesicus fuscus
ref|XP_004459385.1|  PREDICTED: protein disulfide-isomerase A6          187   3e-52    Dasypus novemcinctus
ref|XP_003411934.1|  PREDICTED: protein disulfide-isomerase A6          187   4e-52    Loxodonta africana [African bush elephant]
gb|AAH06865.2|  Protein disulfide isomerase associated 6                187   4e-52    Mus musculus [mouse]
ref|XP_003272792.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    187   4e-52    
ref|NP_001080305.1|  protein disulfide isomerase family A, member...    187   4e-52    Xenopus laevis [clawed frog]
sp|Q922R8.3|PDIA6_MOUSE  RecName: Full=Protein disulfide-isomeras...    187   4e-52    Mus musculus [mouse]
ref|XP_007080745.1|  PREDICTED: protein disulfide-isomerase A6          182   4e-52    
gb|ELK29163.1|  Protein disulfide-isomerase A6                          188   4e-52    Myotis davidii
ref|XP_008848336.1|  PREDICTED: protein disulfide-isomerase A6          187   4e-52    Nannospalax galili
ref|NP_082235.1|  protein disulfide-isomerase A6 precursor              187   5e-52    
ref|XP_005404513.1|  PREDICTED: protein disulfide-isomerase A6          190   5e-52    
gb|KFU96864.1|  Protein disulfide-isomerase A6                          186   5e-52    Pterocles gutturalis
ref|XP_005000363.1|  PREDICTED: protein disulfide-isomerase A6 is...    186   5e-52    Cavia porcellus [guinea pig]
ref|XP_010073176.1|  PREDICTED: protein disulfide-isomerase A6          186   5e-52    Pterocles gutturalis
ref|XP_004870016.1|  PREDICTED: protein disulfide-isomerase A6          186   6e-52    Heterocephalus glaber [naked mole rat]
dbj|BAE39477.1|  unnamed protein product                                186   6e-52    Mus musculus [mouse]
ref|XP_002117070.1|  hypothetical protein TRIADDRAFT_50999              186   6e-52    Trichoplax adhaerens
ref|XP_003462749.1|  PREDICTED: protein disulfide-isomerase A6 is...    186   6e-52    Cavia porcellus [guinea pig]
ref|NP_001086643.1|  protein disulfide isomerase family A, member...    186   6e-52    Xenopus laevis [clawed frog]
ref|XP_005506964.1|  PREDICTED: protein disulfide-isomerase A6          187   6e-52    
ref|XP_006191925.1|  PREDICTED: protein disulfide-isomerase A6          186   6e-52    Camelus ferus
gb|EHB04452.1|  Protein disulfide-isomerase A6                          186   7e-52    Heterocephalus glaber [naked mole rat]
gb|KFO31202.1|  Protein disulfide-isomerase A6                          186   7e-52    Fukomys damarensis [Damara mole rat]
ref|XP_005366580.1|  PREDICTED: protein disulfide-isomerase A6          186   7e-52    Microtus ochrogaster [prairie voles]
ref|XP_010962323.1|  PREDICTED: protein disulfide-isomerase A6          186   7e-52    Camelus bactrianus [camel]
ref|XP_008570350.1|  PREDICTED: protein disulfide-isomerase A6          186   7e-52    Galeopterus variegatus [Malayan flying lemur]
ref|XP_005238268.1|  PREDICTED: protein disulfide-isomerase A6          186   7e-52    
gb|EPQ08422.1|  Protein disulfide-isomerase A6                          186   8e-52    Myotis brandtii
ref|XP_005967905.1|  PREDICTED: protein disulfide-isomerase A6          186   8e-52    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004436529.1|  PREDICTED: protein disulfide-isomerase A6          186   8e-52    
gb|KFO87204.1|  Protein disulfide-isomerase A6                          186   8e-52    Buceros rhinoceros silvestris
gb|KFW73081.1|  Protein disulfide-isomerase A6                          186   8e-52    Pygoscelis adeliae
ref|XP_005085000.1|  PREDICTED: protein disulfide-isomerase A6          186   9e-52    Mesocricetus auratus [Syrian golden hamster]
gb|KFU90776.1|  Protein disulfide-isomerase A6                          186   9e-52    Chaetura pelagica
ref|XP_006197174.1|  PREDICTED: protein disulfide-isomerase A6          186   1e-51    Vicugna pacos
ref|XP_005867329.1|  PREDICTED: protein disulfide-isomerase A6          186   1e-51    
ref|XP_006765261.1|  PREDICTED: protein disulfide-isomerase A6          187   1e-51    
gb|EGW08481.1|  Protein disulfide-isomerase A6                          181   1e-51    Cricetulus griseus [Chinese hamsters]
ref|XP_010850414.1|  PREDICTED: protein disulfide-isomerase A6          187   1e-51    Bison bison bison
gb|KFW86281.1|  Protein disulfide-isomerase A6                          184   1e-51    Phalacrocorax carbo [common cormorant]
ref|XP_009330780.1|  PREDICTED: protein disulfide-isomerase A6          186   1e-51    Pygoscelis adeliae
tpg|DAA24511.1|  TPA: protein disulfide isomerase family A, member 6    188   1e-51    Bos taurus [bovine]
ref|XP_004686132.1|  PREDICTED: protein disulfide-isomerase A6          187   1e-51    
ref|XP_010130331.1|  PREDICTED: protein disulfide-isomerase A6          186   1e-51    Buceros rhinoceros silvestris
gb|KFQ44656.1|  Protein disulfide-isomerase A6                          186   1e-51    Nestor notabilis
ref|XP_004887060.1|  PREDICTED: protein disulfide-isomerase A6          186   1e-51    
ref|XP_010018621.1|  PREDICTED: protein disulfide-isomerase A6          185   1e-51    Nestor notabilis
gb|KFM05020.1|  Protein disulfide-isomerase A6                          185   1e-51    Aptenodytes forsteri
ref|XP_009273886.1|  PREDICTED: protein disulfide-isomerase A6          185   1e-51    
gb|KFQ08834.1|  Protein disulfide-isomerase A6                          185   1e-51    Leptosomus discolor
ref|XP_005146160.1|  PREDICTED: protein disulfide-isomerase A6          186   1e-51    Melopsittacus undulatus
ref|XP_009946939.1|  PREDICTED: protein disulfide-isomerase A6          185   1e-51    Leptosomus discolor
gb|KFP92383.1|  Protein disulfide-isomerase A6                          185   2e-51    Apaloderma vittatum
ref|NP_001004442.1|  protein disulfide-isomerase A6 precursor           185   2e-51    Rattus norvegicus [brown rat]
emb|CAA55891.1|  CaBP1                                                  185   2e-51    Rattus norvegicus [brown rat]
ref|XP_009997534.1|  PREDICTED: protein disulfide-isomerase A6          186   2e-51    Chaetura pelagica
ref|NP_001182048.1|  protein disulfide-isomerase A6 precursor           185   2e-51    Sus scrofa [pigs]
ref|XP_006073828.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    188   2e-51    
ref|XP_009874965.1|  PREDICTED: protein disulfide-isomerase A6          185   2e-51    Apaloderma vittatum
gb|KFV46902.1|  Protein disulfide-isomerase A6                          185   2e-51    Tyto alba [Schleiereule]
ref|XP_005432317.1|  PREDICTED: protein disulfide-isomerase A6          185   2e-51    
ref|XP_001502324.3|  PREDICTED: protein disulfide-isomerase A6          185   2e-51    
sp|Q63081.2|PDIA6_RAT  RecName: Full=Protein disulfide-isomerase ...    185   2e-51    Rattus norvegicus [brown rat]
ref|XP_009513284.1|  PREDICTED: protein disulfide-isomerase A6          184   2e-51    Phalacrocorax carbo [common cormorant]
ref|XP_007127699.1|  PREDICTED: protein disulfide-isomerase A6          185   2e-51    
ref|XP_004746019.1|  PREDICTED: protein disulfide-isomerase A6          185   2e-51    
ref|XP_009463744.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    185   2e-51    Nipponia nippon
gb|KFO65258.1|  Protein disulfide-isomerase A6                          185   2e-51    Corvus brachyrhynchos
ref|XP_006140909.1|  PREDICTED: protein disulfide-isomerase A6          187   2e-51    
ref|XP_006903376.1|  PREDICTED: protein disulfide-isomerase A6-like     186   2e-51    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007456979.1|  PREDICTED: protein disulfide-isomerase A6          185   2e-51    Lipotes vexillifer [baiji]
gb|KFQ83261.1|  Protein disulfide-isomerase A6                          185   2e-51    Phoenicopterus ruber ruber
ref|XP_005645986.1|  protein disulfide isomerase                        184   2e-51    Coccomyxa subellipsoidea C-169
ref|XP_009961799.1|  PREDICTED: protein disulfide-isomerase A6          185   2e-51    Tyto alba [Schleiereule]
ref|XP_004665748.1|  PREDICTED: protein disulfide-isomerase A6          184   3e-51    Jaculus jaculus
ref|XP_010391624.1|  PREDICTED: protein disulfide-isomerase A6          184   3e-51    Corvus cornix cornix
ref|XP_008639999.1|  PREDICTED: protein disulfide-isomerase A6          184   3e-51    Corvus brachyrhynchos
ref|XP_532876.2|  PREDICTED: protein disulfide-isomerase A6             184   3e-51    Canis lupus familiaris [dogs]
ref|XP_006102414.1|  PREDICTED: protein disulfide-isomerase A6          186   3e-51    
ref|XP_010114738.1|  PREDICTED: protein disulfide-isomerase A6          184   3e-51    Chlamydotis macqueenii
gb|KFP35427.1|  Protein disulfide-isomerase A6                          184   3e-51    Chlamydotis macqueenii
gb|ELK13980.1|  Protein disulfide-isomerase A6                          185   3e-51    Pteropus alecto
ref|XP_006021844.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    184   3e-51    
ref|XP_007607763.1|  PREDICTED: protein disulfide-isomerase A6          184   3e-51    
ref|XP_004373116.1|  PREDICTED: protein disulfide-isomerase A6          184   3e-51    Trichechus manatus latirostris
ref|XP_005521916.1|  PREDICTED: protein disulfide-isomerase A6 is...    184   3e-51    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005521917.1|  PREDICTED: protein disulfide-isomerase A6 is...    184   4e-51    
ref|XP_006976688.1|  PREDICTED: protein disulfide-isomerase A6          187   4e-51    Peromyscus maniculatus bairdii
gb|KFR16570.1|  Protein disulfide-isomerase A6                          184   4e-51    Opisthocomus hoazin [hoatzin]
ref|XP_009940378.1|  PREDICTED: protein disulfide-isomerase A6          184   5e-51    Opisthocomus hoazin [hoatzin]
gb|EPY75602.1|  protein disulfide-isomerase A6                          186   5e-51    Camelus ferus
gb|KFV66878.1|  Protein disulfide-isomerase A6                          184   6e-51    Picoides pubescens
gb|KFO12540.1|  Protein disulfide-isomerase A6                          184   6e-51    Balearica regulorum gibbericeps
ref|XP_010304195.1|  PREDICTED: protein disulfide-isomerase A6          184   6e-51    Balearica regulorum gibbericeps
gb|KFQ57711.1|  Protein disulfide-isomerase A6                          184   6e-51    Pelecanus crispus
ref|XP_004401842.1|  PREDICTED: protein disulfide-isomerase A6          184   6e-51    Odobenus rosmarus divergens
gb|KFP66932.1|  Protein disulfide-isomerase A6                          184   7e-51    Cariama cristata
ref|XP_009898142.1|  PREDICTED: protein disulfide-isomerase A6          184   7e-51    Picoides pubescens
ref|XP_009489926.1|  PREDICTED: protein disulfide-isomerase A6          183   7e-51    Pelecanus crispus
ref|XP_009702308.1|  PREDICTED: protein disulfide-isomerase A6          183   8e-51    Cariama cristata
gb|KFO95889.1|  Protein disulfide-isomerase A6                          183   8e-51    Calypte anna
ref|XP_003984581.1|  PREDICTED: protein disulfide-isomerase A6          183   8e-51    
ref|XP_006745860.1|  PREDICTED: protein disulfide-isomerase A6          183   9e-51    Leptonychotes weddellii
gb|KFV71961.1|  Protein disulfide-isomerase A6                          183   9e-51    Struthio camelus australis
ref|XP_009557934.1|  PREDICTED: protein disulfide-isomerase A6          183   9e-51    Cuculus canorus
gb|KFO75223.1|  Protein disulfide-isomerase A6                          183   9e-51    Cuculus canorus
dbj|BAJ90795.1|  predicted protein                                      183   9e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFV15259.1|  Protein disulfide-isomerase A6                          183   1e-50    Tauraco erythrolophus
ref|XP_008493616.1|  PREDICTED: protein disulfide-isomerase A6          183   1e-50    Calypte anna
gb|KFP16755.1|  Protein disulfide-isomerase A6                          183   1e-50    Egretta garzetta
ref|XP_007423659.1|  PREDICTED: protein disulfide-isomerase A6          183   1e-50    Python bivittatus
gb|KFQ26878.1|  Protein disulfide-isomerase A6                          183   1e-50    Merops nubicus
ref|XP_009913272.1|  PREDICTED: protein disulfide-isomerase A6          183   1e-50    Haliaeetus albicilla
gb|KFQ00948.1|  Protein disulfide-isomerase A6                          183   1e-50    Haliaeetus albicilla
ref|XP_009981655.1|  PREDICTED: protein disulfide-isomerase A6          183   1e-50    Tauraco erythrolophus
ref|XP_010564977.1|  PREDICTED: protein disulfide-isomerase A6          183   1e-50    Haliaeetus leucocephalus
ref|XP_011575233.1|  PREDICTED: protein disulfide-isomerase A6          183   1e-50    Aquila chrysaetos canadensis
emb|CAJ82905.1|  protein disulfide isomerase family A, member 6         183   1e-50    Xenopus tropicalis [western clawed frog]
ref|XP_006910476.1|  PREDICTED: protein disulfide-isomerase A6          184   1e-50    
ref|XP_009638086.1|  PREDICTED: protein disulfide-isomerase A6          183   1e-50    Egretta garzetta
gb|KFV91574.1|  Protein disulfide-isomerase A6                          182   1e-50    Eurypyga helias
gb|KGL97075.1|  Protein disulfide-isomerase A6                          182   1e-50    Charadrius vociferus
gb|KFW88870.1|  Protein disulfide-isomerase A6                          182   2e-50    Manacus vitellinus
ref|XP_008930983.1|  PREDICTED: protein disulfide-isomerase A6          182   2e-50    
ref|XP_008935557.1|  PREDICTED: protein disulfide-isomerase A6          182   2e-50    Merops nubicus
ref|XP_002921563.2|  PREDICTED: protein disulfide-isomerase A6          184   2e-50    Ailuropoda melanoleuca
ref|XP_010145729.1|  PREDICTED: protein disulfide-isomerase A6          182   2e-50    Eurypyga helias
ref|XP_009666708.1|  PREDICTED: protein disulfide-isomerase A6          182   2e-50    
gb|KFV41194.1|  Protein disulfide-isomerase A6                          182   2e-50    
ref|XP_009806227.1|  PREDICTED: protein disulfide-isomerase A6          182   3e-50    
ref|XP_011816364.1|  PREDICTED: protein disulfide-isomerase A6          181   3e-50    
ref|XP_010166959.1|  PREDICTED: protein disulfide-isomerase A6          180   3e-50    
ref|NP_001007974.1|  protein disulfide-isomerase A6 precursor           181   4e-50    
ref|XP_009888074.1|  PREDICTED: protein disulfide-isomerase A6          182   4e-50    
ref|XP_011363442.1|  PREDICTED: protein disulfide-isomerase A6          184   5e-50    
gb|KFQ39965.1|  Protein disulfide-isomerase A6                          181   5e-50    
ref|XP_007640104.1|  PREDICTED: protein disulfide-isomerase A6          181   6e-50    
gb|KFZ68639.1|  Protein disulfide-isomerase A6                          181   6e-50    
gb|KFP27162.1|  Protein disulfide-isomerase A6                          181   7e-50    
ref|XP_010206382.1|  PREDICTED: protein disulfide-isomerase A6          181   8e-50    
ref|XP_008528120.1|  PREDICTED: protein disulfide-isomerase A6          181   8e-50    
ref|XP_003757912.1|  PREDICTED: protein disulfide-isomerase A6          181   8e-50    
gb|ADK26725.1|  protein disulfide isomerase family A, member 6          180   1e-49    
gb|ADK26817.1|  protein disulfide isomerase family A, member 6          180   1e-49    
gb|ETE67495.1|  Protein disulfide-isomerase A6                          180   1e-49    
ref|XP_007476199.1|  PREDICTED: protein disulfide-isomerase A6          180   1e-49    
ref|XP_005487254.1|  PREDICTED: protein disulfide-isomerase A6 is...    180   1e-49    
ref|XP_010189304.1|  PREDICTED: protein disulfide-isomerase A6          181   1e-49    
gb|KIZ01312.1|  protein disulfide isomerase family A, member 6          183   1e-49    
ref|XP_006012215.1|  PREDICTED: protein disulfide-isomerase A6 is...    180   1e-49    
ref|XP_005487253.1|  PREDICTED: protein disulfide-isomerase A6 is...    180   2e-49    
ref|XP_001948267.2|  PREDICTED: protein disulfide-isomerase A6          179   2e-49    
ref|XP_009093512.1|  PREDICTED: protein disulfide-isomerase A6          179   2e-49    
ref|XP_010836180.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    179   2e-49    
ref|XP_004582660.1|  PREDICTED: protein disulfide-isomerase A6 is...    179   2e-49    
gb|KGL83930.1|  Protein disulfide-isomerase A6                          179   2e-49    
gb|ACI33422.1|  disulfide-isomerase A6 precursor                        179   2e-49    
ref|XP_008248061.1|  PREDICTED: protein disulfide-isomerase A6          179   3e-49    
ref|XP_004211312.1|  PREDICTED: protein disulfide-isomerase A6-like     179   3e-49    
ref|XP_004582659.1|  PREDICTED: protein disulfide-isomerase A6 is...    179   3e-49    
ref|XP_010222649.1|  PREDICTED: protein disulfide-isomerase A6          179   3e-49    
ref|XP_002196421.2|  PREDICTED: protein disulfide-isomerase A6          179   3e-49    
ref|XP_005420347.1|  PREDICTED: protein disulfide-isomerase A6          179   3e-49    
ref|XP_005293176.1|  PREDICTED: protein disulfide-isomerase A6          179   3e-49    
gb|EHJ66984.1|  hypothetical protein KGM_18501                          178   5e-49    
emb|CDQ71639.1|  unnamed protein product                                178   6e-49    
ref|XP_006138598.1|  PREDICTED: protein disulfide-isomerase A6          178   7e-49    
gb|EFB24563.1|  hypothetical protein PANDA_010457                       177   9e-49    
ref|XP_007195772.1|  PREDICTED: protein disulfide-isomerase A6          177   9e-49    
ref|XP_001690462.1|  protein disulfide isomerase                        178   1e-48    
ref|XP_003215468.2|  PREDICTED: protein disulfide-isomerase A6          179   1e-48    
ref|XP_008287318.1|  PREDICTED: protein disulfide-isomerase A6          177   1e-48    
gb|KDR20898.1|  Protein disulfide-isomerase A6                          177   1e-48    
ref|XP_007902471.1|  PREDICTED: protein disulfide-isomerase A6-like     178   1e-48    
ref|XP_001996440.1|  GH25032                                            177   1e-48    
tpg|DAA24981.1|  TPA: PDIA6 protein-like                                177   2e-48    
ref|XP_007668730.1|  PREDICTED: protein disulfide-isomerase A6          177   4e-48    
ref|XP_007053233.1|  PREDICTED: protein disulfide-isomerase A6          176   4e-48    
ref|XP_011489880.1|  PREDICTED: protein disulfide-isomerase A6 is...    176   4e-48    
ref|XP_004083501.1|  PREDICTED: protein disulfide-isomerase A6 is...    176   4e-48    
ref|XP_008063733.1|  PREDICTED: protein disulfide-isomerase A6          178   5e-48    
gb|EFA11123.1|  hypothetical protein TcasGA2_TC004723                   176   6e-48    
ref|XP_008200598.1|  PREDICTED: protein disulfide-isomerase A6          175   7e-48    
ref|XP_005963820.1|  PREDICTED: protein disulfide-isomerase A6-like     175   8e-48    
ref|XP_011301143.1|  PREDICTED: protein disulfide-isomerase A6          175   1e-47    
ref|XP_012055150.1|  PREDICTED: protein disulfide-isomerase A6          175   1e-47    
sp|P38660.1|PDIA6_MESAU  RecName: Full=Protein disulfide-isomeras...    175   1e-47    
gb|KIH43421.1|  hypothetical protein ANCDUO_26572                       169   1e-47    
ref|XP_790496.3|  PREDICTED: probable protein disulfide-isomerase A6    175   2e-47    
gb|ETN79262.1|  protein disulfide-isomerase domain protein              174   2e-47    
ref|XP_011062424.1|  PREDICTED: protein disulfide-isomerase A6          174   2e-47    
gb|KHN88358.1|  putative protein disulfide-isomerase A6                 174   3e-47    
ref|XP_002586165.1|  hypothetical protein BRAFLDRAFT_289141             174   3e-47    
ref|XP_003971872.1|  PREDICTED: protein disulfide-isomerase A6 is...    174   4e-47    
ref|XP_011610543.1|  PREDICTED: protein disulfide-isomerase A6 is...    174   4e-47    
ref|XP_001602967.1|  PREDICTED: probable protein disulfide-isomer...    173   5e-47    
ref|XP_395981.2|  PREDICTED: protein disulfide-isomerase A6-like ...    173   5e-47    
ref|XP_001744606.1|  hypothetical protein                               173   5e-47    
ref|XP_002002212.1|  GI13846                                            173   5e-47    
ref|XP_006612487.1|  PREDICTED: protein disulfide-isomerase A6-like     173   6e-47    
ref|XP_001660597.1|  AAEL010065-PA                                      173   6e-47    
ref|XP_006792592.1|  PREDICTED: protein disulfide-isomerase A6-li...    173   7e-47    
ref|XP_006792591.1|  PREDICTED: protein disulfide-isomerase A6-li...    173   7e-47    
gb|ACN60302.1|  disulfide-isomerase A6 precursor                        167   7e-47    
gb|ADD24382.1|  Probable protein disulfide-isomerase A6                 172   7e-47    
ref|XP_008543798.1|  PREDICTED: protein disulfide-isomerase A6          172   8e-47    
ref|XP_011397768.1|  Protein disulfide-isomerase like 2-2               178   1e-46    
ref|XP_001629218.1|  predicted protein                                  172   1e-46    
ref|XP_005731103.1|  PREDICTED: protein disulfide-isomerase A6-like     172   1e-46    
ref|XP_011689873.1|  PREDICTED: protein disulfide-isomerase A6          172   2e-46    
ref|XP_003693801.1|  PREDICTED: protein disulfide-isomerase A6-like     171   2e-46    
gb|EFX87790.1|  hypothetical protein DAPPUDRAFT_306380                  171   2e-46    
ref|XP_004568810.1|  PREDICTED: protein disulfide-isomerase A6-li...    172   2e-46    
ref|XP_011647781.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    172   2e-46    
ref|XP_004568809.1|  PREDICTED: protein disulfide-isomerase A6-li...    172   2e-46    
ref|XP_011563070.1|  PREDICTED: protein disulfide-isomerase A6          171   3e-46    
ref|XP_011160406.1|  PREDICTED: protein disulfide-isomerase A6          171   3e-46    
gb|KKA74764.1|  Thioredoxin                                             171   3e-46    
ref|XP_011139061.1|  PREDICTED: protein disulfide-isomerase A6 is...    171   3e-46    
ref|XP_007260937.1|  PREDICTED: protein disulfide-isomerase A6-like     166   4e-46    
ref|XP_011343321.1|  PREDICTED: protein disulfide-isomerase A6 is...    170   4e-46    
gb|KFB40746.1|  hypothetical protein ZHAS_00008173                      171   4e-46    
emb|CAG03659.1|  unnamed protein product                                171   4e-46    
ref|XP_003458276.1|  PREDICTED: protein disulfide-isomerase A6-like     171   5e-46    
ref|XP_011343320.1|  PREDICTED: protein disulfide-isomerase A6 is...    170   6e-46    
ref|XP_011139060.1|  PREDICTED: protein disulfide-isomerase A6 is...    170   6e-46    
gb|EPB78680.1|  protein disulfide-isomerase domain protein              170   6e-46    
ref|XP_002052260.1|  GJ17455                                            170   6e-46    
emb|CDJ95511.1|  Thioredoxin domain containing protein                  170   7e-46    
ref|XP_004932411.1|  PREDICTED: protein disulfide-isomerase A6-like     169   8e-46    
ref|XP_003398403.1|  PREDICTED: protein disulfide-isomerase A6-like     170   8e-46    
ref|XP_007546385.1|  PREDICTED: protein disulfide-isomerase A6 is...    170   9e-46    
ref|XP_007546392.1|  PREDICTED: protein disulfide-isomerase A6 is...    170   1e-45    
gb|EMP42001.1|  Protein disulfide-isomerase A6                          170   1e-45    
gb|EYB96326.1|  hypothetical protein Y032_0151g2809                     170   1e-45    
ref|XP_010887778.1|  PREDICTED: protein disulfide-isomerase A6          169   1e-45    
ref|XP_005803193.1|  PREDICTED: protein disulfide-isomerase A6-li...    169   1e-45    
ref|XP_005803194.1|  PREDICTED: protein disulfide-isomerase A6-li...    169   1e-45    
ref|XP_009045951.1|  hypothetical protein LOTGIDRAFT_151365             169   2e-45    
ref|XP_001848695.1|  disulfide-isomerase A6                             169   2e-45    
ref|XP_011505126.1|  PREDICTED: probable protein disulfide-isomer...    169   2e-45    
ref|XP_002428877.1|  protein disulfide isomerase, putative              169   2e-45    
ref|XP_003388369.1|  PREDICTED: probable protein disulfide-isomer...    169   3e-45    
ref|XP_011881632.1|  PREDICTED: protein disulfide-isomerase A6          168   4e-45    
ref|XP_003488434.1|  PREDICTED: protein disulfide-isomerase A6-like     168   4e-45    
ref|XP_011206958.1|  PREDICTED: protein disulfide-isomerase A6          168   5e-45    
gb|ETN58364.1|  protein disulfide-isomerase A6 precursor                167   6e-45    
ref|XP_002015314.1|  GL18482                                            167   7e-45    
ref|XP_006818500.1|  PREDICTED: protein disulfide-isomerase A6-like     160   7e-45    
ref|XP_011446200.1|  PREDICTED: protein disulfide-isomerase A6-like     167   9e-45    
ref|XP_004518575.1|  PREDICTED: protein disulfide-isomerase A6-like     167   1e-44    
ref|XP_003706812.1|  PREDICTED: protein disulfide-isomerase A6          167   1e-44    
gb|ACI34364.1|  disulfide-isomerase A6 precursor                        167   1e-44    
ref|XP_008395804.1|  PREDICTED: protein disulfide-isomerase A6 is...    167   1e-44    
ref|XP_007257385.1|  PREDICTED: protein disulfide-isomerase A6          167   1e-44    
ref|XP_008395805.1|  PREDICTED: protein disulfide-isomerase A6 is...    167   1e-44    
emb|CDQ62935.1|  unnamed protein product                                166   2e-44    
ref|XP_008311310.1|  PREDICTED: protein disulfide-isomerase A6          166   2e-44    
ref|XP_003744350.1|  PREDICTED: protein disulfide-isomerase A6-like     166   2e-44    
ref|XP_002038169.1|  GM17901                                            166   2e-44    
ref|XP_001356908.2|  GA19146                                            166   2e-44    
ref|XP_321144.3|  AGAP001919-PA                                         166   2e-44    
gb|KHJ93089.1|  protein disulfide-isomerase domain protein              166   3e-44    
gb|ELT97169.1|  hypothetical protein CAPTEDRAFT_222278                  165   5e-44    
ref|XP_011269957.1|  hypothetical protein CAOG_08387                    163   5e-44    
emb|CEF61969.1|  Protein disulfide-isomerase A6                         165   5e-44    
emb|CDW52124.1|  protein disulfide isomerase A6                         165   7e-44    
ref|XP_010738984.1|  PREDICTED: protein disulfide-isomerase A6          165   8e-44    
ref|XP_011294207.1|  PREDICTED: probable protein disulfide-isomer...    164   8e-44    
ref|XP_003117834.1|  CRE-TAG-320 protein                                164   9e-44    
ref|NP_001265732.1|  protein disulfide-isomerase A6 precursor           164   9e-44    
gb|ERL94682.1|  hypothetical protein D910_11957                         164   1e-43    
gb|ENN76828.1|  hypothetical protein YQE_06669                          164   1e-43    
gb|EJW84631.1|  hypothetical protein WUBG_04457                         161   1e-43    
ref|XP_002090414.1|  GE12817                                            164   1e-43    
ref|NP_609792.1|  calcium-binding protein 1, isoform A                  164   1e-43    
gb|AAK71636.1|AF387900_1  protein disulfide isomerase-related pro...    164   1e-43    
ref|XP_001965403.1|  GF20619                                            164   1e-43    
ref|XP_008487078.1|  PREDICTED: protein disulfide-isomerase A6-like     164   2e-43    
ref|XP_002079636.1|  GD21912                                            164   2e-43    
ref|XP_001976216.1|  GG20128                                            164   2e-43    
ref|XP_002587888.1|  hypothetical protein BRAFLDRAFT_124879             165   3e-43    
gb|KHJ46223.1|  protein disulfide-isomerase domain protein              163   3e-43    
ref|NP_922915.2|  protein disulfide-isomerase A6 precursor              162   5e-43    
gb|KFD51103.1|  hypothetical protein M513_08003                         163   5e-43    
ref|XP_003138581.1|  TAG-320 protein                                    162   6e-43    
gb|EFO25483.2|  TAG-320 protein                                         162   6e-43    
ref|XP_002408975.1|  protein disulfide isomerase 1, putative            161   1e-42    
ref|XP_005845285.1|  hypothetical protein CHLNCDRAFT_136996             162   1e-42    
ref|XP_011266529.1|  PREDICTED: protein disulfide-isomerase A6          161   2e-42    
dbj|BAF63672.1|  protein disulfide isomerase-1                          160   2e-42    
ref|XP_011187125.1|  PREDICTED: probable protein disulfide-isomer...    160   3e-42    
ref|XP_003741496.1|  PREDICTED: protein disulfide-isomerase A6-like     163   4e-42    
ref|XP_002066865.1|  GK24326                                            159   6e-42    
ref|XP_004994815.1|  Pdip5 protein                                      159   9e-42    
ref|NP_509190.1|  Protein TAG-320                                       159   1e-41    
gb|KJH43805.1|  protein disulfide-isomerase domain protein              160   1e-41    
gb|KFM68865.1|  Protein disulfide-isomerase A6                          159   1e-41    
emb|CDP96040.1|  Protein BM-TAG-320, isoform b                          158   2e-41    
gb|EGT52939.1|  CBN-TAG-320 protein                                     158   2e-41    
ref|XP_001898144.1|  Probable protein disulfide isomerase A6 prec...    158   3e-41    
gb|EFN84761.1|  Protein disulfide-isomerase A6                          157   3e-41    
gb|AEB26317.1|  protein disulfide isomerase                             157   4e-41    
gb|EMS60415.1|  hypothetical protein TRIUR3_13550                       149   4e-41    
ref|XP_002644986.1|  C. briggsae CBR-TAG-320 protein                    157   4e-41    
gb|EUB64344.1|  putative protein disulfide-isomerase A6                 157   5e-41    
ref|XP_010781928.1|  PREDICTED: protein disulfide-isomerase A6          157   6e-41    
ref|XP_005108921.1|  PREDICTED: protein disulfide-isomerase A6-like     157   6e-41    
ref|XP_009009748.1|  hypothetical protein HELRODRAFT_63467              156   9e-41    
gb|AGX25157.1|  disulfide-isomerase                                     150   9e-41    
emb|CDS17285.1|  protein disulfide isomerase A6                         157   1e-40    
emb|CDJ05042.1|  protein disulfide isomerase A6                         157   1e-40    
gb|KJE88440.1|  dolichyl-diphosphooligosaccharide-protein glycosy...    160   1e-40    
emb|CDI95688.1|  protein disulfide isomerase A6                         155   3e-40    
gb|KDD74013.1|  hypothetical protein H632_c1651p0                       152   2e-39    
ref|XP_008686251.1|  PREDICTED: protein disulfide-isomerase A6          153   3e-39    
gb|EDK98488.1|  protein disulfide isomerase associated 6, isoform...    151   4e-39    
dbj|BAB24354.1|  unnamed protein product                                151   4e-39    
gb|EDK98487.1|  protein disulfide isomerase associated 6, isoform...    151   5e-39    
emb|CAX70321.1|  hypothetical protein                                   150   8e-39    
gb|ADY90107.1|  protein disulfide isomerase A6                          150   1e-38    
dbj|BAM19465.1|  protein disulfide-isomerase A6 precursor               148   1e-38    
emb|CAX70320.1|  hypothetical protein                                   150   2e-38    
gb|AAW25458.1|  SJCHGC05888 protein                                     150   2e-38    
ref|XP_006817847.1|  PREDICTED: protein disulfide-isomerase A6-like     147   2e-38    
ref|XP_011508610.1|  PREDICTED: protein disulfide-isomerase A6 is...    149   3e-38    
emb|CBN79875.1|  expressed unknown protein                              146   4e-38    
ref|XP_009857523.1|  PREDICTED: protein disulfide-isomerase A6-like     149   5e-38    
gb|ELW72031.1|  Protein disulfide-isomerase A6                          147   2e-37    
gb|KGB39409.1|  putative protein disulfide-isomerase A6                 145   3e-37    
ref|XP_007895303.1|  PREDICTED: protein disulfide-isomerase A6          146   5e-37    
ref|XP_002641016.1|  Hypothetical protein CBG11768                      142   1e-35    
ref|XP_004037455.1|  protein disulfide isomerase family protein, ...    140   1e-34    
gb|EGT53613.1|  hypothetical protein CAEBREN_31752                      139   1e-34    
ref|XP_006626132.1|  PREDICTED: protein disulfide-isomerase A6-like     137   2e-34    
ref|XP_009177268.1|  hypothetical protein T265_12068                    138   4e-34    
gb|KIH51511.1|  hypothetical protein ANCDUO_18403                       129   6e-33    
gb|EGT47278.1|  hypothetical protein CAEBREN_31162                      134   1e-32    
dbj|GAA54880.1|  protein disulfide-isomerase A6                         134   2e-32    
ref|XP_008609528.1|  hypothetical protein SDRG_05583                    132   4e-32    
ref|XP_001438686.1|  hypothetical protein                               131   8e-32    
dbj|BAD38009.1|  putative protein disulfide-isomerase A6 precursor      112   1e-31    
emb|CBY37570.1|  unnamed protein product                                131   1e-31    
emb|CBY07145.1|  unnamed protein product                                131   1e-31    
ref|NP_499613.1|  Protein Y49E10.4                                      131   1e-31    
ref|XP_008864870.1|  protein disulfide-isomerase domain                 130   2e-31    
ref|XP_003094567.1|  hypothetical protein CRE_30155                     130   2e-31    
ref|XP_001010336.1|  protein disulfide-isomerase domain containin...    129   4e-31    



>ref|XP_010913398.1| PREDICTED: protein disulfide isomerase-like 2-3 [Elaeis guineensis]
Length=429

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/221 (81%), Positives = 198/221 (90%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFG DKD P PY GAR ASAIES+ALEQ+E NV+PPEV+
Sbjct  210  DCDAEKSLMSRFNVQGFPTILVFGIDKDSPYPYEGARVASAIESFALEQVETNVAPPEVS  269

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC+SAA+CFVAFLPDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAA
Sbjct  270  ELTGPDVMEEKCASAAICFVAFLPDILDSKAEGRNKYLELLLSVAEKFKRSPYSYVWAAA  329

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPALV L+VK  +YAPL+S+FQHD I EFV+E G  GG+G NLP
Sbjct  330  GKQPDLEKQVGVGGYGYPALVALNVKKGIYAPLRSAFQHDQIMEFVKEAGR-GGKG-NLP  387

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TP++++TEPWDGKDGEI+EEDEFSLEELMG+DT  KDE
Sbjct  388  LEKTPSVIQTEPWDGKDGEIIEEDEFSLEELMGEDTATKDE  428



>ref|XP_009606235.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana tomentosiformis]
Length=432

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 197/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADKD PVPY GARTASAIES+ LEQLE NV+PPEV 
Sbjct  213  DCDAEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFGLEQLETNVAPPEVI  272

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYSYVW AA
Sbjct  273  ELTNPDVMEEKCNSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRNPYSYVWVAA  332

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEKHVGVGGYGYPA+V L+VK  VYAPLKS+FQ   I +FV+E G LGG+G NLP
Sbjct  333  GKQPDLEKHVGVGGYGYPAMVALNVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLP  390

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TP+IVKTE WDGKDGEI+EEDEFSLEELMGDDT NKDE
Sbjct  391  LAATPSIVKTEAWDGKDGEIIEEDEFSLEELMGDDTPNKDE  431



>ref|XP_002320494.2| thioredoxin family protein [Populus trichocarpa]
 gb|EEE98809.2| thioredoxin family protein [Populus trichocarpa]
Length=434

 Score =   369 bits (948),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 196/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD P+PY GARTASAIES+ALEQLE NV+PPEVT
Sbjct  215  DCDSEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLESNVAPPEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAA
Sbjct  275  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRNKYLEQLLSVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+ K   YAPLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  335  GKQPDLENRVGVGGYGYPALVALNAKKGAYAPLKSAFELEHIVEFVKEAGR-GGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G P IVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  393  LNGNPEIVKTEPWDGKDGEIIEEDEFSLEELMGEDAGSKDE  433



>ref|XP_004491086.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Cicer arietinum]
Length=436

 Score =   369 bits (948),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 179/221 (81%), Positives = 199/221 (90%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADKD P+PY GAR+ASAIES+ALEQLE NV+PPEVT
Sbjct  217  DCDAEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARSASAIESFALEQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL   DV+EEKC SAA+CFVAFLPDILDSKAEGRNKYL+ LLSVAEKFK  PYSYVW AA
Sbjct  277  ELHSADVLEEKCGSAAICFVAFLPDILDSKAEGRNKYLQQLLSVAEKFKRSPYSYVWVAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK+VGVGGYGYPALV L++K  VYAPLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  337  GKQPDLEKNVGVGGYGYPALVALNIKKAVYAPLKSAFELEHIIEFVKEAGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L+GTPTIVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  395  LSGTPTIVKTEPWDGKDGEIIEEDEFSLEELMGEDASSKDE  435



>ref|XP_011085485.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=432

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 199/221 (90%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADKD P PY GAR+ASAIES+ALEQLE N +PPEVT
Sbjct  213  DCDAEKSLMSRFNVQGFPTILVFGADKDSPFPYEGARSASAIESFALEQLETNSAPPEVT  272

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PDV+EEKC SAA+CFVAFLPDILDSKAEGRNKYLE LLSVAEKF+  PYSY+WAAA
Sbjct  273  ELTSPDVLEEKCGSAAICFVAFLPDILDSKAEGRNKYLELLLSVAEKFRKSPYSYLWAAA  332

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEKHVGVGGYGYPALV L++K + YAPL+S+F+ DHI EFV+E G  GG+G  +P
Sbjct  333  GKQPDLEKHVGVGGYGYPALVALNLKKKAYAPLRSAFERDHIIEFVKEAGR-GGKGI-VP  390

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G+P IVKTEPWDGKDG+I+EEDEFSLEELMGDD+V+KDE
Sbjct  391  LEGSPVIVKTEPWDGKDGQIIEEDEFSLEELMGDDSVSKDE  431



>ref|XP_009804684.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana sylvestris]
Length=432

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 197/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSR++VQGFPTILVFGADK+ PVPY GARTA+AIES+ LEQLE NV+PPEV 
Sbjct  213  DCDAEKSLMSRYNVQGFPTILVFGADKESPVPYEGARTAAAIESFGLEQLETNVAPPEVI  272

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYSYVW AA
Sbjct  273  ELTSPDVMEEKCNSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRNPYSYVWVAA  332

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEKHVGVGGYGYPA+V L+VK  VYAPLKS+FQ   I +FV+E G LGG+G NLP
Sbjct  333  GKQPDLEKHVGVGGYGYPAMVALNVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLP  390

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TP+IVKTE WDGKDGEI+EEDEFSLEELMGDDT NKDE
Sbjct  391  LAATPSIVKTEAWDGKDGEIIEEDEFSLEELMGDDTPNKDE  431



>ref|XP_012080662.1| PREDICTED: protein disulfide isomerase-like 2-3 [Jatropha curcas]
 gb|KDP30825.1| hypothetical protein JCGZ_13768 [Jatropha curcas]
Length=434

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 197/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADKD P+PY GARTASAIES+AL+QLE NV+PPEVT
Sbjct  215  DCDAEKSLMSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALDQLETNVAPPEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKA GRNKYLE LLSVAEKFK  PYSYVWAAA
Sbjct  275  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAAGRNKYLEQLLSVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPALV L+VK   YAPLKS+F+ +HI EFV+E G  GG+G NL 
Sbjct  335  GKQPDLEKLVGVGGYGYPALVALNVKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLA  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP IVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  393  LGGTPEIVKTEPWDGKDGEIIEEDEFSLEELMGEDVGSKDE  433



>ref|XP_011003479.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/221 (81%), Positives = 196/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD P+PY GARTASAIES+ALEQLE NV+PPEVT
Sbjct  215  DCDSEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLESNVAPPEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC +AA+CF+AFLPDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAA
Sbjct  275  ELTGPDVMEEKCGTAAICFIAFLPDILDSKAEGRNKYLEQLLSVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+ K   YAPLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  335  GKQPDLENQVGVGGYGYPALVALNAKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G P IVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  393  LNGNPEIVKTEPWDGKDGEIIEEDEFSLEELMGEDAGSKDE  433



>ref|XP_004304072.1| PREDICTED: protein disulfide isomerase-like 2-3 [Fragaria vesca 
subsp. vesca]
Length=437

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 197/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAE+SLMSRF+VQGFPTILVFGADKD PVPY GARTASAIES+ALE+LE NV+PPEVT
Sbjct  217  DCDAEQSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALERLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDV+EEKC SAA+CFVAFLPDILDSKAEGRNKYL  LLSVAEKFK  PYSYVWAAA
Sbjct  277  ELTGPDVLEEKCGSAAICFVAFLPDILDSKAEGRNKYLHQLLSVAEKFKRSPYSYVWAAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLE  VGVGGYGYPALV L+VK  VYAPLKS+F+ D I EFVRE G  GG+G NLP
Sbjct  337  GKQQDLENLVGVGGYGYPALVALNVKKGVYAPLKSAFELDQITEFVREAGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP IVK+EPWDGKDGEI+EEDEFSLEELMG+DT +KDE
Sbjct  395  LNGTPNIVKSEPWDGKDGEIVEEDEFSLEELMGEDTNSKDE  435



>ref|XP_007049203.1| PDI-like 2-2 [Theobroma cacao]
 gb|EOX93360.1| PDI-like 2-2 [Theobroma cacao]
Length=434

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 195/221 (88%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD P+PY GARTASAIES+ALEQLE NV P EVT
Sbjct  215  DCDSEKSLMSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLETNVGPAEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAA
Sbjct  275  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRNKYLEMLLSVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE+ VGVGGYGYPALV L+VK   YAPLKS+F  +HI EFV+E G  GG+G NLP
Sbjct  335  GKQPDLERRVGVGGYGYPALVALNVKKGAYAPLKSAFGLEHIIEFVKEAGR-GGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP I KTEPW+GKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  393  LEGTPDIAKTEPWNGKDGEIIEEDEFSLEELMGEDIASKDE  433



>ref|XP_003519441.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Glycine 
max]
Length=438

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 197/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF VQGFPTILVFGADKD P+PY GARTASAIES+ALEQLE N++PPEVT
Sbjct  219  DCDAEKSLMSRFKVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLETNIAPPEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL  PDV+EEKC SAA+CFVAFLPDILDSKAEGRN+YL+ LLSVAEKFK  PYSYVW AA
Sbjct  279  ELYSPDVLEEKCGSAAICFVAFLPDILDSKAEGRNRYLQQLLSVAEKFKRSPYSYVWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK+VGVGGYGYPALV L++K  VYAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  339  GKQPDLEKNVGVGGYGYPALVALNLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + GTPTIVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  397  IEGTPTIVKTEPWDGKDGEIIEEDEFSLEELMGEDASSKDE  437



>ref|XP_009365136.1| PREDICTED: protein disulfide isomerase-like 2-3 [Pyrus x bretschneideri]
Length=435

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 195/221 (88%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS+F+VQGFPTILVFGADK+ P+PY GAR+ASAIES+ALEQLE NV+PPEVT
Sbjct  216  DCDAEKSLMSKFNVQGFPTILVFGADKESPLPYEGARSASAIESFALEQLETNVAPPEVT  275

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPD MEEKC SAA+CFVAFLPDILDSKAEGRNKY++ LLSVAEKFK  PYSYVWAAA
Sbjct  276  ELTGPDAMEEKCGSAAICFVAFLPDILDSKAEGRNKYIQQLLSVAEKFKRSPYSYVWAAA  335

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+ K   YAPLKS+F+ D I EFVRE G  GG+G NLP
Sbjct  336  GKQPDLENRVGVGGYGYPALVALNAKKGAYAPLKSAFEVDQITEFVREAGR-GGKG-NLP  393

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G P+IVK EPWDGKDG+I+EEDEFSLEELMG+DT NKDE
Sbjct  394  LEGIPSIVKIEPWDGKDGQILEEDEFSLEELMGEDTTNKDE  434



>ref|XP_008456396.1| PREDICTED: protein disulfide isomerase-like 2-3 [Cucumis melo]
Length=438

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 199/223 (89%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADKD P+PY GARTASAIES+AL+QLE NV+PPEVT
Sbjct  217  DCDAEKSLMSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALDQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVM+EKC+SAA+CFVAFLPDILDSKAEGRNKYLE LLSVAEKF+  PYSYVWAAA
Sbjct  277  ELTGSDVMDEKCASAAICFVAFLPDILDSKAEGRNKYLEQLLSVAEKFRRSPYSYVWAAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPALV L+VK   YAPLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  337  GKQPDLEKRVGVGGYGYPALVALNVKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMG--DDTVNKDE  127
            L  TP IVKTEPWDGKDGE++EEDEFSLEELMG  D+TV KDE
Sbjct  395  LESTPEIVKTEPWDGKDGEVIEEDEFSLEELMGGEDETVTKDE  437



>ref|XP_006357974.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Solanum 
tuberosum]
Length=432

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 196/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSR++VQGFPTILVFGADK+ PVPY GARTASAIES+ L+QLE NV+PPEV 
Sbjct  213  DCDAEKSLMSRYNVQGFPTILVFGADKESPVPYEGARTASAIESFGLQQLETNVAPPEVI  272

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LL+VAEKFK  PYS+VW  A
Sbjct  273  ELTSPDVMEEKCNSAAICFVSFLPDILDSKAEGRNKYLEMLLAVAEKFKRNPYSFVWVGA  332

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEKHVGVGGYGYPA+V L+VK  VYAPLKS+FQ   I +FV+E G LGG+G NLP
Sbjct  333  GKQPDLEKHVGVGGYGYPAMVALNVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLP  390

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TP+IVK EPWDGKDGEI+EEDEFSLEELMGDDT NKDE
Sbjct  391  LAATPSIVKNEPWDGKDGEIIEEDEFSLEELMGDDTPNKDE  431


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D DA KSL   + ++GFPTI VF   K  PV Y GAR A  I  YAL+Q++
Sbjct  85   DADAHKSLAQEYGIRGFPTIKVFAPGKP-PVDYQGAREAKPIAEYALQQIK  134



>ref|XP_011016519.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 196/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD P+PY GARTASAIES+ALEQL+ NV+PPEVT
Sbjct  215  DCDSEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLDSNVAPPEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC +AA+CFVAFLPDILDSKAEGRNKY+E LLSVAEKFK  PYSYVWAAA
Sbjct  275  ELTGPDVMEEKCGTAAICFVAFLPDILDSKAEGRNKYVEQLLSVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+ K   YAPLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  335  GKQPDLENRVGVGGYGYPALVALNAKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G P IVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  393  LNGNPEIVKTEPWDGKDGEIIEEDEFSLEELMGEDAGSKDE  433



>ref|XP_008342147.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=434

 Score =   365 bits (936),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 196/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS+F+VQGFPTILVFGADKD P+PY GAR+ASAIES+ALEQLE NV+PPEVT
Sbjct  215  DCDAEKSLMSKFNVQGFPTILVFGADKDSPLPYEGARSASAIESFALEQLETNVAPPEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKAEGRNKY++ LLSVAEKFK  PYS+VWAAA
Sbjct  275  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRNKYIQQLLSVAEKFKRSPYSFVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+ K   YAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  335  GKQPDLENRVGVGGYGYPALVALNAKKGAYAPLKSAFEVDQITEFVKEAGR-GGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP IVK EPWDGKDGEI+EEDEFSL+ELMG+DT NK+E
Sbjct  393  LEGTPNIVKIEPWDGKDGEIIEEDEFSLDELMGEDTTNKEE  433



>ref|XP_004243508.1| PREDICTED: protein disulfide isomerase-like 2-3 [Solanum lycopersicum]
Length=432

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 196/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSR++VQGFPTILVFGADK+ PV Y GARTASAIES+ LEQLE NV+PPEV 
Sbjct  213  DCDAEKSLMSRYNVQGFPTILVFGADKESPVTYEGARTASAIESFGLEQLETNVAPPEVV  272

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LL+VAEKFK  PYS+VW  A
Sbjct  273  ELTSPDVMEEKCNSAAICFVSFLPDILDSKAEGRNKYLEMLLAVAEKFKRNPYSFVWVGA  332

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEKHVGVGGYGYPA+V L+VK  VYAPLKS+FQ   I +FV+E G LGG+G NLP
Sbjct  333  GKQPDLEKHVGVGGYGYPAMVALNVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLP  390

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TP+IVK+EPWDGKDGEI+EEDEFSLEELMGDDT NKDE
Sbjct  391  LAATPSIVKSEPWDGKDGEIIEEDEFSLEELMGDDTPNKDE  431


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D DA KSL   + ++GFPTI VF   K  PV Y GAR A  I  YAL+Q++
Sbjct  85   DADAHKSLAQEYGIRGFPTIKVFAPGKP-PVDYQGAREAKPIAEYALQQIK  134



>ref|XP_008805603.1| PREDICTED: protein disulfide isomerase-like 2-3 [Phoenix dactylifera]
Length=430

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/221 (80%), Positives = 196/221 (89%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFG  KD P PY GAR ASAIES+ALEQLE NV+PPEV+
Sbjct  211  DCDAEKSLMSRFNVQGFPTILVFGIVKDSPYPYEGARVASAIESFALEQLETNVAPPEVS  270

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKCSSAA+CFVAFLPDILDSKAEGRNKYLE LLSVAEKF+  PYSYVWAAA
Sbjct  271  ELTGPDVMEEKCSSAAICFVAFLPDILDSKAEGRNKYLELLLSVAEKFRRSPYSYVWAAA  330

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPALV L+VK  +YAPL+S+F+HD I +FV+E G  GG+G NLP
Sbjct  331  GKQPDLEKQVGVGGYGYPALVALNVKKGIYAPLRSAFEHDPIIDFVKEAGR-GGKG-NLP  388

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L   P++V+TEPWDGKDGEI+EEDEFSLEEL+G+DT  KDE
Sbjct  389  LEKAPSVVQTEPWDGKDGEIIEEDEFSLEELLGEDTTTKDE  429



>gb|KJB42838.1| hypothetical protein B456_007G169700 [Gossypium raimondii]
Length=434

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 193/221 (87%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD PVPY GARTASAIES+ALEQLE NV P EVT
Sbjct  215  DCDSEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLETNVGPAEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKCSSAA+CFVAFLPDILDSKAEGRNKYL+ LLSVAEKFK  PYSYVWAAA
Sbjct  275  ELTGPDVMEEKCSSAAICFVAFLPDILDSKAEGRNKYLDMLLSVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK   YAPL S+F+ +HI EFV+E G  GG+G NLP
Sbjct  335  GKQPDLENRVGVGGYGYPALVALNVKKGAYAPLISAFELEHIIEFVKEAGR-GGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP I KTE WDGKDGEI EEDEFSLEELMGD T +KDE
Sbjct  393  LEGTPEIAKTEAWDGKDGEIKEEDEFSLEELMGDFTASKDE  433



>ref|NP_001236576.1| protein disulfide isomerse like protein precursor [Glycine max]
 dbj|BAF95902.1| protein disulfide isomerase family [Glycine max]
 dbj|BAD42856.2| protein disulfide isomerse like protein [Glycine max]
Length=438

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 194/221 (88%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF VQGFPTILVFGADKD P+PY GARTA AIES+ALEQLE NV+PPEVT
Sbjct  219  DCDAEKSLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLETNVAPPEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL  PDV+EEKC SAA+CFVAFLPDILDSKAEGRN YL+ LLSVAEKFK  PYSYVW AA
Sbjct  279  ELHSPDVLEEKCGSAAICFVAFLPDILDSKAEGRNIYLQQLLSVAEKFKRSPYSYVWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G QPDLEK+VGVGGYGYPALV L++K  VYAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  339  GNQPDLEKNVGVGGYGYPALVALNLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTPTIVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  397  LQGTPTIVKTEPWDGKDGEIIEEDEFSLEELMGEDASSKDE  437



>ref|XP_007141667.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
 gb|ESW13661.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
Length=436

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 194/221 (88%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF VQGFPTILVFGADKD P+PY GARTA+AIES+ALEQLE NV PPEVT
Sbjct  217  DCDAEKSLMSRFKVQGFPTILVFGADKDSPIPYEGARTAAAIESFALEQLETNVVPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL  PDV+EEKC +AA+CFVAFLPDILDSKAEGRN+YL+ LLSVAEKFK  PYSYVW AA
Sbjct  277  ELHSPDVLEEKCGTAAICFVAFLPDILDSKAEGRNRYLQQLLSVAEKFKRSPYSYVWVAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEKHVGVGGYGYPALV L++K  VYAPLKS+F+ D I +FV++ G  GG+G NLP
Sbjct  337  GKQLDLEKHVGVGGYGYPALVALNLKKAVYAPLKSAFELDQIIQFVKDAGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TPTIVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  395  LQSTPTIVKTEPWDGKDGEIIEEDEFSLEELMGEDASSKDE  435



>ref|XP_008379697.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=435

 Score =   359 bits (921),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 192/221 (87%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS+F+VQGFPTILVFGADK+ P+PY GAR+ASA ES+ALEQLE NV+PPEVT
Sbjct  216  DCDAEKSLMSKFNVQGFPTILVFGADKESPLPYEGARSASAXESFALEQLETNVAPPEVT  275

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPD MEEKC SAA+CFVAFLPDILDSKAEGRNKY++ LLSVAEKFK  PY YVWAAA
Sbjct  276  ELTGPDAMEEKCGSAAICFVAFLPDILDSKAEGRNKYIQQLLSVAEKFKRSPYXYVWAAA  335

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLE  VGVGGYGYPALV L+ K   YAPLKS+F+ D I EFVRE G  GG+G NLP
Sbjct  336  GKQXDLENRVGVGGYGYPALVALNAKKGAYAPLKSAFEVDQITEFVREAGR-GGKG-NLP  393

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP+IVK EPWDGKDG+I+EEDEFSLEELMG+ T NKDE
Sbjct  394  LEGTPSIVKIEPWDGKDGQILEEDEFSLEELMGEXTTNKDE  434



>ref|XP_002276520.1| PREDICTED: protein disulfide isomerase-like 2-3 [Vitis vinifera]
 emb|CBI28881.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   359 bits (921),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMSRFSVQGFPTILVFGADKD PVPY GARTASAIES+ALEQLE NV+PPEVT
Sbjct  218  DCDSDKSLMSRFSVQGFPTILVFGADKDTPVPYEGARTASAIESFALEQLETNVAPPEVT  277

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKAEGRNKYLE +LS+AEKFK  PYSYVWAAA
Sbjct  278  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRNKYLEMMLSIAEKFKRSPYSYVWAAA  337

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPALV L+VK   YAPLKS+F+ D I  FV+E G  GG+G  LP
Sbjct  338  GKQADLEKQVGVGGYGYPALVALNVKKGAYAPLKSAFELDQIIGFVKEAGH-GGKGI-LP  395

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVN  136
            L  TP +VKTEPWDGKDGEI+EEDEFSLEELMGDD  +
Sbjct  396  LASTPVVVKTEPWDGKDGEIIEEDEFSLEELMGDDATS  433



>ref|XP_011100470.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=438

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 195/221 (88%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGA+K+ P PY GAR+ASAIES+ALEQLE N +PPEVT
Sbjct  219  DCDAEKSLMSRFNVQGFPTILVFGANKESPFPYEGARSASAIESFALEQLETNAAPPEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PDVM+E+C SAA+CF+AFLPDILDSKAEGRNKYL+ LLSVAEKF+  PYSY+W AA
Sbjct  279  ELTSPDVMDERCGSAAICFIAFLPDILDSKAEGRNKYLKLLLSVAEKFRKSPYSYLWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEKHVGVGGYGYPALV L++K + YAPLKS+F+ DHI EFV+  G  GG+G NLP
Sbjct  339  GKQPDLEKHVGVGGYGYPALVALNLKKKAYAPLKSAFERDHIIEFVKAAGR-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G+P I+KTEPWDGKDG+I+EEDEFSL ELMGDD  +KDE
Sbjct  397  LEGSPEILKTEPWDGKDGQIIEEDEFSLSELMGDDNGSKDE  437



>ref|XP_010252582.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nelumbo nucifera]
Length=434

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 192/221 (87%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD EKSLMSRF VQGFPTILVFGADKD PV Y GAR+ASAIES+ALEQLE NV+PPEV 
Sbjct  215  NCDEEKSLMSRFKVQGFPTILVFGADKDIPVSYEGARSASAIESFALEQLETNVAPPEVN  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKCSS+A+CFVAFLPDILDSKA+GRNKYLE LLSVAEKFK  PYS+VWAAA
Sbjct  275  ELTSADVMEEKCSSSAICFVAFLPDILDSKADGRNKYLELLLSVAEKFKRNPYSFVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQP+LEK VGVGGYGYPALV L+VK +VY PL+S+F+   I EFVRE G  GG+G NLP
Sbjct  335  GKQPELEKQVGVGGYGYPALVALNVKKRVYTPLRSAFELQQITEFVREAG-YGGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  +P IVKTEPWDGKDGEI+EEDEFSLEELMGDDT  KDE
Sbjct  393  LENSPVIVKTEPWDGKDGEILEEDEFSLEELMGDDTARKDE  433



>ref|XP_008229815.1| PREDICTED: protein disulfide isomerase-like 2-3 [Prunus mume]
Length=459

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 193/223 (87%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD EKSLMSRF+VQGFPTIL+FGADKD P+PY GARTA AIES+ALEQLE NV+P EVT
Sbjct  238  DCDVEKSLMSRFNVQGFPTILIFGADKDTPLPYEGARTAKAIESFALEQLETNVAPAEVT  297

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKAEGRNKY++ LLSVAEKFK  PYSYVWAAA
Sbjct  298  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRNKYIQQLLSVAEKFKRSPYSYVWAAA  357

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK   YAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  358  GKQPDLENRVGVGGYGYPALVALNVKKGAYAPLKSAFELDQIIEFVKEAGR-GGKG-NLP  415

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM--GDDTVNKDE  127
            L GTP I K EPWDGKDG+I+EEDEFSLEELM  GDDT +KDE
Sbjct  416  LDGTPNISKIEPWDGKDGQIIEEDEFSLEELMGGGDDTTSKDE  458



>ref|XP_003616851.1| Protein disulfide isomerase family [Medicago truncatula]
 gb|AES99809.1| protein disulfide isomerase-like protein [Medicago truncatula]
Length=435

 Score =   357 bits (915),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/222 (79%), Positives = 196/222 (88%), Gaps = 3/222 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDA+KSLMSRF+VQGFPTILVFGADKD P+PY GARTA+AIES+ALEQLE NV+PPEVT
Sbjct  215  DCDADKSLMSRFNVQGFPTILVFGADKDTPIPYEGARTAAAIESFALEQLETNVAPPEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL  PDV+EEKC SAA+CFV+FLPDILDSKAEGRN+YL+ LL+VAEKFK  PYSYVWAAA
Sbjct  275  ELYSPDVLEEKCGSAAICFVSFLPDILDSKAEGRNRYLQQLLTVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE+ VGVGGYGYPALV L+VK  VYAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  335  GKQPDLEQKVGVGGYGYPALVALNVKKGVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLP  392

Query  249  LTGT-PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  T PTIVKTEPWDGKDGEI+EEDEFSLEELMG+D   KDE
Sbjct  393  LGDTPPTIVKTEPWDGKDGEIVEEDEFSLEELMGEDASTKDE  434



>ref|XP_010035498.1| PREDICTED: protein disulfide isomerase-like 2-3 [Eucalyptus grandis]
 gb|KCW46917.1| hypothetical protein EUGRSUZ_K00732 [Eucalyptus grandis]
Length=436

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 192/221 (87%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSR++VQGFPTILVFGADKD P+P+ GARTASAIES+ALEQLE NV+PPEVT
Sbjct  217  DCDAEKSLMSRYNVQGFPTILVFGADKDSPIPFEGARTASAIESFALEQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC SAA+CFVAFLPDILD+KAEGRN+Y++ LLS AEKFK  PYS+VWA+A
Sbjct  277  ELTSQDVMEEKCGSAAICFVAFLPDILDTKAEGRNRYIQMLLSAAEKFKRSPYSFVWASA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPALV L+ K   YAPL+S+F+ +HI EFVRE G LGG+G NLP
Sbjct  337  GKQPDLEKLVGVGGYGYPALVALNAKKGAYAPLRSAFELNHIVEFVREAG-LGGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
              GTP I  TEPWDGKDGEI+EEDEFSLEELM +D  NKDE
Sbjct  395  FEGTPVIAMTEPWDGKDGEILEEDEFSLEELMSEDAPNKDE  435



>gb|KHN44746.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=442

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 194/225 (86%), Gaps = 6/225 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF VQGFPTILVFGADKD P+PY GARTA AIES+ALEQLE NV+PPEVT
Sbjct  219  DCDAEKSLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLETNVAPPEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPY----SYV  442
            EL  PDV+EEKC SAA+CFVAFLPDILDSKAEGRN YL+ LLSVAEKFK  PY    +YV
Sbjct  279  ELHSPDVLEEKCGSAAICFVAFLPDILDSKAEGRNIYLQQLLSVAEKFKRSPYRQVKNYV  338

Query  441  WAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRG  262
            W AAG QPDLEK+VGVGGYGYPALV L++K  VYAPLKS+F+ D I EFV+E G  GG+G
Sbjct  339  WVAAGNQPDLEKNVGVGGYGYPALVALNLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG  397

Query  261  RNLPLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
             NLPL GTPTIVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  398  -NLPLQGTPTIVKTEPWDGKDGEIIEEDEFSLEELMGEDASSKDE  441



>ref|XP_007215346.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
 gb|EMJ16545.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
Length=463

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 193/223 (87%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD EKSLMSRF+VQGFPTIL+FGADKD P+PY GARTA AIES+ALEQLE NV+P EVT
Sbjct  242  DCDVEKSLMSRFNVQGFPTILIFGADKDTPLPYEGARTAKAIESFALEQLETNVAPAEVT  301

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKAEGRNKY++ LLSVAEKFK  PYSYVWAAA
Sbjct  302  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRNKYIQQLLSVAEKFKRSPYSYVWAAA  361

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK   YAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  362  GKQPDLENRVGVGGYGYPALVALNVKKGAYAPLKSAFELDQIIEFVKEAGR-GGKG-NLP  419

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM--GDDTVNKDE  127
            L GTP I K EPWDGKDG+I+EEDEFSLEELM  GD+T +KDE
Sbjct  420  LDGTPNISKIEPWDGKDGQIIEEDEFSLEELMGGGDETTSKDE  462



>gb|ACU17741.1| unknown [Glycine max]
Length=436

 Score =   353 bits (907),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF VQGFPTILVFGADKD P+PY GARTA AIES+ALEQLE NV+PPEVT
Sbjct  219  DCDAEKSLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLETNVAPPEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL  PDV+EEKC SAA+CFVAFLPDILDSKAEGRN YL+ LLSVAEKFK  PYSYVW AA
Sbjct  279  ELHSPDVLEEKCGSAAICFVAFLPDILDSKAEGRNIYLQQLLSVAEKFKRSPYSYVWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G QPDLEK+VGVGGYGYPALV L++K  VYAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  339  GNQPDLEKNVGVGGYGYPALVALNLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMG  151
            L GTPTIVKTEPWDGKDGEI+EEDEFSLEELMG
Sbjct  397  LQGTPTIVKTEPWDGKDGEIIEEDEFSLEELMG  429



>ref|XP_004143192.1| PREDICTED: protein disulfide isomerase-like 2-3 [Cucumis sativus]
 gb|KGN47008.1| hypothetical protein Csa_6G168250 [Cucumis sativus]
Length=438

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 196/223 (88%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADK  P+ Y GARTAS IES+AL+QLE NV+PPEVT
Sbjct  217  DCDAEKSLMSRFNVQGFPTILVFGADKYSPITYEGARTASGIESFALDQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVM+EKC+SAA+CFVAFLPDILDSKAEGRN+YL+ LLSVAEKF+  PYSY+WAAA
Sbjct  277  ELTGSDVMDEKCASAAICFVAFLPDILDSKAEGRNRYLKQLLSVAEKFRRSPYSYIWAAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE+ VGVGGYGYPALV L+VK   YAPLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  337  GKQPDLEQRVGVGGYGYPALVALNVKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMG--DDTVNKDE  127
            L  TP IVKTEPWDGKDGE++EEDEFSLEELMG  D+TV KDE
Sbjct  395  LESTPEIVKTEPWDGKDGEVIEEDEFSLEELMGGEDETVTKDE  437



>ref|XP_010110229.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
 gb|EXC25526.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
Length=439

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 196/224 (88%), Gaps = 5/224 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADKD P PY G RTASAIES+ALEQLE NV+PPEVT
Sbjct  217  DCDAEKSLMSRFNVQGFPTILVFGADKDSPTPYEGGRTASAIESFALEQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPY---SYVW  439
            ELTGPDV+EEKC SAA+CFVAFLPDILDSKAEGRNK+++ LL+VAEKFK  PY   +   
Sbjct  277  ELTGPDVLEEKCGSAAICFVAFLPDILDSKAEGRNKHIQQLLTVAEKFKRSPYRQENIPT  336

Query  438  AAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGR  259
             +AGKQPDLE+ VGVGGYGYPALV L+VK  VYAPLKS+F+ +HI EFVRE G  GG+G 
Sbjct  337  LSAGKQPDLEQRVGVGGYGYPALVALNVKKSVYAPLKSAFELEHIIEFVREAGR-GGKG-  394

Query  258  NLPLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            NLPL GTPTIVKTEPWDGKDGEI+EEDEFSLEELMG+DT +KDE
Sbjct  395  NLPLEGTPTIVKTEPWDGKDGEIIEEDEFSLEELMGEDTTSKDE  438



>ref|XP_009409223.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=430

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 191/221 (86%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFG DK  P PY GARTA AIE+Y LEQLE N++P EV+
Sbjct  211  DCDAEKSLMSRFNVQGFPTILVFGLDKSSPYPYEGARTALAIEAYGLEQLEANIAPTEVS  270

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC+SAA+CFVAFLPDILDSKAEGRNKYLE LLS+AEKFK  PYS+VW+AA
Sbjct  271  ELTGPDVMEDKCASAAICFVAFLPDILDSKAEGRNKYLEHLLSIAEKFKRSPYSFVWSAA  330

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLE HVGVGGYGYPALV L+VK  +YAPLKS+F++D I EF++E G  GG+G NLP
Sbjct  331  GKQADLENHVGVGGYGYPALVALNVKKGIYAPLKSAFENDQIIEFIKEAGR-GGKG-NLP  388

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TPTIVK EPWDG DGEI+EEDEFSL+ELMG+D   KDE
Sbjct  389  LQNTPTIVKIEPWDGNDGEIIEEDEFSLDELMGEDKSAKDE  429



>gb|AFK43048.1| unknown [Lotus japonicus]
Length=440

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/222 (77%), Positives = 195/222 (88%), Gaps = 3/222 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDA++SLMSRF V+GFPTILVFGADKD P+PY GARTASAIES+ALEQLE NV+PPEVT
Sbjct  220  DCDADQSLMSRFGVKGFPTILVFGADKDTPIPYEGARTASAIESFALEQLETNVAPPEVT  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL  P+V++EKC SAA+CFVAFLPDILDSKAEGRN+Y++ LLSVAEKFK  PYSYVW AA
Sbjct  280  ELHAPEVLDEKCGSAAICFVAFLPDILDSKAEGRNRYIQQLLSVAEKFKRSPYSYVWVAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPALV L++K  VYAPLKS+F+ D I EFV+E G  GG+G NLP
Sbjct  340  GKQPDLEKSVGVGGYGYPALVALNIKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMG-DDTVNKDE  127
            L  TP IVKTEPWDGKDGE++EEDEFSL+ELMG +DT +KDE
Sbjct  398  LGDTPAIVKTEPWDGKDGEVIEEDEFSLDELMGEEDTSSKDE  439



>ref|XP_006469595.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide isomerase-like 
2-3-like [Citrus sinensis]
Length=439

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 192/221 (87%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMS+F+VQGFPTILVFGADKD P+PY GARTA AIES+ALEQLE NV+PPEVT
Sbjct  217  DCDSEKSLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK   YS+VWAAA
Sbjct  277  ELTSQDVMEEKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRGHYSFVWAAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK  VY PLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  337  GKQPDLENRVGVGGYGYPALVALNVKKGVYTPLKSAFELEHIVEFVKESGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP+IVKTEPWDGKDG+I+EEDEFSL+ELM +    KD+
Sbjct  395  LDGTPSIVKTEPWDGKDGQIIEEDEFSLDELMAEXAAGKDD  435



>ref|XP_006661300.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Oryza brachyantha]
Length=425

 Score =   349 bits (895),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 192/221 (87%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDA+KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N +PPEV+
Sbjct  206  DCDADKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLEANAAPPEVS  265

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPD MEEKCSSAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  266  ELTGPDAMEEKCSSAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAA  325

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+FQ + I EFV+E G  GG+G NLP
Sbjct  326  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFQLEEITEFVKEAGR-GGKG-NLP  383

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTPTIV++EPWDGKDGE++EEDEFSLEELMGD++   DE
Sbjct  384  LDGTPTIVQSEPWDGKDGEVIEEDEFSLEELMGDNSPVNDE  424



>ref|XP_006829505.1| PREDICTED: protein disulfide isomerase-like 2-3 [Amborella trichopoda]
 gb|ERM96921.1| hypothetical protein AMTR_s00074p00124400 [Amborella trichopoda]
Length=429

 Score =   348 bits (894),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 190/221 (86%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD EKSLMSRF+VQGFPTILVFG DKD P PY GAR ASAIES+ALEQLE NV PPEVT
Sbjct  210  DCDTEKSLMSRFNVQGFPTILVFGVDKDSPYPYEGARAASAIESFALEQLETNVPPPEVT  269

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGP+VM+EKC+SAA+CFV+FLPDILDSKA+GRNK+LE +LSVAE+FK   YSYVWAAA
Sbjct  270  ELTGPEVMDEKCASAAICFVSFLPDILDSKADGRNKHLELVLSVAERFKRNAYSYVWAAA  329

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ +LEK VGVGGYGYPALV L+VK  VYAPL+S+F+HD I EF++E G  GG+G NLP
Sbjct  330  GKQAELEKTVGVGGYGYPALVALNVKKGVYAPLRSAFEHDQIVEFIKEAGR-GGKG-NLP  387

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L   P + KTEPWDGKDGEI+EEDEFSLEELMG+D   KDE
Sbjct  388  LESVPIVTKTEPWDGKDGEILEEDEFSLEELMGEDATPKDE  428



>ref|NP_001063331.1| Os09g0451500 [Oryza sativa Japonica Group]
 sp|Q67UF5.1|PDI23_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-3; Short=OsPDIL2-3; 
AltName: Full=Protein disulfide isomerase-like 5-1; 
Short=OsPDIL5-1; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD38008.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAD38214.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAF25245.1| Os09g0451500 [Oryza sativa Japonica Group]
Length=441

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 191/221 (86%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N +PPEV+
Sbjct  222  DCDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLEANAAPPEVS  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPD MEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  282  ELTGPDAMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+FQ D I EFV+E G  GG+G NLP
Sbjct  342  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFQLDEITEFVKEAGR-GGKG-NLP  399

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTPTIV++EPWDGKDGE++EEDEFSLEELM D++   DE
Sbjct  400  LDGTPTIVQSEPWDGKDGEVIEEDEFSLEELMADNSPVNDE  440



>gb|KDO59567.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=428

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMS+F+VQGFPTILVFGADKD P+PY GARTA AIES+ALEQLE NV+PPEVT
Sbjct  217  DCDSEKSLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK   YS+VWAAA
Sbjct  277  ELTSQDVMEEKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRGHYSFVWAAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK  VY PLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  337  GKQPDLENRVGVGGYGYPALVALNVKKGVYTPLKSAFELEHIVEFVKEAGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGD  148
            L GTP+IVKTEPWDGKDG+I+EEDEFSL+ELM +
Sbjct  395  LDGTPSIVKTEPWDGKDGQIIEEDEFSLDELMAE  428



>ref|XP_006447669.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
 gb|ESR60909.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
Length=428

 Score =   347 bits (889),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMS+F+VQGFPTILVFGADKD P+PY GARTA AIES+ALEQLE NV+PPEVT
Sbjct  217  DCDSEKSLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK   YS+VWAAA
Sbjct  277  ELTSQDVMEEKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRGHYSFVWAAA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK  VY PLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  337  GKQPDLENRVGVGGYGYPALVALNVKKGVYTPLKSAFELEHIVEFVKESGR-GGKG-NLP  394

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGD  148
            L GTP+IVKTEPWDGKDG+I+EEDEFSL+ELM +
Sbjct  395  LDGTPSIVKTEPWDGKDGQIIEEDEFSLDELMAE  428



>ref|XP_009409222.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=431

 Score =   346 bits (888),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 191/222 (86%), Gaps = 3/222 (1%)
 Frame = -2

Query  789  DCDAEK-SLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEV  613
            DCDAEK SLMSRF+VQGFPTILVFG DK  P PY GARTA AIE+Y LEQLE N++P EV
Sbjct  211  DCDAEKQSLMSRFNVQGFPTILVFGLDKSSPYPYEGARTALAIEAYGLEQLEANIAPTEV  270

Query  612  TELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAA  433
            +ELTGPDVME+KC+SAA+CFVAFLPDILDSKAEGRNKYLE LLS+AEKFK  PYS+VW+A
Sbjct  271  SELTGPDVMEDKCASAAICFVAFLPDILDSKAEGRNKYLEHLLSIAEKFKRSPYSFVWSA  330

Query  432  AGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNL  253
            AGKQ DLE HVGVGGYGYPALV L+VK  +YAPLKS+F++D I EF++E G  GG+G NL
Sbjct  331  AGKQADLENHVGVGGYGYPALVALNVKKGIYAPLKSAFENDQIIEFIKEAGR-GGKG-NL  388

Query  252  PLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            PL  TPTIVK EPWDG DGEI+EEDEFSL+ELMG+D   KDE
Sbjct  389  PLQNTPTIVKIEPWDGNDGEIIEEDEFSLDELMGEDKSAKDE  430



>ref|XP_010270061.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X2 [Nelumbo 
nucifera]
Length=381

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 189/221 (86%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEK LMSRF V+GFPTILVFGADKD P  Y GAR AS+IES+ALEQLE NV PPEVT
Sbjct  162  DCDAEKFLMSRFKVEGFPTILVFGADKDSPTKYEGARFASSIESFALEQLETNVVPPEVT  221

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKCSS+++CFVAFLPDILDSKAEGR+KYLE LLSVAEKFK  PYSYVWAAA
Sbjct  222  ELTGPDVMEEKCSSSSICFVAFLPDILDSKAEGRSKYLELLLSVAEKFKRSPYSYVWAAA  281

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK +GVGGYGYPALV L+VK + Y PL+S+F+   I EFVRE G LGG+G NLP
Sbjct  282  GKQLDLEKLIGVGGYGYPALVALNVKKRAYVPLRSAFELGQIIEFVREAG-LGGKG-NLP  339

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            +   P +VKTEPWDGKDGEIMEEDEFSLEELMGD +  +++
Sbjct  340  MENAPVVVKTEPWDGKDGEIMEEDEFSLEELMGDVSAREND  380



>gb|KJB10301.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=427

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 186/215 (87%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSR+ VQGFPTIL FGADKD P+PY GAR AS+IES+ALEQLE NV P EVT
Sbjct  215  DCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLETNVGPAEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ GPDVME+KC SAA+CFVAFLPDILDSKAEGRNKYLE LLSVA+KFK  PYSYVWAAA
Sbjct  275  EVIGPDVMEDKCGSAAICFVAFLPDILDSKAEGRNKYLEMLLSVAKKFKRNPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VG+GGYGYPALV L+VK   YAPL+S+F+ +HI EFV+E G  GG+G NLP
Sbjct  335  GKQPDLEKCVGIGGYGYPALVALNVKKGAYAPLRSAFELEHIIEFVKEAGR-GGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            L G   IVKTE WDGKDG+IMEEDEFSLEELMG+D
Sbjct  393  LNGGLNIVKTEAWDGKDGKIMEEDEFSLEELMGED  427



>ref|XP_010270060.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 189/221 (86%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEK LMSRF V+GFPTILVFGADKD P  Y GAR AS+IES+ALEQLE NV PPEVT
Sbjct  215  DCDAEKFLMSRFKVEGFPTILVFGADKDSPTKYEGARFASSIESFALEQLETNVVPPEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKCSS+++CFVAFLPDILDSKAEGR+KYLE LLSVAEKFK  PYSYVWAAA
Sbjct  275  ELTGPDVMEEKCSSSSICFVAFLPDILDSKAEGRSKYLELLLSVAEKFKRSPYSYVWAAA  334

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK +GVGGYGYPALV L+VK + Y PL+S+F+   I EFVRE G LGG+G NLP
Sbjct  335  GKQLDLEKLIGVGGYGYPALVALNVKKRAYVPLRSAFELGQIIEFVREAG-LGGKG-NLP  392

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            +   P +VKTEPWDGKDGEIMEEDEFSLEELMGD +  +++
Sbjct  393  MENAPVVVKTEPWDGKDGEIMEEDEFSLEELMGDVSAREND  433


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 1/51 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D DA KSL   + +QGFPTI VF   K  P+ Y GAR A  I  +AL+Q++
Sbjct  87   DADAHKSLAQEYKIQGFPTIKVFAPGKP-PIDYRGARDAKGIAEFALQQIK  136



>gb|EYU43141.1| hypothetical protein MIMGU_mgv1a006693mg [Erythranthe guttata]
Length=434

 Score =   341 bits (875),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 187/223 (84%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTI+VFGADKD P PY GAR+ASAIES+ALEQLE N  PPEVT
Sbjct  213  DCDAEKSLMSRFNVQGFPTIMVFGADKDSPFPYEGARSASAIESFALEQLETNAPPPEVT  272

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PD +EEKC SAA+CFVAFLPDILDSKAEGRNKYL+ LLSVAEKF+  P+S++WAAA
Sbjct  273  ELTSPDTLEEKCGSAAICFVAFLPDILDSKAEGRNKYLDLLLSVAEKFRKSPFSFLWAAA  332

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEKHVGVGGYGYPALV L++K +V+ PLKS+FQ   I EFV E  + GG+G  LP
Sbjct  333  GKQSDLEKHVGVGGYGYPALVALNIKKKVFNPLKSAFQRAQIIEFVNEASQ-GGKG-TLP  390

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD--TVNKDE  127
            L G+P IVKTE WDGKDGEI EEDEFSLEELM DD     KDE
Sbjct  391  LEGSPEIVKTEAWDGKDGEIFEEDEFSLEELMADDDTLATKDE  433



>ref|NP_001105804.1| protein disulfide isomerase8 precursor [Zea mays]
 gb|AAX09966.1| protein disulfide isomerase [Zea mays]
 gb|ACF78413.1| unknown [Zea mays]
 tpg|DAA61729.1| TPA: putative protein disulfide isomerase family protein [Zea 
mays]
Length=439

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N  P EV+
Sbjct  220  DCDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLEANSGPAEVS  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  280  ELTGPDVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ +LE  VGVGGYGYPA+V L+VK   YAPL+S+FQ D I EFV+E G  GG+G NLP
Sbjct  340  GKQANLENQVGVGGYGYPAMVALNVKKGAYAPLRSAFQRDEIIEFVKEAGR-GGKG-NLP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L   PT+V +EPWDGKDGE++EEDEFSL+ELMGD +   DE
Sbjct  398  LNDAPTVVASEPWDGKDGEVIEEDEFSLDELMGDSSSANDE  438



>gb|KJB10306.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=428

 Score =   338 bits (868),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 186/216 (86%), Gaps = 3/216 (1%)
 Frame = -2

Query  789  DCDAEK-SLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEV  613
            DCD+EK SLMSR+ VQGFPTIL FGADKD P+PY GAR AS+IES+ALEQLE NV P EV
Sbjct  215  DCDSEKQSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLETNVGPAEV  274

Query  612  TELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAA  433
            TE+ GPDVME+KC SAA+CFVAFLPDILDSKAEGRNKYLE LLSVA+KFK  PYSYVWAA
Sbjct  275  TEVIGPDVMEDKCGSAAICFVAFLPDILDSKAEGRNKYLEMLLSVAKKFKRNPYSYVWAA  334

Query  432  AGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNL  253
            AGKQPDLEK VG+GGYGYPALV L+VK   YAPL+S+F+ +HI EFV+E G  GG+G NL
Sbjct  335  AGKQPDLEKCVGIGGYGYPALVALNVKKGAYAPLRSAFELEHIIEFVKEAGR-GGKG-NL  392

Query  252  PLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            PL G   IVKTE WDGKDG+IMEEDEFSLEELMG+D
Sbjct  393  PLNGGLNIVKTEAWDGKDGKIMEEDEFSLEELMGED  428



>ref|XP_004956980.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Setaria 
italica]
Length=440

 Score =   339 bits (869),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 188/221 (85%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE+N  P EV+
Sbjct  221  DCDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLEVNSGPAEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  281  ELTGPDVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLE  VGVGGYGYPA+V L+VK   YAPL+S+FQHD I EFV+E G  GG+G NLP
Sbjct  341  GKQADLENQVGVGGYGYPAMVALNVKKGAYAPLRSAFQHDEIIEFVKEAGR-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G+PT+V +EPWDGKDGE + EDEFSL+ELMG+ +   DE
Sbjct  399  LNGSPTVVPSEPWDGKDGEEIVEDEFSLDELMGESSPVNDE  439



>gb|EEC84682.1| hypothetical protein OsI_31602 [Oryza sativa Indica Group]
Length=455

 Score =   339 bits (870),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 191/235 (81%), Gaps = 16/235 (7%)
 Frame = -2

Query  789  DCDAEK--------------SLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYA  652
            DCDAEK              SLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+A
Sbjct  222  DCDAEKNTNSSVWSVDKSYRSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFA  281

Query  651  LEQLEINVSPPEVTELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAE  472
            LEQLE N +PPEV+ELTGPD MEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAE
Sbjct  282  LEQLEANAAPPEVSELTGPDAMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAE  341

Query  471  KFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFV  292
            KFK  PYS+VW AAGKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+FQ D I EFV
Sbjct  342  KFKRSPYSFVWTAAGKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFQLDEITEFV  401

Query  291  REIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            +E G  GG+G NLPL GTPTIV++EPWDGKDGE++EEDEFSLEELM D++   DE
Sbjct  402  KEAGR-GGKG-NLPLDGTPTIVQSEPWDGKDGEVIEEDEFSLEELMADNSPVNDE  454



>dbj|BAJ84858.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 187/221 (85%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADKD P PY GAR ASAIES+ALEQLE N +PPEV+
Sbjct  221  DCDSDKSLMSKYKVEGFPTILVFGADKDSPFPYQGARAASAIESFALEQLEANAAPPEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA A
Sbjct  281  ELTSADVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+F+   I EFV+E G  GG+G NLP
Sbjct  341  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V++EPWDGKDGE++EEDEFSLEELM D +   DE
Sbjct  399  LEGAPTVVQSEPWDGKDGEVIEEDEFSLEELMADSSAPNDE  439



>ref|XP_003578205.1| PREDICTED: protein disulfide isomerase-like 2-3 [Brachypodium 
distachyon]
Length=440

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 188/221 (85%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N +PPEV+
Sbjct  221  DCDSDKSLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLEANSAPPEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW  A
Sbjct  281  ELTSSDVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTGA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+FQ D I EFV+E G  GG+G NLP
Sbjct  341  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFQRDEIIEFVKEAGR-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V++ PWDGKDGE++EEDEFSLEELMGD++   DE
Sbjct  399  LDGAPTVVQSGPWDGKDGEVIEEDEFSLEELMGDNSPPNDE  439



>ref|XP_002460311.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
 gb|EER96832.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
Length=439

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 185/221 (84%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS++ V+GFPTILVFGADK+ P  Y GAR +SAIES+ALEQLE N  P EV+
Sbjct  220  DCDAEKSLMSKYKVEGFPTILVFGADKESPFLYQGARVSSAIESFALEQLEANSGPAEVS  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  280  ELTGPDVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ +LE  VGVGGYGYPA+V L+VK   Y PL+S+FQ D I EFV+E G  GG+G NLP
Sbjct  340  GKQANLENQVGVGGYGYPAMVALNVKKGAYTPLRSAFQRDEIIEFVKEAGR-GGKG-NLP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V +EPWDGKDGE++EEDEFSL+ELMGD +   DE
Sbjct  398  LNGAPTVVTSEPWDGKDGEVIEEDEFSLDELMGDSSSVNDE  438



>ref|XP_010556968.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Tarenaya 
hassleriana]
Length=441

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CDAE+SLMSRF VQGFPTILVFG+DK+ P+PY GAR+ASAIES+ALE LE N  P EVT
Sbjct  218  NCDAEQSLMSRFKVQGFPTILVFGSDKNSPIPYEGARSASAIESFALELLEANAGPAEVT  277

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVMEEKC SAA+CFV+FLPDILDSKAEGRNKYL+ LL+VAEKFK  PYS+VW AA
Sbjct  278  ELTGSDVMEEKCGSAAICFVSFLPDILDSKAEGRNKYLDMLLTVAEKFKRSPYSFVWVAA  337

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ D+E  VGVGGYGYPA+V L+ K   Y PLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  338  GKQTDMETKVGVGGYGYPAMVALNAKKGAYTPLKSAFEVEHIMEFVKEAGR-GGKG-NLP  395

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            L GTP IVKTEPWDGKDGE++EEDEFSLEELM DD
Sbjct  396  LNGTPEIVKTEPWDGKDGEVVEEDEFSLEELMADD  430



>ref|XP_008668262.1| PREDICTED: uncharacterized protein LOC100381521 isoform X1 [Zea 
mays]
Length=439

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N  P EV+
Sbjct  220  DCDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLEANSGPVEVS  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEK+K  PYS+VW AA
Sbjct  280  ELTGPDVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKYKKSPYSFVWTAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ +LE  VGVGGYGYPA+V L+VK   YAPL+++FQ D I EFV+E G  GG+G NLP
Sbjct  340  GKQANLENQVGVGGYGYPAMVALNVKKGAYAPLRNAFQRDEIIEFVKEAGR-GGKG-NLP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L   PT+V +EPWDGKDGE++EEDEFSL+ELMGD +   DE
Sbjct  398  LNVAPTVVTSEPWDGKDGEVIEEDEFSLDELMGDSSSVNDE  438



>emb|CBG91909.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 187/221 (85%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N +PPEV+
Sbjct  221  DCDSDKSLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLEANAAPPEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA A
Sbjct  281  ELTSADVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+F+   I EFV+E G  GG+G NLP
Sbjct  341  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V++EPWDGKDGE++EEDEFSLEELM D +   DE
Sbjct  399  LEGAPTVVQSEPWDGKDGEVIEEDEFSLEELMADSSPPNDE  439



>ref|XP_010475171.1| PREDICTED: protein disulfide-isomerase like 2-2 [Camelina sativa]
Length=448

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+ SRF VQGFPTILVFGADK  PVPY GAR+ASAIES+ALEQLE NV P EVT
Sbjct  225  NCDVEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLESNVGPVEVT  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFV+FLPDILDSKAEGRNKY+E LLSVAEKFK  PYS+VW AA
Sbjct  285  ELTGPDVMEEKCGSAAICFVSFLPDILDSKAEGRNKYVEMLLSVAEKFKRDPYSFVWVAA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  HIKEFV+E  + GG+G NLP
Sbjct  345  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHIKEFVKEAAK-GGKG-NLP  402

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSLEELMG+D
Sbjct  403  IDGTMEIVKTEAWDGKDGELVDADEFSLEELMGND  437



>emb|CBG91899.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIE +ALEQLE N +PPEV+
Sbjct  221  DCDSDKSLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLEANAAPPEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA A
Sbjct  281  ELTSADVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+F+   I EFV+E G  GG+G NLP
Sbjct  341  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V++EPWDGKDGE++EEDEFSLEELM D +   DE
Sbjct  399  LEGAPTVVESEPWDGKDGEVIEEDEFSLEELMADSSAPNDE  439



>dbj|BAO79454.1| protein disulfide isomerase family protein 5-1 [Triticum aestivum]
Length=440

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIE +ALEQLE N +PPEV+
Sbjct  221  DCDSDKSLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLEANAAPPEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA A
Sbjct  281  ELTSADVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+F+   I EFV+E G  GG+G NLP
Sbjct  341  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V++EPWDGKDGE++EEDEFSLEELM D +   DE
Sbjct  399  LEGAPTVVESEPWDGKDGEVIEEDEFSLEELMADSSAPNDE  439



>ref|XP_010484503.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Camelina 
sativa]
Length=445

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+ SRF VQGFPTILVFGADK  PVPY GAR+ASAIES+ALEQLE NV P EVT
Sbjct  222  NCDVEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLESNVGPVEVT  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFV+F+PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  282  ELTGPDVMEEKCGSAAICFVSFVPDILDSKAEGRNKYLEMLLSVAEKFKRDPYSFVWVAA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  HIKEFV+E  + GG+G NLP
Sbjct  342  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHIKEFVKEAAK-GGKG-NLP  399

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSL+ELMG+D
Sbjct  400  IDGTMEIVKTEAWDGKDGELVDADEFSLKELMGND  434



>gb|KHG30032.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=422

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 181/221 (82%), Gaps = 14/221 (6%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD PVPY GARTASAIES+ALEQLE NV P EVT
Sbjct  215  DCDSEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLETNVGPAEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVM EKCSSAA+CFVAFLPDILDSKAEGRNKYL+ L             YVWAAA
Sbjct  275  ELTGPDVMAEKCSSAAICFVAFLPDILDSKAEGRNKYLDMLF------------YVWAAA  322

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK   YAPL S+F+ +HI EFV+E G  GG+G NLP
Sbjct  323  GKQPDLENRVGVGGYGYPALVALNVKKGAYAPLISAFELEHIIEFVKEAGR-GGKG-NLP  380

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L GTP I KTE WDGKDGEIMEEDE SLEELMGD T +KDE
Sbjct  381  LEGTPEIAKTEAWDGKDGEIMEEDEISLEELMGDFTASKDE  421



>gb|ACN39830.1| unknown [Picea sitchensis]
Length=445

 Score =   332 bits (851),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 190/221 (86%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD+EKSLMSRF+VQGFPTILVFG+DK+ PVPY GARTASAIES+ALEQLE NVSPPEV 
Sbjct  225  NCDSEKSLMSRFNVQGFPTILVFGSDKESPVPYEGARTASAIESFALEQLETNVSPPEVV  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DV+E KC+S+A+CFV+FLPDILD++AEGRN YLE L+SVAEKFK  PYSYVWAAA
Sbjct  285  ELTSQDVLETKCASSAICFVSFLPDILDTRAEGRNSYLEQLMSVAEKFKRSPYSYVWAAA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQP LE+ VGVGGYGYPA + L++K  VYAPL+S+F+ +H+ +FV++ G  GG+G NLP
Sbjct  345  GKQPALERAVGVGGYGYPAFIALNIKKGVYAPLRSAFELEHLVDFVKDAGR-GGKG-NLP  402

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L   P + KTEPWDGKDGEI+EEDEFSL+ELMG++  +K E
Sbjct  403  LVSVPVLEKTEPWDGKDGEILEEDEFSLDELMGNEDDDKKE  443



>emb|CBG91908.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   331 bits (849),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIE +ALEQLE N +PPEV+
Sbjct  221  DCDSDKSLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLEANAAPPEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA A
Sbjct  281  ELTSADVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+F+   I EFV+E G  GG+G NLP
Sbjct  341  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V++EPWDGKDGE++EEDEFSLEEL+ D +   DE
Sbjct  399  LEGAPTVVESEPWDGKDGEVIEEDEFSLEELIADSSAPNDE  439



>ref|XP_006418074.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
 gb|ESQ36427.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
Length=434

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 180/215 (84%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CDA+KS+ SRF VQGFPTILVFGADK  PVPY GAR+ASAIES+ALEQLE N  P EVT
Sbjct  222  NCDADKSIQSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLESNAGPVEVT  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC  AA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  282  ELTGPDVMEEKCGPAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRDPYSFVWVAA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  H+KEFV E  + GG+G NLP
Sbjct  342  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHLKEFVEE-AKRGGKG-NLP  399

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSLEELM DD
Sbjct  400  IDGTMEIVKTEAWDGKDGEVVDADEFSLEELMADD  434



>ref|XP_010688926.1| PREDICTED: protein disulfide isomerase-like 2-3 [Beta vulgaris 
subsp. vulgaris]
Length=438

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 183/215 (85%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD EKSLMS+F VQGFPTILVFGADKD P PY GAR+AS IES+ALEQLE N  PPEV 
Sbjct  216  NCDEEKSLMSKFKVQGFPTILVFGADKDSPFPYEGARSASGIESFALEQLETNTPPPEVI  275

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PDVMEEKC SAA+CFV+FLPDILD+KAEGRNKYLE LLSVAEKFK  PYS+VWAAA
Sbjct  276  ELTSPDVMEEKCGSAAICFVSFLPDILDTKAEGRNKYLEMLLSVAEKFKRSPYSFVWAAA  335

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK+VGVGGYGYPA+V ++VK   YAPLK++F+ DH+ +FV++ G  GG+G NLP
Sbjct  336  GKQPDLEKNVGVGGYGYPAMVAINVKKGAYAPLKTAFELDHLVDFVKKAGR-GGKG-NLP  393

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            +  TP I K E WDGKDGE++EEDEFSL+ELM D+
Sbjct  394  MNDTPKIEKIEAWDGKDGEVIEEDEFSLDELMKDE  428



>gb|KHN38504.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=391

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 185/226 (82%), Gaps = 21/226 (9%)
 Frame = -2

Query  789  DCDAEK-----SLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVS  625
            DCDAEK     SLMSRF VQGFPTILVFGADKD P+PY GARTASAIES+ALEQLE N++
Sbjct  181  DCDAEKDICYQSLMSRFKVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLETNIA  240

Query  624  PPEVTELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSY  445
            PPEVTEL  PDV+EEKC SAA+CFVAFLPDILDSKAEGRN+YL+               Y
Sbjct  241  PPEVTELYSPDVLEEKCGSAAICFVAFLPDILDSKAEGRNRYLQ--------------HY  286

Query  444  VWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGR  265
            VW AAGKQPDLEK+VGVGGYGYPALV L++K  VYAPLKS+F+ D I EFV+E G  GG+
Sbjct  287  VWVAAGKQPDLEKNVGVGGYGYPALVALNLKKAVYAPLKSAFELDQIIEFVKEAGR-GGK  345

Query  264  GRNLPLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            G NLP+ GTPTIVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  346  G-NLPIEGTPTIVKTEPWDGKDGEIIEEDEFSLEELMGEDASSKDE  390



>emb|CDP05711.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 179/221 (81%), Gaps = 20/221 (9%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDAEKSLMSRF+VQGFPTILVFGADKD P PY GARTASAIES+ALEQLE NV PPEVT
Sbjct  237  DCDAEKSLMSRFNVQGFPTILVFGADKDSPSPYEGARTASAIESFALEQLETNVLPPEVT  296

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC SAA+CFVAFLPDILDSKAEGRN                  ++VWAAA
Sbjct  297  ELTGPDVMEEKCGSAAICFVAFLPDILDSKAEGRN------------------NFVWAAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPALV L+VK   YAPLKS+F  D I EFV+E G LGG+G NLP
Sbjct  339  GKQSDLEKQVGVGGYGYPALVALNVKKGAYAPLKSAFGRDQIIEFVKEAG-LGGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L  TP+I K EPWDGKDGEI+EEDEFSL+ELMGDDT NKDE
Sbjct  397  LGVTPSIAKIEPWDGKDGEIIEEDEFSLDELMGDDTANKDE  437



>ref|NP_171990.3| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
 sp|Q9MAU6.2|PDI22_ARATH RecName: Full=Protein disulfide-isomerase like 2-2; Short=AtPDIL2-2; 
AltName: Full=Protein disulfide-isomerase 10; Short=PDI10; 
AltName: Full=Protein disulfide-isomerase like 5-1; Short=AtPDIL5-1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE27773.1| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
Length=447

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 182/215 (85%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CDAE+S+ SRF VQGFPTILVFG+DK  PVPY GAR+ASAIES+ALEQLE N  P EVT
Sbjct  224  NCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLESNAGPAEVT  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVA+KFK  PY +VW AA
Sbjct  284  ELTGPDVMEDKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVADKFKKDPYGFVWVAA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  H+K+FV+E  + GG+G NLP
Sbjct  344  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHLKDFVKEAAK-GGKG-NLP  401

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSLE+LMG+D
Sbjct  402  IDGTMEIVKTEAWDGKDGEVVDADEFSLEDLMGND  436



>gb|AAF40463.1|AC004809_21 Strong simialrity to the disulfide isomerase precursor homolog 
T21L14.14 gi|2702281 from A. thaliana on BAC gb|AC003033 [Arabidopsis 
thaliana]
 gb|AAM20664.1| disulfide isomerase-related protein, putative [Arabidopsis thaliana]
Length=443

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 182/215 (85%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CDAE+S+ SRF VQGFPTILVFG+DK  PVPY GAR+ASAIES+ALEQLE N  P EVT
Sbjct  220  NCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLESNAGPAEVT  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVA+KFK  PY +VW AA
Sbjct  280  ELTGPDVMEDKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVADKFKKDPYGFVWVAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  H+K+FV+E  + GG+G NLP
Sbjct  340  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHLKDFVKEAAK-GGKG-NLP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSLE+LMG+D
Sbjct  398  IDGTMEIVKTEAWDGKDGEVVDADEFSLEDLMGND  432



>tpg|DAA40211.1| TPA: putative thioredoxin superfamily protein [Zea mays]
Length=212

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 178/213 (84%), Gaps = 2/213 (1%)
 Frame = -2

Query  765  MSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVTELTGPDVM  586
            MS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N  P EV+ELTGPDVM
Sbjct  1    MSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLEANSGPVEVSELTGPDVM  60

Query  585  EEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEK  406
            EEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEK+K  PYS+VW AAGKQ +LE 
Sbjct  61   EEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKYKKSPYSFVWTAAGKQANLEN  120

Query  405  HVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIV  226
             VGVGGYGYPA+V L+VK   YAPL+++FQ D I EFV+E G  GG+G NLPL   PT+V
Sbjct  121  QVGVGGYGYPAMVALNVKKGAYAPLRNAFQRDEIIEFVKEAGR-GGKG-NLPLNVAPTVV  178

Query  225  KTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
             +EPWDGKDGE++EEDEFSL+ELMGD +   DE
Sbjct  179  TSEPWDGKDGEVIEEDEFSLDELMGDSSSVNDE  211



>ref|XP_002892256.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68515.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   326 bits (835),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 181/215 (84%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CDAE+S+ SRF VQGFPTILVFGADK  PVPY GAR+ASAIES+ALEQLE N  P EVT
Sbjct  219  NCDAEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLESNAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC  AA+CFV+FLPDILDSKAEGRNKYLE LLSVA+KFK  PY +VW AA
Sbjct  279  ELTGPDVMEEKCGPAAICFVSFLPDILDSKAEGRNKYLEMLLSVADKFKKDPYGFVWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  H+K+F++E  + GG+G NLP
Sbjct  339  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHLKDFIKEAAK-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSLE+LMG+D
Sbjct  397  IDGTMEIVKTEAWDGKDGEVVDADEFSLEDLMGND  431



>ref|XP_006306333.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
 gb|EOA39231.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
Length=433

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 179/215 (83%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CDAE+S+ SRF VQG+PTILVF ADK  PVPY GAR+ASAIES+ALEQLE NV P EVT
Sbjct  210  NCDAEQSIKSRFKVQGYPTILVFAADKSSPVPYEGARSASAIESFALEQLESNVGPVEVT  269

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVMEEKC  AA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  270  ELTGPDVMEEKCGPAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKKDPYSFVWVAA  329

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQP  EK VGVGGYGYPA+V L+ K   YAPLKS F+  H+K+FV+E    GG+G NLP
Sbjct  330  GKQPGFEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHLKDFVKETAR-GGKG-NLP  387

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSLEELMG+D
Sbjct  388  IDGTLEIVKTEAWDGKDGELVDADEFSLEELMGND  422



>ref|XP_009119218.1| PREDICTED: protein disulfide-isomerase like 2-2 [Brassica rapa]
Length=438

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 178/215 (83%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDA+K++ SRF V+GFPTILVFGADK  P+PY GAR+ASAIES+ALEQLE N  P EVT
Sbjct  226  DCDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLEANAGPAEVT  285

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPD MEEKC  AA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  P S+VW AA
Sbjct  286  ELTGPDAMEEKCGPAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKKDPISFVWVAA  345

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  H+ EFV+E  + GG+G NLP
Sbjct  346  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHLIEFVKE-AQKGGKG-NLP  403

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSLEELM DD
Sbjct  404  IDGTLEIVKTEAWDGKDGEVVDADEFSLEELMADD  438



>emb|CDY18278.1| BnaC05g03010D [Brassica napus]
Length=436

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 177/215 (82%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDA+K++ SRF V+GFPTILVFGADK  P+PY GAR+ASAIES+ALEQLE N  P EVT
Sbjct  224  DCDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLEANAGPVEVT  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPD MEEKC  AA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  P S+VW AA
Sbjct  284  ELTGPDAMEEKCGPAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKKDPISFVWVAA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLEK VGVGGYGYPA+V L+ K   YAPLKS F+  H+ EFV+E  + GG+G NLP
Sbjct  344  GKQPDLEKRVGVGGYGYPAMVALNAKKGAYAPLKSGFEVKHLIEFVKE-AQKGGKG-NLP  401

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            + GT  IVKTE WDGKDGE+++ DEFSL ELM DD
Sbjct  402  IDGTLEIVKTEAWDGKDGEVVDADEFSLAELMADD  436



>ref|XP_010522374.1| PREDICTED: protein disulfide-isomerase 2-3-like [Tarenaya hassleriana]
Length=430

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CDA++SLMSRF VQGFPTILVFGADK   + Y GARTASAIES+ LE LE N  P E T
Sbjct  218  NCDADQSLMSRFKVQGFPTILVFGADKSSHILYEGARTASAIESFGLEMLEANAGPAEAT  277

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPD MEEKC SAA+CFV+FLPDILDSKAEGRNKYL+ LL+VA+KFK  PYS+VW AA
Sbjct  278  ELTGPDAMEEKCGSAAICFVSFLPDILDSKAEGRNKYLDMLLTVADKFKRSPYSFVWVAA  337

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLE  VGVGGYGYPA+V L+ K   YAPLKS+F+ + I EFV+E G  GG+G NLP
Sbjct  338  GKQTDLETKVGVGGYGYPAMVALNSKKGAYAPLKSAFEVEPIMEFVKEAGR-GGKG-NLP  395

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGD  148
            + G P IVKTEPWDGKDGEI+EEDEFSLEELMG+
Sbjct  396  IDGAPEIVKTEPWDGKDGEILEEDEFSLEELMGE  429



>ref|XP_009143922.1| PREDICTED: protein disulfide-isomerase 2-3 [Brassica rapa]
Length=443

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 184/225 (82%), Gaps = 6/225 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTI+VFG DK  P  Y+GAR+ASAIES+A E +E +  P EVT
Sbjct  220  NCDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESFATELVEASAGPVEVT  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  280  ELTGPDVMEKKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFVWVAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V ++VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P
Sbjct  340  VTQPDLEKRVNVGGYGYPAMVAMNVKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NVP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTVN---KDE  127
            + GTP IV+T+ WDGKDGE+MEEDEFSLEELM GDD  N   KDE
Sbjct  398  MNGTPEIVETKAWDGKDGEVMEEDEFSLEELMGGDDDANVGTKDE  442



>emb|CDY52544.1| BnaA05g35030D [Brassica napus]
Length=444

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 184/225 (82%), Gaps = 6/225 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTI+VFG DK  P  Y+GAR+ASAIES+A E +E +  P EVT
Sbjct  221  NCDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESFATELVEASAGPVEVT  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  281  ELTGPDVMEKKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFVWVAA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V ++VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P
Sbjct  341  VTQPDLEKRVNVGGYGYPAMVAMNVKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NVP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTVN---KDE  127
            + GTP IV+T+ WDGKDGE+MEEDEFSLEELM GDD  N   KDE
Sbjct  399  MNGTPEIVETKAWDGKDGEVMEEDEFSLEELMGGDDDANVGTKDE  443



>emb|CDY12149.1| BnaC04g11790D [Brassica napus]
Length=443

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 184/225 (82%), Gaps = 6/225 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTI+VFG DK  P  Y+GAR+ASAIES+A E +E +  P EVT
Sbjct  220  NCDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESFATELVEASAGPVEVT  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA
Sbjct  280  ELTGPDVMEKKCGSAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFVWVAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V ++VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P
Sbjct  340  VTQPDLEKRVNVGGYGYPAMVAMNVKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NVP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTVN---KDE  127
            + GTP IV+T+ WDGKDGE+MEEDEFSLEELM GDD  N   KDE
Sbjct  398  MNGTPEIVETKAWDGKDGEVMEEDEFSLEELMGGDDDANVGTKDE  442



>ref|XP_002881252.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57511.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 184/223 (83%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTILVFG DK  P PY GAR+ASAIES+A E +E +  P EVT
Sbjct  219  NCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVESSAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CF++FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA
Sbjct  279  ELTGPDVMEKKCGSAAICFISFLPDILDSKAEGRNKYLEMLLSVAEKFKKHPYSFMWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V ++VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P
Sbjct  339  VTQPDLEKRVNVGGYGYPAMVAMNVKKGVYAPLKSAFELQHLLEFVKDAG-TGGKG-NVP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTV-NKDE  127
            + GTP IVKT+ WDGKDGE++EEDEFSL+ELM GDD V  KDE
Sbjct  397  MNGTPEIVKTKAWDGKDGELIEEDEFSLDELMGGDDAVGTKDE  439



>ref|XP_006294195.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
 gb|EOA27093.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
Length=452

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 185/223 (83%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTILVFG DK +P PY+GAR+ASAIES+A E +E +  P EVT
Sbjct  231  NCDVEQSIMSRFKVQGFPTILVFGLDKSNPTPYDGARSASAIESFASELVESSAGPVEVT  290

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVME+KC SAA+CF++FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA
Sbjct  291  ELTGSDVMEKKCGSAAICFISFLPDILDSKAEGRNKYLEMLLSVAEKFKKHPYSFMWVAA  350

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V +++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP
Sbjct  351  VTQPDLEKRVNVGGYGYPAMVAMNMKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NLP  408

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTV-NKDE  127
            + GTP IV T+ WDGKDGE++EEDEFSLEELM GDD V +KDE
Sbjct  409  MNGTPEIVTTKAWDGKDGELIEEDEFSLEELMGGDDAVSSKDE  451



>gb|KFK31099.1| hypothetical protein AALP_AA6G068000 [Arabis alpina]
Length=441

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 179/224 (80%), Gaps = 5/224 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTILVFG DK  P PY GAR+ASAIES+A E  E +  P EVT
Sbjct  219  NCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELAENSAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME KC SAA+CF++FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA
Sbjct  279  ELTGPDVMENKCGSAAICFISFLPDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFIWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V ++VK  VYAPLKS+F+   I EFV++ G  GG+G NLP
Sbjct  339  ITQPDLEKRVNVGGYGYPAMVAMNVKKGVYAPLKSAFELQQILEFVKDAGA-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMG---DDTVNKDE  127
            + GTP IV T+ WDGKDG+++EEDEFSLEELMG   D+   KDE
Sbjct  397  MNGTPEIVNTKAWDGKDGQVIEEDEFSLEELMGGDDDNVSTKDE  440



>ref|NP_180851.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
 sp|O48773.1|PDI23_ARATH RecName: Full=Protein disulfide-isomerase 2-3; Short=AtPDIL2-3; 
AltName: Full=Protein disulfide-isomerase 5-2; Short=AtPDIL5-2; 
AltName: Full=Protein disulfide-isomerase 9; Short=PDI9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB91984.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAL06929.1| At2g32920/T21L14.14 [Arabidopsis thaliana]
 gb|AAL61928.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAM91128.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AEC08762.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
Length=440

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 185/223 (83%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTILVFG DK  P PY GAR+ASAIES+A E +E +  P EVT
Sbjct  219  NCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVESSAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CF++FLPDILDSKAEGRNKYLE LLSVAEKFK +PYS++W AA
Sbjct  279  ELTGPDVMEKKCGSAAICFISFLPDILDSKAEGRNKYLEMLLSVAEKFKKQPYSFMWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              Q DLEK V VGGYGYPA+V ++VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P
Sbjct  339  VTQMDLEKRVNVGGYGYPAMVAMNVKKGVYAPLKSAFELQHLLEFVKDAGT-GGKG-NVP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTV-NKDE  127
            + GTP IVKT+ WDGKDGE++EEDEFSL+ELM GDD V +KDE
Sbjct  397  MNGTPEIVKTKEWDGKDGELIEEDEFSLDELMGGDDAVGSKDE  439



>ref|XP_010509948.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X1 [Camelina 
sativa]
 ref|XP_010509949.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X2 [Camelina 
sativa]
Length=440

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 184/223 (83%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTILVFG DK  P  Y+GARTASAIES+A E +E +  P EVT
Sbjct  219  NCDVEQSIMSRFKVQGFPTILVFGLDKSRPNSYDGARTASAIESFASELVESSAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVME+KC SAA+CF++FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA
Sbjct  279  ELTGSDVMEKKCGSAAICFISFLPDILDSKAEGRNKYLEMLLSVAEKFKKHPYSFIWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V +++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP
Sbjct  339  VTQPDLEKRVNVGGYGYPAMVAMNMKKGVYAPLKSAFELPHLLEFVKDAGA-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTV-NKDE  127
            + GTP IV T+ WDGKDGE++EEDEFSLEELM GDDT+ +KDE
Sbjct  397  MNGTPEIVTTKAWDGKDGELIEEDEFSLEELMGGDDTIASKDE  439



>ref|XP_010469533.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 184/223 (83%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTILVFG DK  P  Y+GARTASAIES+A E +E +  P EVT
Sbjct  219  NCDVEQSIMSRFKVQGFPTILVFGLDKSSPTSYDGARTASAIESFASELVESSAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVME+KC SAA+CF++FLPDILDSKAEGRNKYLE LL+VAEKFK  PYS++W AA
Sbjct  279  ELTGSDVMEKKCGSAAICFISFLPDILDSKAEGRNKYLEILLAVAEKFKKHPYSFIWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V +++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP
Sbjct  339  VTQPDLEKRVNVGGYGYPAMVAMNMKKGVYAPLKSAFELPHLLEFVKDAGA-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTV-NKDE  127
            + GTP IV T+ WDGKDGE++EEDEFSLEELM GDDTV +KDE
Sbjct  397  MNGTPEIVTTKAWDGKDGELIEEDEFSLEELMGGDDTVASKDE  439



>ref|XP_010413931.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   310 bits (795),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 183/223 (82%), Gaps = 4/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTILVFG DK  P  Y+GARTASAIES+A E +E +  P EVT
Sbjct  219  NCDVEQSIMSRFKVQGFPTILVFGLDKSSPTSYDGARTASAIESFASELVESSAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVME+ C SAA+CF++FLPDILDSKAEGRNKYLE LL+VAEKFK  PYS++W AA
Sbjct  279  ELTGSDVMEKNCGSAAICFISFLPDILDSKAEGRNKYLEILLAVAEKFKKHPYSFIWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V +++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP
Sbjct  339  VTQPDLEKRVNVGGYGYPAMVAMNMKKGVYAPLKSAFELPHLLEFVKDAGA-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTV-NKDE  127
            + GTP IV T+ WDGKDGE++EEDEFSLEELM GDDTV +KDE
Sbjct  397  MNGTPEIVTTKAWDGKDGELIEEDEFSLEELMGGDDTVASKDE  439



>emb|CDX79497.1| BnaC03g18330D [Brassica napus]
Length=443

 Score =   310 bits (795),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 182/225 (81%), Gaps = 6/225 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTI+VFGADK  P  Y GAR+ASAIES+A E +E +  P EVT
Sbjct  220  NCDVEQSIMSRFKVQGFPTIMVFGADKSSPYAYEGARSASAIESFATELVESSAGPVEVT  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGPDVME+KC SAA+CF++FLPDILDSKAEGRNKYL+ L SVAEK+K  PYS+VW AA
Sbjct  280  ELTGPDVMEKKCGSAAICFISFLPDILDSKAEGRNKYLKMLQSVAEKYKRHPYSFVWVAA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V ++VK  VYAPLKS+F+  H+ EFV++  E GG+G NLP
Sbjct  340  VTQPDLEKKVSVGGYGYPAMVAMNVKKGVYAPLKSAFELQHLLEFVKD-AEAGGKG-NLP  397

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELM-GDDTVN---KDE  127
            + GTP IV T+ WDGKDGE++EEDEFSLEELM GDD  N   KDE
Sbjct  398  MNGTPEIVDTKAWDGKDGEVIEEDEFSLEELMGGDDDANVGIKDE  442



>ref|XP_006410429.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
 gb|ESQ51882.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
Length=442

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 178/216 (82%), Gaps = 2/216 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            +CD E+S+MSRF VQGFPTI+VFGADK  P  Y+GAR+ASAIES+A E +E +  P EVT
Sbjct  219  NCDVEQSIMSRFKVQGFPTIMVFGADKSSPYAYDGARSASAIESFATELVESSAGPVEVT  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTG DVM++KC SAA+CF++FLPDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA
Sbjct  279  ELTGQDVMDKKCGSAAICFISFLPDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFLWVAA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QPDLEK V VGGYGYPA+V ++VK  V+APLKS+F+  H+ EFV++ G  GG+G NLP
Sbjct  339  VTQPDLEKRVSVGGYGYPAMVAMNVKKGVFAPLKSAFELPHLLEFVKDAGA-GGKG-NLP  396

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDT  142
            + GTP IV T+ WDGKDGE++EEDEFSLEELMG D 
Sbjct  397  MNGTPEIVNTKAWDGKDGEVIEEDEFSLEELMGGDA  432



>gb|KDO59568.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=411

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 172/214 (80%), Gaps = 19/214 (9%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMS+F+VQGFPTILVFGADKD P+PY GARTA AIES+ALEQLE NV+PPEVT
Sbjct  217  DCDSEKSLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLETNVAPPEVT  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC SAA+CF                 YLE LLSVAEKFK   YS+VWAAA
Sbjct  277  ELTSQDVMEEKCGSAAICF-----------------YLEMLLSVAEKFKRGHYSFVWAAA  319

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQPDLE  VGVGGYGYPALV L+VK  VY PLKS+F+ +HI EFV+E G  GG+G NLP
Sbjct  320  GKQPDLENRVGVGGYGYPALVALNVKKGVYTPLKSAFELEHIVEFVKEAGR-GGKG-NLP  377

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGD  148
            L GTP+IVKTEPWDGKDG+I+EEDEFSL+ELM +
Sbjct  378  LDGTPSIVKTEPWDGKDGQIIEEDEFSLDELMAE  411



>gb|EEE54954.1| hypothetical protein OsJ_02527 [Oryza sativa Japonica Group]
Length=291

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 176/235 (75%), Gaps = 34/235 (14%)
 Frame = -2

Query  789  DCDAEK--------------SLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYA  652
            DCDAEK              SLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+A
Sbjct  76   DCDAEKNTNSSVWSVDKSYRSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFA  135

Query  651  LEQLEINVSPPEVTELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAE  472
            LEQLE N +PPEV+ELTGPD MEEKC+SAA+CFV+FLPDILDSKAEGRN           
Sbjct  136  LEQLEANAAPPEVSELTGPDAMEEKCASAAICFVSFLPDILDSKAEGRN-----------  184

Query  471  KFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFV  292
                   ++VW AAGKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+FQ D I EFV
Sbjct  185  -------NFVWTAAGKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFQLDEITEFV  237

Query  291  REIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            +E G  GG+G NLPL GTPTIV++EPWDGKDGE++EEDEFSLEELM D++   DE
Sbjct  238  KEAGR-GGKG-NLPLDGTPTIVQSEPWDGKDGEVIEEDEFSLEELMADNSPVNDE  290



>gb|KHG02314.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=414

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 172/216 (80%), Gaps = 17/216 (8%)
 Frame = -2

Query  789  DCDAEK-SLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEV  613
            DCD+EK SLMSR+ VQ FPTIL FGADKD P+ Y GAR AS+IES+ALEQLE NV P EV
Sbjct  215  DCDSEKQSLMSRYKVQEFPTILAFGADKDGPILYEGARAASSIESFALEQLETNVGPAEV  274

Query  612  TELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAA  433
            TE+ GPDVME+KC SAA+CFVAFLPDILDSKAEGRNKYLE               YVWAA
Sbjct  275  TEVIGPDVMEDKCGSAAICFVAFLPDILDSKAEGRNKYLEI--------------YVWAA  320

Query  432  AGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNL  253
            AGKQPDLEK VGVGGYGYPALV L+VK   YAPL+S+F+ +HI EFV+E G  GG+G NL
Sbjct  321  AGKQPDLEKCVGVGGYGYPALVALNVKKGAYAPLRSAFELEHIIEFVKEAGR-GGKG-NL  378

Query  252  PLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            PL G   IVKTE WDGKDG+I+EEDEFSLEELMG+D
Sbjct  379  PLNGGLNIVKTEAWDGKDGKIIEEDEFSLEELMGED  414



>gb|EMT02125.1| Protein disulfide-isomerase A6 [Aegilops tauschii]
Length=422

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 172/221 (78%), Gaps = 20/221 (9%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N +PPEV+
Sbjct  221  DCDSDKSLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLEANAAPPEVS  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRN                  ++VWA A
Sbjct  281  ELTSADVMEEKCASAAICFVSFLPDILDSKAEGRN------------------NFVWAGA  322

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+F+   I EFV+E G  GG+G NLP
Sbjct  323  GKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLP  380

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G PT+V++EPWDGKDGE++EEDEFSLEELM D +   DE
Sbjct  381  LEGAPTVVQSEPWDGKDGEVIEEDEFSLEELMADSSAPNDE  421



>ref|XP_002973288.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
 gb|EFJ25662.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
Length=442

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 168/215 (78%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D DA K LMS++SV GFPTILVFGADK +P  Y GAR ASAIES+AL+ LE +  PPEVT
Sbjct  221  DGDAHKDLMSKYSVTGFPTILVFGADKQNPTVYQGARDASAIESHALQLLESSAVPPEVT  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGP++ME  CSSAA+CFV FLPDILDSKA+GRN+YL+ L ++A KF   PY Y+WA A
Sbjct  281  ELTGPEIMESHCSSAAICFVTFLPDILDSKADGRNQYLDILKNLATKFGKDPYGYLWAEA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQP LEK V VGGYGYPALV L+VK  V+ PL+S+F+   + +FV++ G+ GG+G NLP
Sbjct  341  GKQPSLEKAVQVGGYGYPALVALNVKKAVFLPLRSAFEPSSVLDFVKDAGQ-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            L     IVKT+PWDGKDGE + E+EFSLEELM  D
Sbjct  399  LGTGYEIVKTDPWDGKDGEAIPEEEFSLEELMAAD  433



>ref|XP_002976616.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
 gb|EFJ22285.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
Length=442

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 168/215 (78%), Gaps = 2/215 (1%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D DA K LMS++SV GFPTILVFGADK +P  Y GAR ASAIES+AL+ LE +  PPEVT
Sbjct  221  DGDAHKDLMSKYSVTGFPTILVFGADKQNPTVYQGARDASAIESHALQLLESSAVPPEVT  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELTGP++ME  CSSAA+CFV FLPDILDSKA+GRN+YL+ L ++A KF   PY Y+WA A
Sbjct  281  ELTGPEIMESHCSSAAICFVTFLPDILDSKADGRNQYLDILKNLATKFGKDPYGYLWAEA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            GKQP LEK V VGGYGYPALV L+VK  V+ PL+S+F+   + +FV++ G+ GG+G NLP
Sbjct  341  GKQPSLEKAVQVGGYGYPALVALNVKKAVFLPLRSAFEPSSVLDFVKDAGQ-GGKG-NLP  398

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDD  145
            L     IVKT+PWDGKDGE + E+EFSLEELM  D
Sbjct  399  LGTGYEIVKTDPWDGKDGEAIPEEEFSLEELMAAD  433



>ref|XP_001780684.1| predicted protein [Physcomitrella patens]
 gb|EDQ54468.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 168/221 (76%), Gaps = 10/221 (5%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DC+  K L  ++ +QGFPTI++FG DK++P  Y GARTA AIESYA+ QLE+NV+ PEV 
Sbjct  216  DCETNKDLAQKYGIQGFPTIMLFGVDKENPTLYEGARTAGAIESYAISQLELNVAAPEVV  275

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            EL G DV++++C SAA+CFV+FLPDILDSKAEGRNKYL TL +VAEK+K   Y       
Sbjct  276  ELVGQDVLDKECGSAAICFVSFLPDILDSKAEGRNKYLATLRNVAEKYKRNAY-------  328

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
             +QPDLEK VGVGG+GYPA+V L+VK  VYAPL+ +F+ + + +FV E G+ GGRG  +P
Sbjct  329  -RQPDLEKAVGVGGFGYPAMVALNVKKAVYAPLRGAFEQEPVMKFVAEAGK-GGRGI-VP  385

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L   P ++ TEPWDGKDG ++EEDEFSL+ELMGDD    DE
Sbjct  386  LQSVPPVLTTEPWDGKDGHLIEEDEFSLDELMGDDETKNDE  426


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  K L  ++ +QGFPTI VFG  K  P+ Y GAR A AI  YAL+Q++
Sbjct  82   DADTHKDLAQQYGIQGFPTIKVFGLGK-SPIDYQGAREAKAIVDYALQQVK  131



>ref|XP_002528963.1| protein disulfide isomerase, putative [Ricinus communis]
 gb|EEF33437.1| protein disulfide isomerase, putative [Ricinus communis]
Length=348

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 147/221 (67%), Gaps = 51/221 (23%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD P+PY GARTASAIES+ALEQLE NV+PPEVT
Sbjct  178  DCDSEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLETNVAPPEVT  237

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            ELT PD+MEEKC  AA+CF AFLPDILD+KAEGRNKYLE LLSVAE+FK  PY       
Sbjct  238  ELTSPDIMEEKCGPAAICFAAFLPDILDTKAEGRNKYLEQLLSVAEEFKRSPYR------  291

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
                +  K  G GG G                                         N+ 
Sbjct  292  ----EFVKEAGYGGKG-----------------------------------------NMA  306

Query  249  LTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            L G P IVKTEPWDGKDGEI+EEDEFSLEELMG+D  +KDE
Sbjct  307  LDGRPEIVKTEPWDGKDGEIIEEDEFSLEELMGEDVGSKDE  347



>ref|NP_001167822.1| uncharacterized protein LOC100381521 [Zea mays]
 gb|ACN26216.1| unknown [Zea mays]
Length=153

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 2/154 (1%)
 Frame = -2

Query  588  MEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLE  409
            MEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEK+K  PYS+VW AAGKQ +LE
Sbjct  1    MEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKYKKSPYSFVWTAAGKQANLE  60

Query  408  KHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTI  229
              VGVGGYGYPA+V L+VK   YAPL+++FQ D I EFV+E G  GG+G NLPL   PT+
Sbjct  61   NQVGVGGYGYPAMVALNVKKGAYAPLRNAFQRDEIIEFVKEAGR-GGKG-NLPLNVAPTV  118

Query  228  VKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            V +EPWDGKDGE++EEDEFSL+ELMGD +   DE
Sbjct  119  VTSEPWDGKDGEVIEEDEFSLDELMGDSSSVNDE  152



>gb|KJB42837.1| hypothetical protein B456_007G169700 [Gossypium raimondii]
Length=336

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSRF+VQGFPTILVFGADKD PVPY GARTASAIES+ALEQLE NV P EVT
Sbjct  215  DCDSEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLETNVGPAEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPY  451
            ELTGPDVMEEKCSSAA+CFVAFLPDILDSKAEGRNKYL+ LLSVAEKFK  PY
Sbjct  275  ELTGPDVMEEKCSSAAICFVAFLPDILDSKAEGRNKYLDMLLSVAEKFKRSPY  327



>gb|KJB10305.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=336

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD+EKSLMSR+ VQGFPTIL FGADKD P+PY GAR AS+IES+ALEQLE NV P EVT
Sbjct  215  DCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLETNVGPAEVT  274

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPY  451
            E+ GPDVME+KC SAA+CFVAFLPDILDSKAEGRNKYLE LLSVA+KFK  PY
Sbjct  275  EVIGPDVMEDKCGSAAICFVAFLPDILDSKAEGRNKYLEMLLSVAKKFKRNPY  327



>gb|EAX00949.1| protein disulfide isomerase family A, member 6, isoform CRA_a 
[Homo sapiens]
Length=259

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  40   DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  98

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  99   EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  158

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  159  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  216

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  217  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  258



>ref|XP_005327417.1| PREDICTED: protein disulfide-isomerase A6 [Ictidomys tridecemlineatus]
Length=259

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F  D + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  40   DATVNQVLASRYGIRGFPTIKIFQKD-ESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  98

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  99   EIINEDVAKSTCEEHQLCVVAVLPHILDTGASGRNSYLEVLLKLADKYKKKMWGWLWTEA  158

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  159  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  216

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  217  VGGGAFPAITVREPWDGRDGELPVEDDIDLSDVELDD-LEKDE  258



>gb|EMS60416.1| Protein disulfide isomerase-like 2-3 [Triticum urartu]
Length=371

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCD++KSLMS++ V+GFPTILVFGADK+ P PY GAR ASAIES+ALEQLE N +PPEV+
Sbjct  254  DCDSDKSLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLEANAAPPEVS  313

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYV  442
            ELT  DVMEEKC+SAA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  PY  V
Sbjct  314  ELTSADVMEEKCASAAICFVSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYRQV  369



>ref|XP_010706217.1| PREDICTED: protein disulfide-isomerase A6 [Meleagris gallopavo]
Length=447

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 136/223 (61%), Gaps = 5/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  227  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  285

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  286  EIISEDVLKTTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  345

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  346  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  403

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD  +KDE
Sbjct  404  VGGGAFPKIHAVEPWDGKDGELPVEDDIDLSDVDLDDIWDKDE  446



>ref|XP_419952.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Gallus gallus]
Length=447

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 136/223 (61%), Gaps = 5/223 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L +R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  227  DATVNQMLANRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDITARALDLFSDNAPPPELL  285

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  286  EIINEDVLKTTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  345

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  346  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  403

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD  +KDE
Sbjct  404  VGGGAFPKIHAVEPWDGKDGELPVEDDIDLSDVDLDDIWDKDE  446



>ref|XP_005044328.1| PREDICTED: protein disulfide-isomerase A6 [Ficedula albicollis]
Length=442

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  223  DATVNQVLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVSRALDLFSDNAPPPELL  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  282  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G QPDLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  342  GAQPDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  399

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD   KDE
Sbjct  400  VGGGAFPKIHSVEPWDGKDGELPVEDDIDLSDVDLDD-FGKDE  441



>ref|XP_004696438.1| PREDICTED: protein disulfide-isomerase A6 [Echinops telfairi]
Length=468

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 139/223 (62%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L +R++++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  249  DATANQMLANRYAIRGFPTIKIF-QKGESPVDYDGGRTKSNIVSRALDLFSDNAPPPELL  307

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+T  DV ++ C    LC VA LP ILD+ A GRN YL+ LL +AEK+K K + ++WA A
Sbjct  308  EITSEDVAKKTCEDHQLCVVAVLPHILDTGASGRNSYLDVLLKLAEKYKKKMWGWLWAEA  367

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  368  GAQGELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  425

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I  TEPWDGKDGE+  ED+  L ++  DD + +DE
Sbjct  426  VGGGVFPKISTTEPWDGKDGELPVEDDVDLSDVELDD-LGRDE  467


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D +  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL
Sbjct  114  DANTHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTAEAIVDAAL  160



>gb|KFQ65954.1| Protein disulfide-isomerase A6, partial [Phaethon lepturus]
Length=440

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI VF   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKVFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD  NKDE
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDLSDVDLDDW-NKDE  439



>ref|XP_010280693.1| PREDICTED: protein disulfide-isomerase A6 [Phaethon lepturus]
Length=464

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI VF   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  245  DATVNQMLASRYGIRGFPTIKVFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  303

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  304  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  363

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  364  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  421

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD  NKDE
Sbjct  422  VGGGAFPKIHSVEPWDGKDGELPVEDDIDLSDVDLDDW-NKDE  463



>gb|AAB50217.1| protein disulfide isomerase-related protein 5 [Homo sapiens]
Length=421

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  202  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  260

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  261  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  320

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  321  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  378

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  379  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  420


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  63   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  113



>ref|XP_002953269.1| hypothetical protein VOLCADRAFT_105867 [Volvox carteri f. nagariensis]
 gb|EFJ45579.1| hypothetical protein VOLCADRAFT_105867 [Volvox carteri f. nagariensis]
Length=452

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 138/223 (62%), Gaps = 10/223 (4%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DC A +++ S + VQG+PTI  FGADK  P  Y G R + +I S+A+ +    V PPE  
Sbjct  231  DCTAHQTVCSEYGVQGYPTIKFFGADKRSPQDYQGGRDSGSIVSFAMAKFAEQVPPPEPV  290

Query  609  ELTGPDVMEEKC---SSAA----LCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPY  451
            ELT   V E +C   SS A    LC VAFLPD+LDSKA GRN+Y+  L   AE +K KPY
Sbjct  291  ELTSQSVFESECLGDSSGAKARRLCLVAFLPDLLDSKAAGRNRYINILKKTAEAYKDKPY  350

Query  450  SYVWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELG  271
            SY+W     Q  LE + GVGG+GYPALV  +  ++ Y   KS+F+ +H+K+++ E   +G
Sbjct  351  SYLWVQGAVQEGLESNFGVGGFGYPALVAFNPADKKYTVCKSAFELNHVKDWI-EAMRMG  409

Query  270  GRGRNLPLTGTPTIVKT-EPWDGKDGEIMEEDEFSLEELMGDD  145
            G G  LPL G+   +K+  PWDG+D +    DEF L +++ ++
Sbjct  410  GTGA-LPLQGSLASIKSITPWDGQDAKEEAADEFDLSDILNEE  451



>ref|XP_007933283.1| PREDICTED: protein disulfide-isomerase A6 [Orycteropus afer afer]
Length=440

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L SR+ ++GFPTI +F    + PV Y+G R+ S I S AL+    N  PPE+ 
Sbjct  221  DATANQMLASRYGIRGFPTIKIF-QKGESPVDYDGGRSKSNIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +AEK+K K + ++WA A
Sbjct  280  EIINEDIAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLEVLLKLAEKYKKKMWGWLWAEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPKITTIEPWDGKDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   A+
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTAEAIVDAAV  128



>ref|XP_010336276.1| PREDICTED: protein disulfide-isomerase A6 [Saimiri boliviensis 
boliviensis]
Length=638

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 139/223 (62%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L SR+ ++GFPTI VF    + PV Y+GART S I S+AL+    N  PPE+ 
Sbjct  419  DATANQVLASRYGIRGFPTIKVF-QKGESPVDYDGARTRSHIVSWALDLFSDNAPPPELL  477

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  478  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  537

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  538  GAQSELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  595

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P+IV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  596  VGGGAFPSIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  637


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  280  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPGDYQGGRTGEAIVDAALSALH  330



>ref|NP_001253564.1| protein disulfide-isomerase A6 precursor [Macaca mulatta]
 ref|XP_005576620.1| PREDICTED: protein disulfide-isomerase A6 [Macaca fascicularis]
 ref|XP_007969684.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007969685.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_011747684.1| PREDICTED: protein disulfide-isomerase A6 [Macaca nemestrina]
 ref|XP_011900023.1| PREDICTED: protein disulfide-isomerase A6 [Cercocebus atys]
Length=440

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|NP_001269636.1| protein disulfide-isomerase A6 isoform e precursor [Homo sapiens]
 dbj|BAH11740.1| unnamed protein product [Homo sapiens]
Length=437

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  218  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  277  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  337  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  394

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  395  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  436


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  79   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  129



>ref|XP_011820677.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Mandrillus 
leucophaeus]
Length=437

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  218  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  277  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  337  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  394

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  395  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  436


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  79   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  129



>ref|XP_004642404.1| PREDICTED: protein disulfide-isomerase A6 [Octodon degus]
Length=515

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  296  DATVNQVLASRYGIRGFPTIKIF-QKGEAPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  354

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  355  EIISEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  414

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  415  GAQPELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  472

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P IV  EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  473  VGGGAFPAIVTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  514


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RTA AI   AL  + 
Sbjct  157  DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVR  207



>ref|XP_004028893.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Gorilla 
gorilla gorilla]
Length=437

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  218  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  277  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  337  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  394

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  395  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  436


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  79   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  129



>ref|NP_001233576.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
 ref|XP_003827017.1| PREDICTED: protein disulfide-isomerase A6 [Pan paniscus]
 ref|XP_004028892.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Gorilla 
gorilla gorilla]
 dbj|BAK63728.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
Length=440

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>dbj|BAH12614.1| unnamed protein product [Homo sapiens]
Length=445

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  444


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  87   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  137



>ref|XP_003908325.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Papio anubis]
Length=440

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI++ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTIIEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|NP_005733.1| protein disulfide-isomerase A6 isoform d precursor [Homo sapiens]
 sp|Q15084.1|PDIA6_HUMAN RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Endoplasmic 
reticulum protein 5; Short=ER protein 5; Short=ERp5; 
AltName: Full=Protein disulfide isomerase P5; AltName: Full=Thioredoxin 
domain-containing protein 7; Flags: Precursor 
[Homo sapiens]
 dbj|BAA08450.1| human P5 [Homo sapiens]
 gb|AAH01312.1| Protein disulfide isomerase family A, member 6 [Homo sapiens]
 gb|AAY24070.1| unknown [Homo sapiens]
 gb|EAX00950.1| protein disulfide isomerase family A, member 6, isoform CRA_b 
[Homo sapiens]
 gb|ABM82112.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 gb|ABM85295.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 dbj|BAF82117.1| unnamed protein product [Homo sapiens]
 gb|AIC50514.1| PDIA6, partial [synthetic construct]
Length=440

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|NP_001269635.1| protein disulfide-isomerase A6 isoform c [Homo sapiens]
Length=445

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  444


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  87   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  137



>ref|XP_009181940.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Papio anubis]
Length=437

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  218  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  276

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  277  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEA  336

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  337  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  394

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI++ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  395  VGGGAFPTIIEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  436


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  79   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  129



>ref|NP_001193274.1| protein disulfide-isomerase A6 precursor [Bos taurus]
 ref|XP_005892611.1| PREDICTED: protein disulfide-isomerase A6 [Bos mutus]
 ref|XP_011975252.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Ovis aries 
musimon]
Length=440

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  132



>ref|NP_001269634.1| protein disulfide-isomerase A6 isoform b [Homo sapiens]
Length=488

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  269  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  327

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  328  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  387

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  388  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  445

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  446  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  487


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  130  DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  180



>ref|XP_007529904.1| PREDICTED: protein disulfide-isomerase A6 [Erinaceus europaeus]
Length=440

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 132/220 (60%), Gaps = 5/220 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + P+ Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPMDYDGGRTKSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIVNEDIAKKTCEEHQLCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVN  136
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD  N
Sbjct  398  VGGGTFPTISTREPWDGKDGELPVEDDIDLSDVELDDFEN  437



>dbj|BAG54757.1| unnamed protein product [Homo sapiens]
Length=488

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  269  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  327

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  328  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  387

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  388  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  445

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  446  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  487


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  130  DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  180



>ref|XP_002758076.1| PREDICTED: protein disulfide-isomerase A6 [Callithrix jacchus]
Length=440

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P+IV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPSIVEKEPWDGRDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>gb|AAI48887.1| PDIA6 protein [Bos taurus]
Length=453

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  234  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  292

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  293  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  352

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  353  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  410

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  411  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  452


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  95   DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  145



>ref|XP_011820676.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Mandrillus 
leucophaeus]
Length=488

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  269  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  327

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  328  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEA  387

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  388  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  445

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  446  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  487


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  130  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  180



>ref|NP_001126483.1| protein disulfide-isomerase A6 precursor [Pongo abelii]
 sp|Q5R6T1.1|PDIA6_PONAB RecName: Full=Protein disulfide-isomerase A6; Flags: Precursor 
[Pongo abelii]
 emb|CAH92529.1| hypothetical protein [Pongo abelii]
Length=440

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC V+ LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIISEDIAKRTCEEHQLCVVSVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_004274932.1| PREDICTED: protein disulfide-isomerase A6 [Orcinus orca]
 ref|XP_004310311.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Tursiops 
truncatus]
Length=440

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYEIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+  + C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EILSEDIARKACEEYQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQPELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGVFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALR  132



>gb|ELR58675.1| Protein disulfide-isomerase A6, partial [Bos mutus]
Length=444

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  225  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  284  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  402  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  443


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  86   DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  136



>ref|XP_004005734.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Ovis aries]
Length=440

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_005687063.1| PREDICTED: protein disulfide-isomerase A6 [Capra hircus]
Length=440

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  132



>emb|CDY53400.1| BnaAnng12480D [Brassica napus]
Length=338

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DCDA+K++ SRF V+GFPTILVFGADK  P+PY GAR+ASAIES+ALEQLE N  P EVT
Sbjct  225  DCDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLEANAGPAEVT  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKP  454
            ELTGPD MEEKC  AA+CFV+FLPDILDSKAEGRNKYLE LLSVAEKFK  P
Sbjct  285  ELTGPDSMEEKCGPAAICFVSFLPDILDSKAEGRNKYLEMLLSVAEKFKKDP  336



>ref|XP_010377997.1| PREDICTED: protein disulfide-isomerase A6 [Rhinopithecus roxellana]
Length=512

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  293  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  351

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  352  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEA  411

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  412  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  469

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  470  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  511


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  154  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  204



>ref|XP_010627358.1| PREDICTED: protein disulfide-isomerase A6, partial [Fukomys damarensis]
Length=405

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 133/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  186  DATVNQVLAGRYGIRGFPTIKIF-QRGEAPVDYDGGRTRSDILSRALDLFSDNAPPPELL  244

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV  + C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  245  EIISEDVARKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  304

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  305  AAQPELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  362

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  363  VGGGTFPTIATREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  404


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RTA AI   AL
Sbjct  47   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDSAL  93



>gb|EHH21891.1| hypothetical protein EGK_05054 [Macaca mulatta]
 gb|EHH55361.1| hypothetical protein EGM_04558 [Macaca fascicularis]
Length=508

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  289  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  347

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  348  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEA  407

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  408  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  465

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  466  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  507


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  150  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  200



>ref|XP_004310310.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Tursiops 
truncatus]
Length=448

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  229  DATVNQVLASRYEIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  287

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+  + C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  288  EILSEDIARKACEEYQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEA  347

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  348  GAQPELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  405

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  406  VGGGVFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  447


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  90   DADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALR  140



>dbj|BAE88097.1| unnamed protein product [Macaca fascicularis]
Length=220

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 131/212 (62%), Gaps = 6/212 (3%)
 Frame = -2

Query  756  FSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVTELTGPDVMEEK  577
            + ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ E+   D+ +  
Sbjct  12   YGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRT  70

Query  576  CSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVG  397
            C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G
Sbjct  71   CEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALG  130

Query  396  VGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVK  223
            +GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+
Sbjct  131  IGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPTIVE  188

Query  222  TEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
             EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  189  REPWDGRDGELPVEDDIDLSDVELDD-LGKDE  219



>gb|KFV98779.1| Protein disulfide-isomerase A6, partial [Fulmarus glacialis]
Length=440

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ G DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIIGEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_004609467.1| PREDICTED: protein disulfide-isomerase A6 [Sorex araneus]
Length=466

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  247  DATANQHLTSRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  305

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YL+ LL +A+K+K K + ++W  A
Sbjct  306  EIINEDIAKKTCEDHQLCVVAVLPHILDTGAVGRNSYLDVLLKLADKYKKKMWGWLWTEA  365

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  366  GAQTDLENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  423

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P+I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  424  VGGGAFPSISTREPWDGKDGELPVEDDIDLSDVELDD-LGKDE  465


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT+ AI   AL  L 
Sbjct  112  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSTLR  162



>dbj|BAC86977.1| unnamed protein product [Homo sapiens]
Length=492

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  273  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  331

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  332  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  391

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  392  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  449

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  450  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  491


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  134  DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  184



>ref|NP_001269633.1| protein disulfide-isomerase A6 isoform a [Homo sapiens]
Length=492

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  273  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  331

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  332  EIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  391

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  392  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  449

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  450  VGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  491


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  134  DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  184



>gb|KFP75924.1| Protein disulfide-isomerase A6, partial [Acanthisitta chloris]
Length=440

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKTTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD   KDE
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDLSDVDLDDW-EKDE  439



>ref|XP_009068583.1| PREDICTED: protein disulfide-isomerase A6 [Acanthisitta chloris]
Length=444

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIISEDVLKTTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD   KDE
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDLSDVDLDDW-EKDE  443



>ref|XP_009585693.1| PREDICTED: protein disulfide-isomerase A6 [Fulmarus glacialis]
Length=444

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ G DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIIGEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>ref|XP_003787439.1| PREDICTED: protein disulfide-isomerase A6 [Otolemur garnettii]
Length=440

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKRTCEEHQLCIVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQTELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P+I + EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPSISEREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DVDKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_006257985.1| PREDICTED: protein disulfide-isomerase A6 [Alligator mississippiensis]
Length=461

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT + I + AL+    N  PPE+ 
Sbjct  242  DATVNQMLTGRYGIRGFPTIKIFQKGED-PVDYDGGRTRADIVTRALDLFSDNAPPPELL  300

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+++  C +  LC +A LP ILD+ A GRN YLE +L +AEK+K K + ++W  A
Sbjct  301  EVINADILKSTCEAHQLCIIAVLPHILDTGASGRNSYLEVMLKMAEKYKKKIWGWLWTEA  360

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  361  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  418

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD   KDE
Sbjct  419  VAGGAFPKINTVEPWDGKDGELPVEDDIDLSDVDLDDW-EKDE  460



>gb|EMC90288.1| Protein disulfide-isomerase A6, partial [Columba livia]
Length=440

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+T  DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EITSEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_006869520.1| PREDICTED: protein disulfide-isomerase A6 [Chrysochloris asiatica]
Length=437

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 137/224 (61%), Gaps = 7/224 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L +R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  217  DATANQMLANRYEIRGFPTIKIF-QKGESPVDYDGGRTKSNIVSRALDLFSDNAPPPELL  275

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +AEK+K K + ++WA A
Sbjct  276  EIINEDIAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLEVLLKLAEKYKKKMWGWLWAEA  335

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  336  GTQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  393

Query  249  LTGT--PTIVKTEPWDGKDGEI-MEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+ +E+D   L ++  DD + KDE
Sbjct  394  VGGGAFPKISTIEPWDGKDGELPVEDDYIDLSDVELDD-LGKDE  436


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D D  +SL  ++ VQGFPTI +F ++K+ P  Y G RTA AI   AL
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFSSNKNRPEDYQGGRTAEAIVDAAL  128



>ref|XP_008160636.1| PREDICTED: protein disulfide-isomerase A6 [Eptesicus fuscus]
Length=438

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  219  DATANQMLTGRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  277

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  278  EIISEDVAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  337

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  338  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  395

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  396  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  437


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALR  132



>ref|XP_004459385.1| PREDICTED: protein disulfide-isomerase A6 [Dasypus novemcinctus]
Length=440

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  EDE  L ++  DD + KDE
Sbjct  398  VGGAAFPKISTVEPWDGKDGELPVEDEIDLSDVELDD-LGKDE  439


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAAL  128



>ref|XP_003411934.1| PREDICTED: protein disulfide-isomerase A6 [Loxodonta africana]
Length=440

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTKSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++WA A
Sbjct  280  EIINEDIAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWAEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPKISTVEPWDGKDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL
Sbjct  82   DADKHQSLAGQYGVQGFPTIRIFGSNKNRPEDYQGGRTAEAIVDAAL  128



>gb|AAH06865.2| Protein disulfide isomerase associated 6 [Mus musculus]
 dbj|BAE40104.1| unnamed protein product [Mus musculus]
 dbj|BAE40225.1| unnamed protein product [Mus musculus]
Length=445

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATVNQVLASRYGIKGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGSFPTITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  444


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  87   NADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  137



>ref|XP_003272792.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Nomascus leucogenys]
Length=441

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 137/224 (61%), Gaps = 7/224 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALE-QLEINVSPPEV  613
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S A    L+IN  PPE+
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRAPRPXLQINAPPPEL  279

Query  612  TELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAA  433
             E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  
Sbjct  280  LEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTE  339

Query  432  AGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNL  253
            AG Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   
Sbjct  340  AGAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTA  397

Query  252  PLTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            P+ G   PTIV+ EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  PVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  440


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D   SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|NP_001080305.1| protein disulfide isomerase family A, member 6 precursor [Xenopus 
laevis]
 gb|AAH46867.1| Pdip5-prov protein [Xenopus laevis]
Length=442

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT   I + A++    N  PPE+ 
Sbjct  223  DATVSQVLASRYGIRGFPTIKIF-QKGEEPVDYDGGRTKPDIVARAVDLFSENAPPPEIN  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D++++ C    LC VA LP ILD+ A GRN YLE +L +A+K+K K + ++WA A
Sbjct  282  EILNGDIVKKTCEEHQLCIVAVLPHILDTGAAGRNSYLEVMLKMADKYKKKMWGWLWAEA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  342  GTQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSY--GRGSTSP  399

Query  249  LTG--TPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  400  VGGGAIPKINTVEPWDGKDGELPAEDDIDLSDVELDD-IGKDE  441


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ V+GFPTI +FGA+K+ P  Y G RTA AI   AL  L 
Sbjct  82   NADQHQSLGGQYGVRGFPTIKIFGANKNKPDDYQGGRTADAIIDAALNSLR  132



>sp|Q922R8.3|PDIA6_MOUSE RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Thioredoxin 
domain-containing protein 7; Flags: Precursor [Mus 
musculus]
Length=440

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIKGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGSFPTITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  82   NADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_007080745.1| PREDICTED: protein disulfide-isomerase A6 [Panthera tigris altaica]
Length=259

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 133/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  40   DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  98

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  99   EIIDEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  158

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+G PA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  159  GAQSELENALGIGGFGSPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  216

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  217  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  258



>gb|ELK29163.1| Protein disulfide-isomerase A6 [Myotis davidii]
Length=525

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  306  DATANQMLTGRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  364

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  365  EIVSEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  424

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  425  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  482

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  483  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  524


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL  L 
Sbjct  169  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALR  219



>ref|XP_008848336.1| PREDICTED: protein disulfide-isomerase A6 [Nannospalax galili]
Length=440

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++WA A
Sbjct  280  EIINEDITKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWAEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I+  EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGTFPPIIAREPWDGRDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  132



>ref|NP_082235.1| protein disulfide-isomerase A6 precursor [Mus musculus]
 dbj|BAC36392.1| unnamed protein product [Mus musculus]
 dbj|BAE38431.1| unnamed protein product [Mus musculus]
 dbj|BAE38578.1| unnamed protein product [Mus musculus]
 dbj|BAE31623.1| unnamed protein product [Mus musculus]
Length=445

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATMNQVLASRYGIKGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGSFPTITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  444


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  87   NADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  137



>ref|XP_005404513.1| PREDICTED: protein disulfide-isomerase A6, partial [Chinchilla 
lanigera]
Length=610

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 137/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D P+ Y+G RT S I S AL+    N  PPE+ 
Sbjct  391  DATVNQVLASRYGIRGFPTIKIFQKGED-PIDYDGGRTRSDIVSRALDLFSDNAPPPELL  449

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ G DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  450  EIIGEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNAYLEVLLKLADKYKKKMWGWLWTEA  509

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  510  GAQSELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  567

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I+  EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  568  VGGGIFPAIISREPWDGQDGELPVEDDIDLSDVELDD-LEKDE  609


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RTA AI   AL  + 
Sbjct  252  DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVR  302



>gb|KFU96864.1| Protein disulfide-isomerase A6, partial [Pterocles gutturalis]
Length=439

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  220  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIISRALDLFSDNAPPPELL  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  279  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  339  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  396

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  397  VAGGAFPKINSVEPWDGKDGELPVEDDIDL  426



>ref|XP_005000363.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Cavia porcellus]
Length=441

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  222  DATVNQVLASRYGIRGFPTIKIF-QKGEAPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  280

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  281  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  340

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  341  GAQTELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  398

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  399  VGGGAFPAITTREPWDGKDGELPVEDDIDLSDVELDD-LGKDE  440


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RTA AI   AL  + 
Sbjct  83   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVR  133



>ref|XP_010073176.1| PREDICTED: protein disulfide-isomerase A6, partial [Pterocles 
gutturalis]
Length=444

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIISRALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VAGGAFPKINSVEPWDGKDGELPVEDDIDL  431



>ref|XP_004870016.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=440

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + P+ Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATANQVLAGRYGIRGFPTIKIFQGG-ETPMDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIIHEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  AAQPELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P+I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPSIATREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI VF ADK+ P  Y G RTA AI   AL  L 
Sbjct  82   DADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALR  132



>dbj|BAE39477.1| unnamed protein product [Mus musculus]
Length=445

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATMNQVLASRYGIKGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGSFPTITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  444


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  87   NADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  137



>ref|XP_002117070.1| hypothetical protein TRIADDRAFT_50999 [Trichoplax adhaerens]
 gb|EDV20376.1| hypothetical protein TRIADDRAFT_50999 [Trichoplax adhaerens]
Length=434

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 138/226 (61%), Gaps = 9/226 (4%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVF-GADKDHPVP--YNGARTASAIESYALEQLEINVSPP  619
            D  A   + +++ V+GFPTI  F G  KD      Y G RTAS I ++A E+   N  PP
Sbjct  208  DATANTIVANKYEVKGFPTIKFFPGGKKDFSSAEDYTGGRTASDIVNWAEEKYAENAEPP  267

Query  618  EVTELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVW  439
            E+ EL   +V +E C +  LC ++FLP+ILD+ A GRNK+LE +  + +KFK K + ++W
Sbjct  268  EIIELVNAEVFDETCKNKQLCVISFLPNILDTGASGRNKFLELIHGLGDKFKRKQWGWLW  327

Query  438  AAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGR  259
             AAG Q  LE  VGVGGYGYPA++ L+ +  ++A LK +F    + EF++E+    GRG 
Sbjct  328  CAAGTQSKLESAVGVGGYGYPAMIALNPRKSLFAELKLAFSEQTVNEFLKELSY--GRGS  385

Query  258  NLPLT--GTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
               L   G P I+  + WDGKDG++ EE+EF L EL    TVN D+
Sbjct  386  TAALRGEGLPEILTIDSWDGKDGQLPEEEEFDLSEL--GITVNADD  429



>ref|XP_003462749.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Cavia porcellus]
Length=440

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGEAPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQTELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPAITTREPWDGKDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RTA AI   AL  + 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVR  132



>ref|NP_001086643.1| protein disulfide isomerase family A, member 6 precursor [Xenopus 
laevis]
 gb|AAH77228.1| MGC79068 protein [Xenopus laevis]
Length=442

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G R  + I + AL+    N  PPE+ 
Sbjct  223  DATVSQVLASRYGIRGFPTIKIF-QKGEEPVDYDGGRNRADIVARALDLFSENAPPPEIN  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D++++ C    LC VA LP ILD+ A GRN YLE +L +AEK+K K + ++W  A
Sbjct  282  EILNGDIVKKTCDEHQLCIVAVLPHILDTGAAGRNSYLEVMLKMAEKYKKKMWGWLWTEA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  342  GAQMDLETSLGIGGFGYPAMAAINARKIKFALLKGSFSEQGINEFLRELSY--GRGSTSP  399

Query  249  LTG--TPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  400  VGGGAIPKINTVEPWDGKDGELPAEDDIDLSDVELDD-IGKDE  441


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ V+GFPTI VFGA+K+ P  Y G RTA AI   AL  L 
Sbjct  82   NADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIVDAALNSLR  132



>ref|XP_005506964.1| PREDICTED: protein disulfide-isomerase A6 [Columba livia]
Length=471

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  252  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  310

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+T  DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  311  EITSEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  370

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  371  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  428

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  429  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  458



>ref|XP_006191925.1| PREDICTED: protein disulfide-isomerase A6, partial [Camelus ferus]
Length=436

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  217  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  275

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  276  EIINEDVAKKTCEEHQLCVVAILPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  335

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  336  GAQSELESALGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  393

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  394  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  435


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT+ AI   AL  L 
Sbjct  78   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALR  128



>gb|EHB04452.1| Protein disulfide-isomerase A6, partial [Heterocephalus glaber]
Length=434

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + P+ Y+G RT S I S AL+    N  PPE+ 
Sbjct  215  DATANQVLAGRYGIRGFPTIKIFQGG-ETPMDYDGGRTRSDIVSRALDLFSDNAPPPELL  273

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  274  EIIHEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  333

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  334  AAQPELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  391

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P+I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  392  VGGGAFPSIATREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  433


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI VF ADK+ P  Y G RTA AI   AL  L 
Sbjct  76   DADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALR  126



>gb|KFO31202.1| Protein disulfide-isomerase A6 [Fukomys damarensis]
Length=457

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 133/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  238  DATVNQVLAGRYGIRGFPTIKIF-QRGEAPVDYDGGRTRSDILSRALDLFSDNAPPPELL  296

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV  + C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  297  EIISEDVARKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  356

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  357  AAQPELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  414

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  415  VGGGTFPTIATREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  456


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RTA AI   AL  + 
Sbjct  99   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDSALSAVR  149



>ref|XP_005366580.1| PREDICTED: protein disulfide-isomerase A6 [Microtus ochrogaster]
Length=445

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + P  Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATVNQVLASRYGIRGFPTIKIF-QKGESPADYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGSFPTITAREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  444


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  87   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  137



>ref|XP_010962323.1| PREDICTED: protein disulfide-isomerase A6 [Camelus bactrianus]
 ref|XP_010981000.1| PREDICTED: protein disulfide-isomerase A6 [Camelus dromedarius]
Length=440

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDVAKKTCEEHQLCVVAILPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELESALGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT+ AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALR  132



>ref|XP_008570350.1| PREDICTED: protein disulfide-isomerase A6 [Galeopterus variegatus]
Length=460

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  241  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  299

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+++  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  300  EIINEDIVKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  359

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  360  GAQNELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  417

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  418  VGGGTFPTIYIREPWDGRDGELPMEDDIDLSDVELDD-LGKDE  459


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  + 
Sbjct  102  DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALNAVR  152



>ref|XP_005238268.1| PREDICTED: protein disulfide-isomerase A6 [Falco peregrinus]
Length=444

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++WA A
Sbjct  284  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWAEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>gb|EPQ08422.1| Protein disulfide-isomerase A6 [Myotis brandtii]
Length=460

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  241  DATANQMLTGRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  299

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  300  EIISEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  359

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  360  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  417

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  418  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  459


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL  L 
Sbjct  104  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALR  154



>ref|XP_005967905.1| PREDICTED: protein disulfide-isomerase A6 [Pantholops hodgsonii]
Length=440

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++     +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINALKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_004436529.1| PREDICTED: protein disulfide-isomerase A6 [Ceratotherium simum 
simum]
Length=432

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 133/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  213  DATVNQELASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  271

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ +  C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  272  EIISEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  331

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  332  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  389

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  390  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  431


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  74   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  124



>gb|KFO87204.1| Protein disulfide-isomerase A6, partial [Buceros rhinoceros silvestris]
Length=439

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  220  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  278

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+T  DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  279  EITSEDVLKGTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  338

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  339  GAQSDLETSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  396

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  397  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  426



>gb|KFW73081.1| Protein disulfide-isomerase A6, partial [Pygoscelis adeliae]
Length=440

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ G DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIIGEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_005085000.1| PREDICTED: protein disulfide-isomerase A6 [Mesocricetus auratus]
Length=445

 Score =   186 bits (472),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGSFPAITAREPWDGRDGELPVEDDIDLSDVELDD-LEKDE  444


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  87   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  137



>gb|KFU90776.1| Protein disulfide-isomerase A6, partial [Chaetura pelagica]
Length=440

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISILPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            ++G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VSGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_006197174.1| PREDICTED: protein disulfide-isomerase A6 [Vicugna pacos]
Length=440

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELESALGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT+ AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALR  132



>ref|XP_005867329.1| PREDICTED: protein disulfide-isomerase A6 [Myotis brandtii]
Length=471

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  252  DATANQMLTGRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  310

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  311  EIISEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  370

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  371  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  428

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  429  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  470


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL  L 
Sbjct  115  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALR  165



>ref|XP_006765261.1| PREDICTED: protein disulfide-isomerase A6 [Myotis davidii]
Length=539

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  320  DATANQMLTGRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  378

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  379  EIVSEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  438

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  439  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  496

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  497  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  538


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL  L 
Sbjct  183  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALR  233



>gb|EGW08481.1| Protein disulfide-isomerase A6 [Cricetulus griseus]
Length=259

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 133/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L +R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  40   DATVNQVLANRYGIRGFPTIKIF-QKGEAPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  98

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  99   EIINEDVAKKMCEEHQLCVVAVLPHILDTGAAGRNSYLEILLKLADKYKKKMWGWLWTEA  158

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+G PA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  159  GAQSELENALGIGGFGSPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  216

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  217  VGGGSFPAITAREPWDGRDGELPVEDDIDLSDVELDD-LEKDE  258



>ref|XP_010850414.1| PREDICTED: protein disulfide-isomerase A6 [Bison bison bison]
Length=540

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  321  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  379

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  380  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  439

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  440  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  497

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  498  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  539


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  182  DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  232



>gb|KFW86281.1| Protein disulfide-isomerase A6, partial [Phalacrocorax carbo]
Length=369

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  150  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  208

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  209  EIISEDVLKSTCDAHQLCIISILPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  268

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  269  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  326

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  327  VGGGAFPKIHTVEPWDGKDGELPVEDDIDL  356



>ref|XP_009330780.1| PREDICTED: protein disulfide-isomerase A6 [Pygoscelis adeliae]
Length=443

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  224  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  282

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ G DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  283  EIIGEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  342

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  343  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  400

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  401  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  430



>tpg|DAA24511.1| TPA: protein disulfide isomerase family A, member 6 [Bos taurus]
Length=590

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  371  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  429

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  430  EIINEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  489

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  490  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  547

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  548  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  589


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  232  DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  282



>ref|XP_004686132.1| PREDICTED: protein disulfide-isomerase A6 [Condylura cristata]
Length=492

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 136/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A ++L SR+ ++GFPTI VF    + PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  273  DATANQALTSRYGIRGFPTIKVF-QKGESPVDYDGGRTRSDIVARALDLFSDNAPPPELL  331

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+T  DV ++ C    LC VA LP ILD+ A GRN YL+ LL +A+K+K K + ++W  A
Sbjct  332  EITSEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWTEA  391

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q  LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  392  GAQSALESALGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  449

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  450  VGGGAFPPISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  491


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  134  DADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGDAIVDAALGTLR  184



>ref|XP_010130331.1| PREDICTED: protein disulfide-isomerase A6, partial [Buceros rhinoceros 
silvestris]
Length=444

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+T  DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EITSEDVLKGTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLETSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>gb|KFQ44656.1| Protein disulfide-isomerase A6, partial [Nestor notabilis]
Length=440

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQMLTGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKNTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VAGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_004887060.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=477

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + P+ Y+G RT S I S AL+    N  PPE+ 
Sbjct  258  DATANQVLAGRYGIRGFPTIKIFQGG-ETPMDYDGGRTRSDIVSRALDLFSDNAPPPELL  316

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  317  EIIHEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  376

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
              QP+LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  377  AAQPELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  434

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P+I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  435  VGGGAFPSIATREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  476


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI VF ADK+ P  Y G RTA AI   AL  L 
Sbjct  119  DADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALR  169



>ref|XP_010018621.1| PREDICTED: protein disulfide-isomerase A6 [Nestor notabilis]
Length=444

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  225  DATVNQMLTGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVSRALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIISEDVLKNTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VAGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>gb|KFM05020.1| Protein disulfide-isomerase A6, partial [Aptenodytes forsteri]
Length=440

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ G DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIIGEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGSFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_009273886.1| PREDICTED: protein disulfide-isomerase A6 [Aptenodytes forsteri]
Length=444

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+ G DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIIGEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGSFPKIHSVEPWDGKDGELPVEDDIDL  431



>gb|KFQ08834.1| Protein disulfide-isomerase A6, partial [Leptosomus discolor]
Length=440

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+TG DV++  C +  LC ++ LP ILD+ A GR+ YL+ +L +AEK+K K + ++W  A
Sbjct  280  EITGEDVLKSTCDAHQLCIISVLPHILDTGASGRSSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_005146160.1| PREDICTED: protein disulfide-isomerase A6 [Melopsittacus undulatus]
Length=488

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  269  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVSRALDLFSDNAPPPELL  327

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  328  EIISEDVLKNTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  387

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  388  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  445

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  446  VAGGAFPKIHSVEPWDGKDGELPVEDDIDL  475



>ref|XP_009946939.1| PREDICTED: protein disulfide-isomerase A6 [Leptosomus discolor]
Length=444

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+TG DV++  C +  LC ++ LP ILD+ A GR+ YL+ +L +AEK+K K + ++W  A
Sbjct  284  EITGEDVLKSTCDAHQLCIISVLPHILDTGASGRSSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>gb|KFP92383.1| Protein disulfide-isomerase A6, partial [Apaloderma vittatum]
Length=440

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISILPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|NP_001004442.1| protein disulfide-isomerase A6 precursor [Rattus norvegicus]
 gb|AAH82063.1| Protein disulfide isomerase family A, member 6 [Rattus norvegicus]
 gb|EDM03147.1| rCG62282, isoform CRA_a [Rattus norvegicus]
Length=445

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATVNQVLASRYGIKGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDIAKKTCEEHQLCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGSFPNITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  444


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  87   NADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  137



>emb|CAA55891.1| CaBP1 [Rattus norvegicus]
Length=431

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  212  DATVNQVLASRYGIKGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  270

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  271  EIINEDIAKKTCEEHQLCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEA  330

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  331  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  388

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  389  VGGGSFPNITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  430


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  73   NADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  123



>ref|XP_009997534.1| PREDICTED: protein disulfide-isomerase A6 [Chaetura pelagica]
Length=464

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  245  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVSRALDLFSDNAPPPELL  303

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  304  EIISEDVLKSTCDAHQLCIISILPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  363

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  364  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  421

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            ++G   P I   EPWDGKDGE+  ED+  L
Sbjct  422  VSGGAFPKIHSVEPWDGKDGELPVEDDIDL  451



>ref|NP_001182048.1| protein disulfide-isomerase A6 precursor [Sus scrofa]
 dbj|BAJ11758.1| protein disulfide isomerase P5 [Sus scrofa]
Length=440

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVTRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIISEDVAKKSCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQTELEHALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_006073828.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Bubalus bubalis]
Length=590

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  371  DATGNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  429

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  430  EIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  489

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  490  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  547

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  548  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  589


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  232  DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALR  282



>ref|XP_009874965.1| PREDICTED: protein disulfide-isomerase A6 [Apaloderma vittatum]
Length=444

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIISEDVLKSTCDAHQLCIISILPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>gb|KFV46902.1| Protein disulfide-isomerase A6, partial [Tyto alba]
Length=440

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIISRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKGTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGTFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_005432317.1| PREDICTED: protein disulfide-isomerase A6 [Falco cherrug]
Length=444

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++WA A
Sbjct  284  EIISEDVLKSTCDAHQLCIISVLPHILDTGALGRNSYLDVMLKMAEKYKKKMWGWLWAEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>ref|XP_001502324.3| PREDICTED: protein disulfide-isomerase A6 [Equus caballus]
Length=448

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  229  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIISRALDLFSDNAPPPELL  287

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  288  EIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  347

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  348  GAQSELETALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  405

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  406  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  447


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G R+  AI   AL  L 
Sbjct  90   DADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRSGEAIVDAALSALR  140



>sp|Q63081.2|PDIA6_RAT RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Calcium-binding 
protein 1; Short=CaBP1; AltName: Full=Protein 
disulfide isomerase P5; AltName: Full=Thioredoxin domain-containing 
protein 7; Flags: Precursor [Rattus norvegicus]
Length=440

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIKGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKKTCEEHQLCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGSFPNITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            + D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  82   NADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_009513284.1| PREDICTED: protein disulfide-isomerase A6, partial [Phalacrocorax 
carbo]
Length=390

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  171  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  229

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  230  EIISEDVLKSTCDAHQLCIISILPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  289

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  290  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  347

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  348  VGGGAFPKIHTVEPWDGKDGELPVEDDIDL  377



>ref|XP_007127699.1| PREDICTED: protein disulfide-isomerase A6 [Physeter catodon]
Length=440

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATINQVLASRYEIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EILNEDIAKKTCDEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_004746019.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
 ref|XP_004790281.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
Length=454

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  235  DATANQFLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSENAPPPELL  293

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  294  EIISEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  353

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  354  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  411

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + +DE
Sbjct  412  VGGGAFPPISAREPWDGKDGELPVEDDIDLSDVELDD-LERDE  453


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  96   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALGALR  146



>ref|XP_009463744.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Nipponia nippon]
Length=443

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  224  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  282

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  283  EIINEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  342

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  343  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  400

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  401  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  430



>gb|KFO65258.1| Protein disulfide-isomerase A6, partial [Corvus brachyrhynchos]
Length=440

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_006140909.1| PREDICTED: protein disulfide-isomerase A6 [Tupaia chinensis]
Length=535

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  316  DATVNQGLASRYGIRGFPTIKIF-QRGESPVDYDGGRTRSDIVARALDLFSDNAPPPELL  374

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  375  EIVNEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  434

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  435  GAQSDLESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  492

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I + EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  493  VGGGAFPAIFEREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  534


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  177  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  227



>ref|XP_006903376.1| PREDICTED: protein disulfide-isomerase A6-like [Elephantulus 
edwardii]
Length=508

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  289  DATANQLLSQRYGIRGFPTIKIF-QKGESPVDYDGGRTKSNIVSRALDLFSDNAPPPELL  347

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YL+ LL +A+K+K K + ++WA A
Sbjct  348  EIINEDIAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWAEA  407

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  408  GAQNELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  465

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  466  VGGGAFPKISSIEPWDGKDGELPVEDDIDLSDVELDD-LGKDE  507


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   A+
Sbjct  151  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTAEAIVDSAV  197



>ref|XP_007456979.1| PREDICTED: protein disulfide-isomerase A6 [Lipotes vexillifer]
Length=440

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 133/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATINQVLASRYEIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+  + C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EILSEDIARKACEEYQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGVFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALR  132



>gb|KFQ83261.1| Protein disulfide-isomerase A6, partial [Phoenicopterus ruber 
ruber]
Length=440

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIINEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_005645986.1| protein disulfide isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE21442.1| protein disulfide isomerase [Coccomyxa subellipsoidea C-169]
Length=416

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 138/225 (61%), Gaps = 10/225 (4%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            DC    ++     VQG+PTI VFGADK  P  YNGAR +S++ +YA+EQ      PPE  
Sbjct  194  DCTGNAAICQEHGVQGYPTIKVFGADKGAPTDYNGARDSSSMAAYAIEQWSSLQPPPEAQ  253

Query  609  ELTGPDVMEEKCSSAA------LCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYS  448
            EL   D  E +C   +      LC +AFLP ILD KA GR  +++ L  +A K+K +P+S
Sbjct  254  ELIDEDTFEIQCLGHSDAPPKKLCLIAFLPHILDDKAVGRKAHIQMLADLAAKYKDRPFS  313

Query  447  YVWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGG  268
            Y+WA  G QP LE    VGGYGYPAL+ L+  +  +APLKS+F+   + +F+  + +  G
Sbjct  314  YLWAEGGAQPQLEAAFEVGGYGYPALIALNPADGKFAPLKSAFEPQPLVQFIEGLRQ--G  371

Query  267  RGRNLPLTG-TPTIVKTEPWDGKDGEIM-EEDEFSLEELMGDDTV  139
              R  PL G  P++V   PWDG +G +  EE+EFSL+++MGDD +
Sbjct  372  FARVQPLQGDLPSVVSVSPWDGGEGVLQEEEEEFSLDDIMGDDEL  416



>ref|XP_009961799.1| PREDICTED: protein disulfide-isomerase A6 [Tyto alba]
Length=444

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  225  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIISRALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIISEDVLKGTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGTFPKIHSVEPWDGKDGELPVEDDIDL  431



>ref|XP_004665748.1| PREDICTED: protein disulfide-isomerase A6 [Jaculus jaculus]
Length=440

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTKSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKKTCEEHQLCIVAVLPHILDTGAAGRNSYLEVLLRLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQFELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPAISTREPWDGRDGELPVEDDIDLSDVELDD-LGKDE  439


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGEAIVDAALSALR  132



>ref|XP_010391624.1| PREDICTED: protein disulfide-isomerase A6 [Corvus cornix cornix]
Length=442

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  223  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  282  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  342  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  399

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  400  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  429



>ref|XP_008639999.1| PREDICTED: protein disulfide-isomerase A6 [Corvus brachyrhynchos]
Length=442

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  223  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  282  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  342  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  399

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  400  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  429



>ref|XP_532876.2| PREDICTED: protein disulfide-isomerase A6 [Canis lupus familiaris]
Length=440

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + P+ Y G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQLLASRYGIRGFPTIKIF-QKGESPMEYEGGRTRSDIVSRALDLFSENAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  280  EIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   PTI   EPWDGKDGE+  ED+  L ++  DD + +DE
Sbjct  398  VGGGAFPTISTREPWDGKDGELPVEDDIDLSDVELDD-LERDE  439


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G+RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGSRTGEAIVDAALGALR  132



>ref|XP_006102414.1| PREDICTED: protein disulfide-isomerase A6 [Myotis lucifugus]
Length=503

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L  R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  284  DATANQMLTGRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  342

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  343  EIISEDVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  402

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  403  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  460

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  461  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  502


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RTA AI   AL  L 
Sbjct  147  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALR  197



>ref|XP_010114738.1| PREDICTED: protein disulfide-isomerase A6, partial [Chlamydotis 
macqueenii]
Length=445

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  226  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  285  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  403  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  432



>gb|KFP35427.1| Protein disulfide-isomerase A6, partial [Chlamydotis macqueenii]
Length=440

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>gb|ELK13980.1| Protein disulfide-isomerase A6 [Pteropus alecto]
Length=469

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D  A + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  250  DATANQVLSSRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELH  308

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YL+ LL +A+K+K K + ++W  A
Sbjct  309  EIISEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWTEA  368

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  369  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  426

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + +DE
Sbjct  427  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LERDE  468


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYAL  649
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y GART+ AI   AL
Sbjct  111  DADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGARTSEAIVDAAL  157



>ref|XP_006021844.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Alligator sinensis]
Length=445

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 133/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT + I + AL+    N   PE+ 
Sbjct  226  DATVNQMLTGRYGIRGFPTIKIFQKGED-PVDYDGGRTRADIVTRALDLFSDNAPAPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+++  C +  LC +A LP ILD+ A GRN YLE +L +AEK+K K + ++W  A
Sbjct  285  EVINADILKSTCEAHQLCIIAVLPHILDTGASGRNSYLEVMLKMAEKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD   KDE
Sbjct  403  VAGGAFPKINTVEPWDGKDGELPVEDDIDLSDVDLDDW-EKDE  444



>ref|XP_007607763.1| PREDICTED: protein disulfide-isomerase A6 [Cricetulus griseus]
Length=445

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L +R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  226  DATVNQVLANRYGIRGFPTIKIF-QKGEAPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  284

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  285  EIINEDVAKKMCEEHQLCVVAVLPHILDTGAAGRNSYLEILLKLADKYKKKMWGWLWTEA  344

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  345  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  402

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDG+DGE+  ED+  L ++  DD + KDE
Sbjct  403  VGGGSFPAITAREPWDGRDGELPVEDDIDLSDVELDD-LEKDE  444


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  87   DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  137



>ref|XP_004373116.1| PREDICTED: protein disulfide-isomerase A6 [Trichechus manatus 
latirostris]
Length=440

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L +R+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQVLANRYGIRGFPTIKIF-QKGEPPVDYDGGRTKSDIVSRALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+ ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++WA A
Sbjct  280  EIISEDIAKKTCEDHQLCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWAEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQYELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  VGGGAFPKISTIEPWDGKDGELPVEDDIDLSDVELDD-LEKDE  439



>ref|XP_005521916.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Pseudopodoces 
humilis]
Length=446

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  227  DATVNQVLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  285

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  286  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  345

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  346  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  403

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  404  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  433



>ref|XP_005521917.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Pseudopodoces 
humilis]
Length=442

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  223  DATVNQVLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  281

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  282  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  341

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  342  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  399

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  400  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  429



>ref|XP_006976688.1| PREDICTED: protein disulfide-isomerase A6 [Peromyscus maniculatus 
bairdii]
Length=602

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  383  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  441

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  442  EIINEDVAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  501

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  502  GAQYDLENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAP  559

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  560  VGGGSFPAITPREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  601


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FGA+K+ P  Y G RT  AI   AL  L 
Sbjct  244  DADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALR  294



>gb|KFR16570.1| Protein disulfide-isomerase A6, partial [Opisthocomus hoazin]
Length=434

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  215  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  273

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++WA A
Sbjct  274  EIINEDVLKSICDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWAEA  333

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  334  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  391

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  392  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  421



>ref|XP_009940378.1| PREDICTED: protein disulfide-isomerase A6 [Opisthocomus hoazin]
Length=447

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  228  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  286

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++WA A
Sbjct  287  EIINEDVLKSICDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWAEA  346

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  347  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  404

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  405  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  434



>gb|EPY75602.1| protein disulfide-isomerase A6 [Camelus ferus]
Length=551

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  332  DATVNQVLASRYGIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL  390

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YLE LL +A+K+K K + ++W  A
Sbjct  391  EIINEDVAKKTCEEHQLCVVAILPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEA  450

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  451  GAQSELESALGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  508

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  509  VGGGAFPAISTREPWDGKDGELPVEDDIDLSDVELDD-LEKDE  550


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT+ AI   AL  L 
Sbjct  193  DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALR  243



>gb|KFV66878.1| Protein disulfide-isomerase A6, partial [Picoides pubescens]
Length=440

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLTGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VAGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>gb|KFO12540.1| Protein disulfide-isomerase A6, partial [Balearica regulorum 
gibbericeps]
Length=440

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G+RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGSRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_010304195.1| PREDICTED: protein disulfide-isomerase A6 [Balearica regulorum 
gibbericeps]
Length=444

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G+RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGSRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



>gb|KFQ57711.1| Protein disulfide-isomerase A6, partial [Pelecanus crispus]
Length=440

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLAGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIVARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHSVEPWDGKDGELPVEDDIDL  427



>ref|XP_004401842.1| PREDICTED: protein disulfide-isomerase A6 [Odobenus rosmarus 
divergens]
Length=440

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 134/223 (60%), Gaps = 6/223 (3%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F    + PV Y+G RT S I S AL+    N  PPE+ 
Sbjct  221  DATVNQLLASRYEIRGFPTIKIF-QKGESPVDYDGGRTRSDIVSRALDLFSENAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV ++ C    LC VA LP ILD+ A GRN YL+ LL +A+K+K K + ++W  A
Sbjct  280  EIISEDVAKKTCEERQLCVVAVLPHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSELENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  127
            + G   P I   EPWDGKDGE+  ED+  L ++  DD + +DE
Sbjct  398  VGGGAFPAISAREPWDGKDGELPVEDDIDLSDVELDD-LERDE  439


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLE  637
            D D  +SL  ++ VQGFPTI +FG++K+ P  Y G RT  AI   AL  L 
Sbjct  82   DADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR  132



>gb|KFP66932.1| Protein disulfide-isomerase A6, partial [Cariama cristata]
Length=440

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L SR+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  221  DATVNQMLASRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  279

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   D+++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  280  EIINEDILKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  339

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  340  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  397

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  398  VGGGAFPKIHLVEPWDGKDGELPVEDDIDL  427



>ref|XP_009898142.1| PREDICTED: protein disulfide-isomerase A6, partial [Picoides 
pubescens]
Length=444

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 127/210 (60%), Gaps = 5/210 (2%)
 Frame = -2

Query  789  DCDAEKSLMSRFSVQGFPTILVFGADKDHPVPYNGARTASAIESYALEQLEINVSPPEVT  610
            D    + L  R+ ++GFPTI +F   +D PV Y+G RT S I + AL+    N  PPE+ 
Sbjct  225  DATVNQMLTGRYGIRGFPTIKIFQKGED-PVDYDGGRTRSDIIARALDLFSDNAPPPELL  283

Query  609  ELTGPDVMEEKCSSAALCFVAFLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAA  430
            E+   DV++  C +  LC ++ LP ILD+ A GRN YL+ +L +AEK+K K + ++W  A
Sbjct  284  EIISEDVLKSTCDAHQLCIISVLPHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEA  343

Query  429  GKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLP  250
            G Q DLE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P
Sbjct  344  GAQSDLESSLGIGGFGYPAMAAVNARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAP  401

Query  249  LTGT--PTIVKTEPWDGKDGEIMEEDEFSL  166
            + G   P I   EPWDGKDGE+  ED+  L
Sbjct  402  VAGGAFPKIHSVEPWDGKDGELPVEDDIDL  431



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1600433394064