BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10946

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603199.1|  PREDICTED: uncharacterized protein LOC104098231    180   6e-49   Nicotiana tomentosiformis
ref|XP_006359954.1|  PREDICTED: uncharacterized protein LOC102605...    178   2e-48   Solanum tuberosum [potatoes]
ref|XP_006359953.1|  PREDICTED: uncharacterized protein LOC102605...    178   2e-48   Solanum tuberosum [potatoes]
ref|XP_009769854.1|  PREDICTED: uncharacterized protein LOC104220660    177   9e-48   Nicotiana sylvestris
ref|XP_004246017.1|  PREDICTED: uncharacterized protein LOC101254412    176   2e-47   Solanum lycopersicum
emb|CDP07209.1|  unnamed protein product                                173   2e-46   Coffea canephora [robusta coffee]
gb|KJB25097.1|  hypothetical protein B456_004G177500                    166   6e-45   Gossypium raimondii
gb|KJB25099.1|  hypothetical protein B456_004G177500                    165   5e-44   Gossypium raimondii
gb|KJB25101.1|  hypothetical protein B456_004G177500                    166   5e-44   Gossypium raimondii
gb|KJB25098.1|  hypothetical protein B456_004G177500                    165   7e-44   Gossypium raimondii
gb|KJB25102.1|  hypothetical protein B456_004G177500                    165   1e-43   Gossypium raimondii
gb|EYU37484.1|  hypothetical protein MIMGU_mgv1a002766mg                165   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_011082185.1|  PREDICTED: uncharacterized protein LOC105165...    162   8e-43   Sesamum indicum [beniseed]
ref|XP_011082183.1|  PREDICTED: uncharacterized protein LOC105165...    162   9e-43   Sesamum indicum [beniseed]
gb|KJB25104.1|  hypothetical protein B456_004G177500                    162   1e-42   Gossypium raimondii
ref|XP_011082184.1|  PREDICTED: uncharacterized protein LOC105165...    162   1e-42   Sesamum indicum [beniseed]
gb|KCW72694.1|  hypothetical protein EUGRSUZ_E01147                     162   2e-42   Eucalyptus grandis [rose gum]
gb|KFK36454.1|  hypothetical protein AALP_AA4G126700                    161   3e-42   Arabis alpina [alpine rockcress]
ref|XP_010056116.1|  PREDICTED: uncharacterized protein LOC104444...    161   4e-42   
ref|XP_010056115.1|  PREDICTED: uncharacterized protein LOC104444...    160   6e-42   Eucalyptus grandis [rose gum]
emb|CDP07210.1|  unnamed protein product                                160   7e-42   Coffea canephora [robusta coffee]
ref|XP_010505074.1|  PREDICTED: uncharacterized protein LOC104781967    159   1e-41   Camelina sativa [gold-of-pleasure]
gb|EPS61566.1|  hypothetical protein M569_13228                         157   1e-41   Genlisea aurea
gb|KHF98530.1|  hypothetical protein F383_12515                         159   2e-41   Gossypium arboreum [tree cotton]
emb|CDX84192.1|  BnaC04g09540D                                          157   6e-41   
emb|CDY31704.1|  BnaA05g08430D                                          157   6e-41   Brassica napus [oilseed rape]
ref|XP_009143647.1|  PREDICTED: uncharacterized protein LOC103867343    157   6e-41   Brassica rapa
gb|KJB51494.1|  hypothetical protein B456_008G219000                    155   6e-41   Gossypium raimondii
ref|XP_002881404.1|  hypothetical protein ARALYDRAFT_902666             156   1e-40   
ref|XP_006293822.1|  hypothetical protein CARUB_v10022808mg             156   2e-40   Capsella rubella
ref|XP_011028505.1|  PREDICTED: uncharacterized protein LOC105128...    156   2e-40   Populus euphratica
ref|XP_010518959.1|  PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D...    156   2e-40   Tarenaya hassleriana [spider flower]
emb|CDY32116.1|  BnaC04g44500D                                          156   2e-40   Brassica napus [oilseed rape]
ref|XP_007040866.1|  Xyloglucanase 113 isoform 2                        155   2e-40   
ref|XP_007040867.1|  Xyloglucanase 113 isoform 3                        155   2e-40   
ref|XP_010509590.1|  PREDICTED: uncharacterized protein LOC104785987    155   2e-40   Camelina sativa [gold-of-pleasure]
ref|NP_850250.1|  xyloglucanase 113                                     155   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516741.1|  PREDICTED: uncharacterized protein LOC104792321    155   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_012079766.1|  PREDICTED: uncharacterized protein LOC105640147    155   4e-40   Jatropha curcas
dbj|BAH19600.1|  AT2G35610                                              155   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300682.1|  PREDICTED: uncharacterized protein LOC101298609    155   5e-40   Fragaria vesca subsp. vesca
ref|XP_007040865.1|  Xyloglucanase 113 isoform 1                        155   5e-40   
ref|XP_011028504.1|  PREDICTED: uncharacterized protein LOC105128...    154   6e-40   Populus euphratica
ref|XP_006410719.1|  hypothetical protein EUTSA_v10016368mg             154   8e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010266424.1|  PREDICTED: uncharacterized protein LOC104603...    154   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009141501.1|  PREDICTED: uncharacterized protein LOC103865...    154   1e-39   Brassica rapa
gb|KJB51493.1|  hypothetical protein B456_008G219000                    154   1e-39   Gossypium raimondii
gb|KHG12902.1|  hypothetical protein F383_16835                         154   1e-39   Gossypium arboreum [tree cotton]
ref|XP_006385158.1|  hypothetical protein POPTR_0004s24390g             153   2e-39   
ref|XP_009141500.1|  PREDICTED: uncharacterized protein LOC103865...    153   3e-39   Brassica rapa
emb|CDY40459.1|  BnaA04g20580D                                          152   3e-39   Brassica napus [oilseed rape]
ref|XP_008365916.1|  PREDICTED: uncharacterized protein LOC103429...    150   2e-38   
ref|XP_010266425.1|  PREDICTED: uncharacterized protein LOC104603...    150   2e-38   Nelumbo nucifera [Indian lotus]
gb|KHN27499.1|  hypothetical protein glysoja_018611                     149   5e-38   Glycine soja [wild soybean]
ref|XP_003547737.1|  PREDICTED: uncharacterized protein LOC100780346    149   6e-38   Glycine max [soybeans]
ref|XP_007210882.1|  hypothetical protein PRUPE_ppa002815mg             148   1e-37   Prunus persica
emb|CDP12730.1|  unnamed protein product                                147   2e-37   Coffea canephora [robusta coffee]
ref|XP_009362859.1|  PREDICTED: uncharacterized protein LOC103952897    147   3e-37   Pyrus x bretschneideri [bai li]
gb|KHG12903.1|  hypothetical protein F383_16835                         146   7e-37   Gossypium arboreum [tree cotton]
emb|CDP12729.1|  unnamed protein product                                145   9e-37   Coffea canephora [robusta coffee]
ref|XP_007156343.1|  hypothetical protein PHAVU_003G278500g             144   1e-36   Phaseolus vulgaris [French bean]
ref|XP_010676706.1|  PREDICTED: uncharacterized protein LOC104892...    144   1e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676705.1|  PREDICTED: uncharacterized protein LOC104892...    144   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002519934.1|  reticulon3-A3, putative                            144   3e-36   Ricinus communis
ref|XP_010676703.1|  PREDICTED: uncharacterized protein LOC104892...    144   3e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006430896.1|  hypothetical protein CICLE_v10011269mg             144   5e-36   Citrus clementina [clementine]
ref|XP_008782814.1|  PREDICTED: uncharacterized protein LOC103702...    139   8e-36   Phoenix dactylifera
ref|XP_004509491.1|  PREDICTED: uncharacterized protein LOC101505601    143   8e-36   Cicer arietinum [garbanzo]
ref|XP_010111777.1|  hypothetical protein L484_008781                   142   1e-35   Morus notabilis
emb|CDP12731.1|  unnamed protein product                                143   1e-35   Coffea canephora [robusta coffee]
gb|KHN03113.1|  hypothetical protein glysoja_049543                     142   1e-35   Glycine soja [wild soybean]
ref|XP_003548765.1|  PREDICTED: uncharacterized protein LOC100819032    142   1e-35   Glycine max [soybeans]
emb|CAN79199.1|  hypothetical protein VITISV_040773                     143   2e-35   Vitis vinifera
ref|XP_008782812.1|  PREDICTED: uncharacterized protein LOC103702...    138   2e-35   Phoenix dactylifera
gb|EPS61907.1|  hypothetical protein M569_12886                         136   3e-35   Genlisea aurea
gb|KHN41773.1|  Pentatricopeptide repeat-containing protein, mito...    144   3e-35   Glycine soja [wild soybean]
ref|XP_002269181.2|  PREDICTED: uncharacterized protein LOC100263017    141   3e-35   Vitis vinifera
emb|CBI29197.3|  unnamed protein product                                141   3e-35   Vitis vinifera
gb|KDO72261.1|  hypothetical protein CISIN_1g036925mg                   140   1e-34   Citrus sinensis [apfelsine]
ref|XP_006482352.1|  PREDICTED: uncharacterized protein LOC102613765    140   1e-34   Citrus sinensis [apfelsine]
gb|KHN05539.1|  hypothetical protein glysoja_020504                     139   2e-34   Glycine soja [wild soybean]
ref|XP_006590766.1|  PREDICTED: uncharacterized protein LOC100789338    139   2e-34   Glycine max [soybeans]
ref|XP_003612490.1|  hypothetical protein MTR_5g025590                  139   3e-34   
gb|AES95448.2|  nucleotide-diphospho-sugar transferase family pro...    139   4e-34   Medicago truncatula
gb|AAD15452.2|  unknown protein                                         137   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517099.1|  PREDICTED: uncharacterized protein LOC100776463    137   7e-34   Glycine max [soybeans]
gb|AET03500.2|  nucleotide-diphospho-sugar transferase family pro...    137   9e-34   Medicago truncatula
ref|XP_003629024.1|  hypothetical protein MTR_8g072310                  137   1e-33   
ref|XP_011623933.1|  PREDICTED: uncharacterized protein LOC184227...    136   2e-33   Amborella trichopoda
ref|XP_006878624.1|  PREDICTED: uncharacterized protein LOC184227...    136   2e-33   Amborella trichopoda
ref|XP_008444233.1|  PREDICTED: uncharacterized protein LOC103487624    135   5e-33   Cucumis melo [Oriental melon]
ref|XP_007158076.1|  hypothetical protein PHAVU_002G122000g             134   2e-32   Phaseolus vulgaris [French bean]
ref|XP_004142646.1|  PREDICTED: uncharacterized protein LOC101203732    133   3e-32   Cucumis sativus [cucumbers]
gb|KJB25103.1|  hypothetical protein B456_004G177500                    132   4e-32   Gossypium raimondii
ref|XP_004982506.1|  PREDICTED: uncharacterized protein LOC101753789    132   5e-32   Setaria italica
ref|NP_001143144.1|  hypothetical protein                               131   1e-31   Zea mays [maize]
ref|XP_010907097.1|  PREDICTED: uncharacterized protein LOC105033...    130   3e-31   Elaeis guineensis
ref|XP_010907098.1|  PREDICTED: uncharacterized protein LOC105033...    130   3e-31   Elaeis guineensis
gb|EMS55953.1|  hypothetical protein TRIUR3_26709                       129   7e-31   Triticum urartu
ref|XP_002464281.1|  hypothetical protein SORBIDRAFT_01g015590          129   8e-31   Sorghum bicolor [broomcorn]
ref|XP_010676704.1|  PREDICTED: uncharacterized protein LOC104892...    127   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010540709.1|  PREDICTED: uncharacterized protein LOC104814389    127   2e-30   Tarenaya hassleriana [spider flower]
ref|XP_010235552.1|  PREDICTED: uncharacterized protein LOC100829311    127   4e-30   
ref|XP_004512439.1|  PREDICTED: uncharacterized protein LOC101497257    126   1e-29   
ref|XP_003562333.1|  PREDICTED: uncharacterized protein LOC100845970    125   2e-29   Brachypodium distachyon [annual false brome]
ref|NP_001050567.1|  Os03g0586300                                       120   3e-28   
ref|XP_009383104.1|  PREDICTED: uncharacterized protein LOC103970914    121   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC75649.1|  hypothetical protein OsI_12401                          119   3e-27   Oryza sativa Indica Group [Indian rice]
gb|ABF97349.1|  expressed protein                                       119   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002991425.1|  glycosyltransferase-like protein                   115   3e-26   
ref|XP_002988322.1|  glycosyltransferase-like protein                   115   7e-26   
ref|XP_001761094.1|  predicted protein                                  106   6e-23   
gb|EPS68350.1|  hypothetical protein M569_06419                         105   1e-22   Genlisea aurea
ref|XP_006650304.1|  PREDICTED: uncharacterized protein LOC102706084    104   4e-22   Oryza brachyantha
emb|CDX84232.1|  BnaC04g09940D                                        96.7    3e-21   
ref|XP_005758156.1|  hypothetical protein EMIHUDRAFT_77405            66.2    3e-09   Emiliania huxleyi CCMP1516
ref|XP_005649227.1|  hypothetical protein COCSUDRAFT_62105            66.2    3e-09   Coccomyxa subellipsoidea C-169
ref|XP_005843950.1|  hypothetical protein CHLNCDRAFT_37217            66.2    3e-09   Chlorella variabilis
ref|XP_002956226.1|  hypothetical protein VOLCADRAFT_97156            65.1    7e-09   Volvox carteri f. nagariensis
gb|KDD76569.1|  nucleotide-diphospho-sugar transferase                64.7    1e-08   Helicosporidium sp. ATCC 50920
ref|XP_005852062.1|  hypothetical protein CHLNCDRAFT_133059           63.9    2e-08   Chlorella variabilis
ref|XP_005760837.1|  hypothetical protein EMIHUDRAFT_465597           63.2    5e-08   Emiliania huxleyi CCMP1516
ref|XP_011398427.1|  hypothetical protein F751_0558                   60.1    2e-07   Auxenochlorella protothecoides
ref|XP_003078397.1|  unnamed protein product                          58.2    1e-06   
ref|XP_011397700.1|  hypothetical protein F751_1691                   57.4    3e-06   Auxenochlorella protothecoides
emb|CEF97310.1|  Nucleotide-diphospho-sugar transferase               57.0    3e-06   Ostreococcus tauri
gb|KIZ02110.1|  hypothetical protein MNEG_5845                        56.2    5e-06   Monoraphidium neglectum
ref|XP_007509006.1|  predicted protein                                55.8    8e-06   Bathycoccus prasinos
ref|XP_002506735.1|  glycosyltransferase family 77 protein            55.5    1e-05   Micromonas commoda
ref|XP_005772161.1|  hypothetical protein EMIHUDRAFT_117868           55.1    2e-05   Emiliania huxleyi CCMP1516
ref|XP_005709932.1|  glycosyl transferase family GT77 cell wall p...  53.9    4e-05   Chondrus crispus [carageen]
ref|XP_007512211.1|  predicted protein                                52.4    1e-04   Bathycoccus prasinos
ref|XP_001692787.1|  predicted protein                                52.0    2e-04   Chlamydomonas reinhardtii
ref|XP_011395852.1|  hypothetical protein F751_0343                   51.6    2e-04   Auxenochlorella protothecoides



>ref|XP_009603199.1| PREDICTED: uncharacterized protein LOC104098231 [Nicotiana tomentosiformis]
Length=636

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 133/178 (75%), Gaps = 8/178 (4%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  +S+ +          IAPS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPHSSTFS--------LSIAPSASSD  59

Query  327  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  506
              A   +Q  N S  +  G       Q +SK LKPIWI PP GS+MP LE+FRL+KEL +
Sbjct  60   AKAEPSSQASNFSRLQADGDSTPLNPQLQSKLLKPIWIVPPAGSKMPYLESFRLSKELVE  119

Query  507  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            ERV  NV++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  120  ERVIGNVVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPVFD  177



>ref|XP_006359954.1| PREDICTED: uncharacterized protein LOC102605574 isoform X2 [Solanum 
tuberosum]
Length=634

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 133/178 (75%), Gaps = 9/178 (5%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  ++ S           +APS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPNSTFS---------LSMAPSTSSD  58

Query  327  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  506
            V A    Q  N S ++   +    K Q +SK LKPIW  PP GS+M  LETF+L+KEL Q
Sbjct  59   VKAEPSVQASNFSHRQVDDASIPVKPQHQSKLLKPIWKVPPAGSKMLDLETFKLSKELVQ  118

Query  507  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            ERV DN+++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  119  ERVTDNIVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPVFD  176



>ref|XP_006359953.1| PREDICTED: uncharacterized protein LOC102605574 isoform X1 [Solanum 
tuberosum]
Length=635

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 133/178 (75%), Gaps = 9/178 (5%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  ++ S           +APS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPNSTFS---------LSMAPSTSSD  58

Query  327  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  506
            V A    Q  N S ++   +    K Q +SK LKPIW  PP GS+M  LETF+L+KEL Q
Sbjct  59   VKAEPSVQASNFSHRQVDDASIPVKPQHQSKLLKPIWKVPPAGSKMLDLETFKLSKELVQ  118

Query  507  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            ERV DN+++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  119  ERVTDNIVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPVFD  176



>ref|XP_009769854.1| PREDICTED: uncharacterized protein LOC104220660 [Nicotiana sylvestris]
Length=636

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 131/178 (74%), Gaps = 8/178 (4%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            +EMANSKPLF+TIYATV +G+VFS+ YVFSA+YSS  +S+ +          IAPS S D
Sbjct  8    KEMANSKPLFMTIYATVLIGIVFSSVYVFSAIYSSPHSSTFS--------LSIAPSASSD  59

Query  327  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  506
              A   +Q  N S  +  G       Q +SK LK IW  PP GS+MP LE+FRL+KEL Q
Sbjct  60   AEAEPSSQASNFSRLQADGHSTPLNPQLQSKLLKAIWTVPPAGSKMPDLESFRLSKELVQ  119

Query  507  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            ERV  NV++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  120  ERVIGNVVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPVFD  177



>ref|XP_004246017.1| PREDICTED: uncharacterized protein LOC101254412 [Solanum lycopersicum]
Length=635

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 130/178 (73%), Gaps = 9/178 (5%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            +EMANSKPLFLTIYATV +G+VFS+ YVFSA+YSS  ++ S           IAPS S D
Sbjct  8    KEMANSKPLFLTIYATVVIGIVFSSVYVFSAIYSSPNSTFS---------LSIAPSASSD  58

Query  327  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  506
              A    Q  N S ++        K Q + K LKPIW  PP GS+MP LETF+L+KEL Q
Sbjct  59   EKAEPSVQASNFSHRQVDDVSIPVKPQLQRKLLKPIWEVPPAGSKMPDLETFKLSKELVQ  118

Query  507  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            ERV DN++IVTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+P FD
Sbjct  119  ERVIDNIVIVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPAFD  176



>emb|CDP07209.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 139/179 (78%), Gaps = 13/179 (7%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
            +++MAN KP+FLTIYATV VGVV S+FYVFSAVYSSS++SSS+  +S +        +SP
Sbjct  8    IKDMANYKPVFLTIYATVVVGVVVSSFYVFSAVYSSSSSSSSSSSSSLW--------FSP  59

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  503
                 V  Q+ N S    V       +Q +SKS+KPIW +PP GS+MP L+TFRLTKEL 
Sbjct  60   -----VQNQVSNSSHVTVVNVSLGSTSQTQSKSMKPIWEAPPSGSKMPPLKTFRLTKELV  114

Query  504  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            Q+RV+DNVI+VTFGNYAFMDFILTWVKHLTD+ VDNLLVGA+DTKL+EALYWKG+PVFD
Sbjct  115  QQRVKDNVIVVTFGNYAFMDFILTWVKHLTDLGVDNLLVGAMDTKLVEALYWKGVPVFD  173



>gb|KJB25097.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=399

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 115/194 (59%), Gaps = 36/194 (19%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  315  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  458
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  639  LLEALYWKGIPVFD  680
            LLEALYWKG+PVFD
Sbjct  161  LLEALYWKGVPVFD  174



>gb|KJB25099.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
 gb|KJB25100.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=519

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 115/194 (59%), Gaps = 36/194 (19%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  315  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  458
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  639  LLEALYWKGIPVFD  680
            LLEALYWKG+PVFD
Sbjct  161  LLEALYWKGVPVFD  174



>gb|KJB25101.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=588

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 115/194 (59%), Gaps = 36/194 (19%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  315  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  458
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  639  LLEALYWKGIPVFD  680
            LLEALYWKG+PVFD
Sbjct  161  LLEALYWKGVPVFD  174



>gb|KJB25098.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=559

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 115/194 (59%), Gaps = 36/194 (19%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  315  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  458
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  639  LLEALYWKGIPVFD  680
            LLEALYWKG+PVFD
Sbjct  161  LLEALYWKGVPVFD  174



>gb|KJB25102.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=634

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 115/194 (59%), Gaps = 36/194 (19%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  315  YSPDVPAAV------------LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  458
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  639  LLEALYWKGIPVFD  680
            LLEALYWKG+PVFD
Sbjct  161  LLEALYWKGVPVFD  174



>gb|EYU37484.1| hypothetical protein MIMGU_mgv1a002766mg [Erythranthe guttata]
Length=640

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 130/179 (73%), Gaps = 5/179 (3%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
            ++E+  S+PLFLTIYATV VG++ S+FYVFSAV+S S + SS   +S      +  + SP
Sbjct  7    LKEVTTSRPLFLTIYATVIVGILVSSFYVFSAVFSGSNSVSSPWFSSLSPAGDVVRASSP  66

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  503
                A      N S +  +GS     ++ K   L PIW +PPPGS MP LETFRLTKEL 
Sbjct  67   SFNGA-----SNSSHEVVIGSAPNLPSRPKKTPLSPIWKAPPPGSEMPPLETFRLTKELV  121

Query  504  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            Q+RV+DNVIIVTFGN+AFMDFILTWVKHL+DM V+N LVGA+DTKL+EALYWKG+PVFD
Sbjct  122  QQRVKDNVIIVTFGNFAFMDFILTWVKHLSDMGVENFLVGAMDTKLVEALYWKGVPVFD  180



>ref|XP_011082185.1| PREDICTED: uncharacterized protein LOC105165007 isoform X3 [Sesamum 
indicum]
Length=622

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 133/179 (74%), Gaps = 5/179 (3%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
            ++E AN++PLFLTIYATV +G+  S+FYVFSAV+SSS + SS   ++S     +A + SP
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSPWFSTSPPSGDVAEASSP  66

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  503
                   +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKEL 
Sbjct  67   S-----FSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKELV  121

Query  504  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            Q+RV+DNVI+VTFGN+AFMDFILTWVKHL+DM VDNLLVGA+DTKLLEALYWKGIPVFD
Sbjct  122  QQRVKDNVIVVTFGNFAFMDFILTWVKHLSDMGVDNLLVGAMDTKLLEALYWKGIPVFD  180



>ref|XP_011082183.1| PREDICTED: uncharacterized protein LOC105165007 isoform X1 [Sesamum 
indicum]
Length=640

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 133/179 (74%), Gaps = 5/179 (3%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
            ++E AN++PLFLTIYATV +G+  S+FYVFSAV+SSS + SS   ++S     +A + SP
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSPWFSTSPPSGDVAEASSP  66

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  503
                   +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKEL 
Sbjct  67   S-----FSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKELV  121

Query  504  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            Q+RV+DNVI+VTFGN+AFMDFILTWVKHL+DM VDNLLVGA+DTKLLEALYWKGIPVFD
Sbjct  122  QQRVKDNVIVVTFGNFAFMDFILTWVKHLSDMGVDNLLVGAMDTKLLEALYWKGIPVFD  180



>gb|KJB25104.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=620

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 115/182 (63%), Gaps = 26/182 (14%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
            YSP  P +  TQ  + S   +    Q   +Q  S  LK IW +PP  S+MP LE+F+LTK
Sbjct  41   YSPSAPTS--TQSISTSWLSSPPLSQNKASQPGSNQLKTIWEAPPSNSKMPPLESFKLTK  98

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
            EL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTKLLEALYWKG+PV
Sbjct  99   ELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTKLLEALYWKGVPV  158

Query  675  FD  680
            FD
Sbjct  159  FD  160



>ref|XP_011082184.1| PREDICTED: uncharacterized protein LOC105165007 isoform X2 [Sesamum 
indicum]
Length=639

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 133/181 (73%), Gaps = 10/181 (6%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
            ++E AN++PLFLTIYATV +G+  S+FYVFSAV+SSS + SS         F  +P  S 
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSP-------WFSTSPP-SG  58

Query  324  DVPAAV--LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  497
            DV A+    +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKE
Sbjct  59   DVAASSPSFSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKE  118

Query  498  LFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVF  677
            L Q+RV+DNVI+VTFGN+AFMDFILTWVKHL+DM VDNLLVGA+DTKLLEALYWKGIPVF
Sbjct  119  LVQQRVKDNVIVVTFGNFAFMDFILTWVKHLSDMGVDNLLVGAMDTKLLEALYWKGIPVF  178

Query  678  D  680
            D
Sbjct  179  D  179



>gb|KCW72694.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=611

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 129/195 (66%), Gaps = 33/195 (17%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            K+  QE+A+S+PLFLTIYATV  G+V S+ YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  315  YSPDVPAAVLT------------QIHNESLKETVGSPQ-APKTQAKSKSLKPIWISPPPG  455
             SPD  + + +            Q  N SL  TVG+   AP +Q        +W+ PP  
Sbjct  45   SSPDSTSWLSSPSSLSYVDSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKS  103

Query  456  SRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDT  635
            S+MPSL+TFRLTKEL ++RV+DNVIIVTFGNYAFMDFIL+WVKHLTD++V NLLVGA+DT
Sbjct  104  SKMPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLNVYNLLVGAMDT  163

Query  636  KLLEALYWKGIPVFD  680
            KLLEALYWKGIPVFD
Sbjct  164  KLLEALYWKGIPVFD  178



>gb|KFK36454.1| hypothetical protein AALP_AA4G126700 [Arabis alpina]
Length=642

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 128/194 (66%), Gaps = 29/194 (15%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +   +E  NSKPLF+TIYATV +GV+ S+FYVFSA+YS                 P   S
Sbjct  6    RNGFREATNSKPLFVTIYATVIIGVLVSSFYVFSAIYS-----------------PSNGS  48

Query  315  YS--PDVPAAVLTQI-HNESLKETVGSPQAPKTQ---------AKSKSLKPIWISPPPGS  458
            YS     P +   +I H      TV  P AP  Q         A+ KSL  IW+SPP   
Sbjct  49   YSWLSSPPLSTSGRIYHPPQENTTVELPVAPPPQVLPLPTPEEAQGKSLGKIWVSPPRDK  108

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+D+ N+LVGA+DTK
Sbjct  109  KMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKHLTDLDLSNILVGAMDTK  168

Query  639  LLEALYWKGIPVFD  680
            LLEALYWKGIPVFD
Sbjct  169  LLEALYWKGIPVFD  182



>ref|XP_010056116.1| PREDICTED: uncharacterized protein LOC104444183 isoform X2 [Eucalyptus 
grandis]
Length=636

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 129/193 (67%), Gaps = 31/193 (16%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            K+  QE+A+S+PLFLTIYATV  G+V S+ YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  315  YSPDVPAAVLT----------QIHNESLKETVGSPQ-APKTQAKSKSLKPIWISPPPGSR  461
             SPD  + + +          Q  N SL  TVG+   AP +Q        +W+ PP  S+
Sbjct  45   SSPDSTSWLSSPSSLSYSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKSSK  103

Query  462  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  641
            MPSL+TFRLTKEL ++RV+DNVIIVTFGNYAFMDFIL+WVKHLTD++V NLLVGA+DTKL
Sbjct  104  MPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLNVYNLLVGAMDTKL  163

Query  642  LEALYWKGIPVFD  680
            LEALYWKGIPVFD
Sbjct  164  LEALYWKGIPVFD  176



>ref|XP_010056115.1| PREDICTED: uncharacterized protein LOC104444183 isoform X1 [Eucalyptus 
grandis]
 gb|KCW72693.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=638

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 129/195 (66%), Gaps = 33/195 (17%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            K+  QE+A+S+PLFLTIYATV  G+V S+ YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  315  YSPDVPAAVLT------------QIHNESLKETVGSPQ-APKTQAKSKSLKPIWISPPPG  455
             SPD  + + +            Q  N SL  TVG+   AP +Q        +W+ PP  
Sbjct  45   SSPDSTSWLSSPSSLSYVDSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKS  103

Query  456  SRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDT  635
            S+MPSL+TFRLTKEL ++RV+DNVIIVTFGNYAFMDFIL+WVKHLTD++V NLLVGA+DT
Sbjct  104  SKMPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLNVYNLLVGAMDT  163

Query  636  KLLEALYWKGIPVFD  680
            KLLEALYWKGIPVFD
Sbjct  164  KLLEALYWKGIPVFD  178



>emb|CDP07210.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  345  TQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDN  524
             Q+ N S    V       +Q +SKS+ PIW  PP GS+MP L+TF+LTKEL Q+RV+DN
Sbjct  65   NQVSNCSHLTVVNVSLGSASQTQSKSMMPIWEVPPSGSKMPPLKTFKLTKELVQQRVKDN  124

Query  525  VIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            V++VTFGNYAFMDFILTWVKHLTD+ VDNLLVGA+DTK++EALYWKG+PVFD
Sbjct  125  VVVVTFGNYAFMDFILTWVKHLTDLGVDNLLVGAMDTKMVEALYWKGVPVFD  176



>ref|XP_010505074.1| PREDICTED: uncharacterized protein LOC104781967 [Camelina sativa]
Length=644

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ KSL  IW+SPP   +MPSLETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPSLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  152

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  153  HLTDLDLSNILVGAMDTKLLEALYWKGVPVFD  184



>gb|EPS61566.1| hypothetical protein M569_13228, partial [Genlisea aurea]
Length=430

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +3

Query  411  KSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHL  590
            ++KSL PIW  PPPGS+MP LETFRLTKE+ Q+RVR NVI+VTFGN+AFMDFILTWVKHL
Sbjct  5    QNKSLVPIWQVPPPGSKMPPLETFRLTKEMVQQRVRGNVIVVTFGNFAFMDFILTWVKHL  64

Query  591  TDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            +DM+VDN+LVGA+DTKLLEALYW G+PVFD
Sbjct  65   SDMNVDNILVGAMDTKLLEALYWAGVPVFD  94



>gb|KHF98530.1| hypothetical protein F383_12515 [Gossypium arboreum]
Length=605

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 115/194 (59%), Gaps = 36/194 (19%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIY T+ VG+V ++                         +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  315  YSPD------------VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGS  458
            YSP             + +  L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSASTSTQSISTSWLSSPPLSQNGGSNFSNNISLPTDKASQPGSNQLKTIWQAPPSNS  100

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  639  LLEALYWKGIPVFD  680
            LLEALYWKG+PVFD
Sbjct  161  LLEALYWKGVPVFD  174



>emb|CDX84192.1| BnaC04g09540D [Brassica napus]
Length=632

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAQGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  152  HLTDLDISNLLVGAMDTKLLEALYWKGVPVFD  183



>emb|CDY31704.1| BnaA05g08430D [Brassica napus]
Length=632

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAEGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  152  HLTDLDISNLLVGAMDTKLLEALYWKGVPVFD  183



>ref|XP_009143647.1| PREDICTED: uncharacterized protein LOC103867343 [Brassica rapa]
Length=643

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAEGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  152  HLTDLDISNLLVGAMDTKLLEALYWKGVPVFD  183



>gb|KJB51494.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=391

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 126/182 (69%), Gaps = 18/182 (10%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIYATV +G V S+FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
            EL  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIPV
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPV  166

Query  675  FD  680
            FD
Sbjct  167  FD  168



>ref|XP_002881404.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57663.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
Length=640

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ +SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAQGRSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  152  HLTDLDLSNILVGAMDTKLLEALYWKGVPVFD  183



>ref|XP_006293822.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
 gb|EOA26720.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
Length=645

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            + K KSL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  94   EPKGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  153

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  154  HLTDLDLSNILVGAMDTKLLEALYWKGVPVFD  185



>ref|XP_011028505.1| PREDICTED: uncharacterized protein LOC105128495 isoform X2 [Populus 
euphratica]
Length=648

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 134/184 (73%), Gaps = 13/184 (7%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +   QE+ANSKPLF+ IYATV +G+VF + YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFYSLYVLSAVYSANSSSSS-----------TSWL  64

Query  315  YSPDVPAAV-LTQIHNESLKETVGSPQAPKTQA-KSKSLKPIWISPPPGSRMPSLETFRL  488
             SP +P ++ + Q  N S   T+ +  +P T   ++  +KPIW  PP G++ P L+TFRL
Sbjct  65   SSPPIPTSIDVDQSSNFSKPTTLAAGSSPLTSNPQTMQIKPIWEPPPHGTKFPPLKTFRL  124

Query  489  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  668
            TK+L Q+RV+DNVIIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGI
Sbjct  125  TKQLVQQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLGLSNLLVGAMDTKLLEALYWKGI  184

Query  669  PVFD  680
            PVFD
Sbjct  185  PVFD  188



>ref|XP_010518959.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 
MGP4 [Tarenaya hassleriana]
Length=631

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  V+E  NSKPLF+TIY TV VGV+ S+F+VFSA+YS S  SSS   +   S     P 
Sbjct  5    RNAVREATNSKPLFVTIYGTVIVGVIVSSFFVFSAIYSPSNGSSSWLSSPPLSSVGRFPI  64

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
             SP    + L              P +P +Q++ KSL PIW+ PP   +MP LETFRLTK
Sbjct  65   QSPSNATSDL--------------PVSPPSQSQGKSLNPIWV-PPQEKKMPPLETFRLTK  109

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
            EL  ERV+DNV+IVTFGN+AFMDFILTWVKHLTD+ + N+LVGA+DTKLLEALYWKGIPV
Sbjct  110  ELVGERVKDNVVIVTFGNFAFMDFILTWVKHLTDLGLSNILVGAMDTKLLEALYWKGIPV  169

Query  675  FD  680
            FD
Sbjct  170  FD  171



>emb|CDY32116.1| BnaC04g44500D [Brassica napus]
Length=636

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 127/192 (66%), Gaps = 27/192 (14%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +   +E  NSKPLF+TIYATV +GV+ S+FYVFSAVYS +                 + S
Sbjct  6    RNGFREATNSKPLFVTIYATVIIGVLVSSFYVFSAVYSPTNG---------------STS  50

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAP----------KTQAKSKSLKPIWISPPPGSRM  464
            +    P +   +IH  S +E   S   P          + Q KS SL  IW+SPP   +M
Sbjct  51   WLSSPPLSTAGRIHKLS-QENATSQSLPVALPPPPPEEEAQGKS-SLGKIWVSPPKDKKM  108

Query  465  PSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLL  644
            P LE F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+D+ N+LVGA+DTKLL
Sbjct  109  PPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKHLTDLDLSNILVGAMDTKLL  168

Query  645  EALYWKGIPVFD  680
            EALYWKG+PVFD
Sbjct  169  EALYWKGVPVFD  180



>ref|XP_007040866.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
 gb|EOY25367.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
Length=518

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 129/182 (71%), Gaps = 10/182 (5%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIYATV VG+V S+FYVFSA+YS SA+++ +   S  S       
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQSVSTSWLS-------  57

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
             SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F LTK
Sbjct  58   -SPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSLTK  114

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
            EL +ER +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIP 
Sbjct  115  ELVEERAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPA  174

Query  675  FD  680
            FD
Sbjct  175  FD  176



>ref|XP_007040867.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
 gb|EOY25368.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
Length=546

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 131/184 (71%), Gaps = 14/184 (8%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIYATV VG+V S+FYVFSA+YS SA+++ +          ++ S
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQS----------VSTS  54

Query  315  Y--SPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  488
            +  SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F L
Sbjct  55   WLSSPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSL  112

Query  489  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  668
            TKEL +ER +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGI
Sbjct  113  TKELVEERAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGI  172

Query  669  PVFD  680
            P FD
Sbjct  173  PAFD  176



>ref|XP_010509590.1| PREDICTED: uncharacterized protein LOC104785987 [Camelina sativa]
Length=644

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ER +DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERAKDNVIIVTFGNYAFMDFILTWVK  152

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  153  HLTDLDLSNILVGAMDTKLLEALYWKGVPVFD  184



>ref|NP_850250.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AAL67023.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09128.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AHL38813.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=644

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+  SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGNSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  152

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  153  HLTDLDLSNILVGAMDTKLLEALYWKGVPVFD  184



>ref|XP_010516741.1| PREDICTED: uncharacterized protein LOC104792321 [Camelina sativa]
Length=644

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ER +DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERAKDNVIIVTFGNYAFMDFILTWVK  152

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ N+L+GA+DTKLLEALYWKG+PVFD
Sbjct  153  HLTDLDLSNILIGAMDTKLLEALYWKGVPVFD  184



>ref|XP_012079766.1| PREDICTED: uncharacterized protein LOC105640147 [Jatropha curcas]
 gb|KDP31566.1| hypothetical protein JCGZ_15383 [Jatropha curcas]
Length=647

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 134/184 (73%), Gaps = 7/184 (4%)
 Frame = +3

Query  129  LEKEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIA  308
            L +   Q + N+KPLFLTIYATV VG++FS+FYVFSAVYSSS+ S++  ++S  S     
Sbjct  11   LWRNAYQAVVNTKPLFLTIYATVVVGILFSSFYVFSAVYSSSSLSATTWLSSPPSSLSRH  70

Query  309  PSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  488
               S ++          E+    V SP     + ++K LKPIW +PP  S+MPS++ FRL
Sbjct  71   IDQSSNIS-------QQEAKSIVVVSPPIKTLRPQTKQLKPIWEAPPGNSKMPSIKKFRL  123

Query  489  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  668
            TK++ +ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+ + NLLVGA+DTKLLEALYWKG+
Sbjct  124  TKKMVEERVQDNVIIVTFGNYAFMDFILTWVKHLTDLGLSNLLVGAMDTKLLEALYWKGV  183

Query  669  PVFD  680
            PVFD
Sbjct  184  PVFD  187



>dbj|BAH19600.1| AT2G35610 [Arabidopsis thaliana]
Length=644

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+  SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGNSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  152

Query  585  HLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  153  HLTDLDLSNILVGAVDTKLLEALYWKGVPVFD  184



>ref|XP_004300682.1| PREDICTED: uncharacterized protein LOC101298609 [Fragaria vesca 
subsp. vesca]
Length=629

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 123/174 (71%), Gaps = 13/174 (7%)
 Frame = +3

Query  159  NSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPDVPAA  338
            NSKPLF+ +YATV VG++FS+ YV SA+YS  AA+ S            A S+  +V ++
Sbjct  9    NSKPLFVAVYATVIVGIIFSSLYVISAIYSGKAATFS------------ATSFQNNVGSS  56

Query  339  VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVR  518
               Q  N S    V    +P  ++++ S KPIW   P   +MP LETFRLTKEL Q+RV+
Sbjct  57   PSEQALNVSQSAVVQGVPSPNLESRNVSTKPIW-EAPNTKKMPELETFRLTKELVQQRVK  115

Query  519  DNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            DNV+IVTFGNYAFMDFILTWVKHLTD+ + NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  116  DNVVIVTFGNYAFMDFILTWVKHLTDLGISNLLVGAMDTKLLEALYWKGVPVFD  169



>ref|XP_007040865.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
 gb|EOY25366.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
Length=636

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 131/184 (71%), Gaps = 14/184 (8%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIYATV VG+V S+FYVFSA+YS SA+++ +          ++ S
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQS----------VSTS  54

Query  315  Y--SPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  488
            +  SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F L
Sbjct  55   WLSSPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSL  112

Query  489  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  668
            TKEL +ER +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGI
Sbjct  113  TKELVEERAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGI  172

Query  669  PVFD  680
            P FD
Sbjct  173  PAFD  176



>ref|XP_011028504.1| PREDICTED: uncharacterized protein LOC105128495 isoform X1 [Populus 
euphratica]
Length=652

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 134/188 (71%), Gaps = 17/188 (9%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +   QE+ANSKPLF+ IYATV +G+VF + YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFYSLYVLSAVYSANSSSSS-----------TSWL  64

Query  315  YSPDVPAAV-----LTQIHNESLKETVGSPQAPKTQA-KSKSLKPIWISPPPGSRMPSLE  476
             SP +P ++     + Q  N S   T+ +  +P T   ++  +KPIW  PP G++ P L+
Sbjct  65   SSPPIPTSIDNTRHVDQSSNFSKPTTLAAGSSPLTSNPQTMQIKPIWEPPPHGTKFPPLK  124

Query  477  TFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALY  656
            TFRLTK+L Q+RV+DNVIIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALY
Sbjct  125  TFRLTKQLVQQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLGLSNLLVGAMDTKLLEALY  184

Query  657  WKGIPVFD  680
            WKGIPVFD
Sbjct  185  WKGIPVFD  192



>ref|XP_006410719.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
 gb|ESQ52172.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
Length=645

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  408  AKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKH  587
            A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKH
Sbjct  95   AQVKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKH  154

Query  588  LTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            LTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  155  LTDLDLSNILVGAMDTKLLEALYWKGVPVFD  185



>ref|XP_010266424.1| PREDICTED: uncharacterized protein LOC104603944 isoform X1 [Nelumbo 
nucifera]
Length=634

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 117/178 (66%), Gaps = 10/178 (6%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            Q+ ANSKPLF+TIYATV VG+  S+ YVFSA+YS     S           P + S    
Sbjct  7    QDAANSKPLFVTIYATVLVGIALSSVYVFSAIYSGKTIYS----------IPWSSSSLSR  56

Query  327  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  506
            V A  L    N S          P +Q +S   KPIW  PPPG++MP L+ FRLTKEL  
Sbjct  57   VDAPQLEHALNFSRPFAGVGVTGPASQPQSIWTKPIWEVPPPGTKMPPLKAFRLTKELVS  116

Query  507  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
             RV+DN+IIVTFGNYAFMDFI+ WVKHLTD+ + N LVGA+DTKLLEALYWKG+PVFD
Sbjct  117  HRVKDNIIIVTFGNYAFMDFIMNWVKHLTDLGLSNFLVGAMDTKLLEALYWKGVPVFD  174



>ref|XP_009141501.1| PREDICTED: uncharacterized protein LOC103865462 isoform X2 [Brassica 
rapa]
Length=640

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 127/188 (68%), Gaps = 27/188 (14%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            +E  NSKPLF+TIYATV +GV+ S+FYVFSA+YS +                 + S+   
Sbjct  10   REATNSKPLFVTIYATVIIGVLVSSFYVFSAIYSPTNG---------------STSWLSS  54

Query  327  VPAAVLTQIHNESLKETVGSPQAP---------KTQAKSKS-LKPIWISPPPGSRMPSLE  476
             P +   +IH   L +   + Q+          + +AK KS L  IW+SPP   +MP LE
Sbjct  55   PPLSTAGRIHK--LPQDNATSQSLPVALPPPAPEEEAKGKSSLGKIWVSPPKDKKMPPLE  112

Query  477  TFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALY  656
             F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+D+ N+LVGA+DTKLLEALY
Sbjct  113  AFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKHLTDLDLSNILVGAMDTKLLEALY  172

Query  657  WKGIPVFD  680
            WKG+PVFD
Sbjct  173  WKGVPVFD  180



>gb|KJB51493.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=628

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 126/182 (69%), Gaps = 18/182 (10%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIYATV +G V S+FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
            EL  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIPV
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPV  166

Query  675  FD  680
            FD
Sbjct  167  FD  168



>gb|KHG12902.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=611

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 126/182 (69%), Gaps = 18/182 (10%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +  VQE A SKPLFLTIYATV +G V S+FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
            EL  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIPV
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPV  166

Query  675  FD  680
            FD
Sbjct  167  FD  168



>ref|XP_006385158.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
 gb|ERP62955.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
Length=638

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 131/182 (72%), Gaps = 19/182 (10%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +   QE+ANSKPLF+ IYATV +G+VFS+ YV SAVYS++++SSS               
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFSSLYVLSAVYSANSSSSSTSW-----------L  64

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
             SP +P ++      ++ +    SP  P +  ++  +KPIW  PP G++ P L+TFRLTK
Sbjct  65   SSPPIPTSI------DNTRPAGSSP--PTSNPQTMQIKPIWEPPPHGTKFPPLKTFRLTK  116

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
            +L Q+RV+DNVIIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGIPV
Sbjct  117  QLVQQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLGLSNLLVGAMDTKLLEALYWKGIPV  176

Query  675  FD  680
            FD
Sbjct  177  FD  178



>ref|XP_009141500.1| PREDICTED: uncharacterized protein LOC103865462 isoform X1 [Brassica 
rapa]
Length=644

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = +3

Query  399  KTQAKSKS-LKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILT  575
            + +AK KS L  IW+SPP   +MP LE F+LTKELF ERV+DNVIIVTFGNYAFMDFILT
Sbjct  90   EEEAKGKSSLGKIWVSPPKDKKMPPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDFILT  149

Query  576  WVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            WVKHLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  150  WVKHLTDLDLSNILVGAMDTKLLEALYWKGVPVFD  184



>emb|CDY40459.1| BnaA04g20580D [Brassica napus]
Length=640

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 1/94 (1%)
 Frame = +3

Query  399  KTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTW  578
            + Q KS SL  IW+SPP   +MP LE F+LTKELF ERV+DNVIIVTFGNYAFMDFILTW
Sbjct  88   EAQGKS-SLGKIWVSPPKDKKMPPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDFILTW  146

Query  579  VKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            VKHLTD+D+ N+LVGA+DTKLLEALYWKG+PVFD
Sbjct  147  VKHLTDLDLSNILVGAMDTKLLEALYWKGVPVFD  180



>ref|XP_008365916.1| PREDICTED: uncharacterized protein LOC103429549 isoform X1 [Malus 
domestica]
 ref|XP_008365917.1| PREDICTED: uncharacterized protein LOC103429549 isoform X2 [Malus 
domestica]
Length=630

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +3

Query  342  LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRD  521
            L Q  N S  E V +   P    +S S +PIW +PP   +MP L+ FRL+KEL Q+RV+D
Sbjct  58   LEQAPNVSQPEIVQAIATPSLGPQSMSTRPIWEAPPRTKKMPPLKKFRLSKELVQQRVKD  117

Query  522  NVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            NV+IVTFGNYAFMDFILTWVKHLTD+ + NLL+GA+DTKLLEALYWKG+PVFD
Sbjct  118  NVVIVTFGNYAFMDFILTWVKHLTDLGLSNLLIGAMDTKLLEALYWKGVPVFD  170



>ref|XP_010266425.1| PREDICTED: uncharacterized protein LOC104603944 isoform X2 [Nelumbo 
nucifera]
Length=616

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 110/178 (62%), Gaps = 28/178 (16%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            Q+ ANSKPLF+TIYATV VG+  S+                        ++  +  YS  
Sbjct  7    QDAANSKPLFVTIYATVLVGIALSS------------------------VYVFSAIYSGK  42

Query  327  VPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  506
               ++     + S     G    P +Q +S   KPIW  PPPG++MP L+ FRLTKEL  
Sbjct  43   TIYSIPWSSSSLSRVGVTG----PASQPQSIWTKPIWEVPPPGTKMPPLKAFRLTKELVS  98

Query  507  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
             RV+DN+IIVTFGNYAFMDFI+ WVKHLTD+ + N LVGA+DTKLLEALYWKG+PVFD
Sbjct  99   HRVKDNIIIVTFGNYAFMDFIMNWVKHLTDLGLSNFLVGAMDTKLLEALYWKGVPVFD  156



>gb|KHN27499.1| hypothetical protein glysoja_018611 [Glycine soja]
Length=648

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 115/197 (58%), Gaps = 39/197 (20%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            ++  +E+ANSKPLFLTIY  V +G+V S+                         +  +  
Sbjct  4    RKGFEEVANSKPLFLTIYTVVIIGIVVSS------------------------FYVFSAI  39

Query  315  YSPDVPAA---------------VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPP  449
            YS + P+A               V  Q  N S    V +   P  + +++S + IW  PP
Sbjct  40   YSANPPSAQSSAWLSSISSDATHVTDQTLNVSQSAAVHTVPPPSPRPRNESPRSIWDDPP  99

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
            P  +MP L+ FRLTKEL ++RV+DN IIVTFGNYAFMDFILTWVK LTD+ V N LVGA+
Sbjct  100  PNKKMPPLKDFRLTKELVRQRVKDNAIIVTFGNYAFMDFILTWVKQLTDLGVSNFLVGAM  159

Query  630  DTKLLEALYWKGIPVFD  680
            DTKLLEALYWKGIPVFD
Sbjct  160  DTKLLEALYWKGIPVFD  176



>ref|XP_003547737.1| PREDICTED: uncharacterized protein LOC100780346 [Glycine max]
Length=638

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 115/197 (58%), Gaps = 39/197 (20%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            ++  +E+ANSKPLFLTIY  V +G+V S+                         +  +  
Sbjct  4    RKGFEEVANSKPLFLTIYTVVIIGIVVSS------------------------FYVFSAI  39

Query  315  YSPDVPAA---------------VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPP  449
            YS + P+A               V  Q  N S    V +   P  + +++S + IW  PP
Sbjct  40   YSANPPSAQSSAWLSSISSDATHVTDQTLNVSQSAAVHTVPPPSPRPRNESPRSIWDDPP  99

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
            P  +MP L+ FRLTKEL ++RV+DN IIVTFGNYAFMDFILTWVK LTD+ V N LVGA+
Sbjct  100  PNKKMPPLKDFRLTKELVRQRVKDNAIIVTFGNYAFMDFILTWVKQLTDLGVSNFLVGAM  159

Query  630  DTKLLEALYWKGIPVFD  680
            DTKLLEALYWKGIPVFD
Sbjct  160  DTKLLEALYWKGIPVFD  176



>ref|XP_007210882.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
 gb|EMJ12081.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
Length=630

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 122/174 (70%), Gaps = 12/174 (7%)
 Frame = +3

Query  159  NSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPDVPAA  338
            N+KP+F+TIYATV +G++FS+ YV SA+YS  +A+ S              S+   V + 
Sbjct  9    NAKPVFVTIYATVIIGIIFSSLYVISAIYSGKSAADSTT------------SWLSHVGSP  56

Query  339  VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVR  518
             + Q  N S    V +   P  + +S S +PIW +P    +MP+L+ FRL+KEL QERV+
Sbjct  57   PVEQAPNVSEPAIVQAVPTPSLEPRSMSTRPIWEAPLHTKKMPALKKFRLSKELVQERVK  116

Query  519  DNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            DNVIIVTFGNYAFMDFILTWVKHLTD+ + NLL+GA+DTKLLEALYWKG+PVFD
Sbjct  117  DNVIIVTFGNYAFMDFILTWVKHLTDLGLSNLLIGAMDTKLLEALYWKGVPVFD  170



>emb|CDP12730.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +3

Query  342  LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRD  521
            L +  N S   T     A K +  +K +KP+W  P  GS+MP L+TFRL+K+L Q+RV+D
Sbjct  58   LNKALNSSHMTTENVMLATKPRLHNKLVKPVWEIPSTGSKMPPLKTFRLSKKLVQQRVKD  117

Query  522  NVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            N++IVT+ NYAFMDF++TWVKHLTD+ V+NLLVGALDTKLLEALYWKGIPVFD
Sbjct  118  NIVIVTYANYAFMDFVITWVKHLTDLGVENLLVGALDTKLLEALYWKGIPVFD  170



>ref|XP_009362859.1| PREDICTED: uncharacterized protein LOC103952897 [Pyrus x bretschneideri]
Length=632

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +3

Query  342  LTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRD  521
            L Q  N S  E V +   P     S S +PIW +P    +MP L+ FRL+KEL Q+RV+D
Sbjct  60   LEQAPNVSQPEIVQAISTPSLGPHSMSTRPIWEAPTRTKKMPPLKKFRLSKELVQQRVKD  119

Query  522  NVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            NV+IVTFGNYAFMDFILTWVKHLTD+ + NLL+GA+DTKLLEALYWKG+PVFD
Sbjct  120  NVVIVTFGNYAFMDFILTWVKHLTDLGLSNLLIGAMDTKLLEALYWKGVPVFD  172



>gb|KHG12903.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=619

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 4/106 (4%)
 Frame = +3

Query  363  SLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTF  542
            SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTKEL  +R +DNVIIVTF
Sbjct  58   SLPNNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTKELVAQRAKDNVIIVTF  113

Query  543  GNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            GN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIPVFD
Sbjct  114  GNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPVFD  159



>emb|CDP12729.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +3

Query  366  LKETVGS-PQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTF  542
            ++E+  S P AP ++ ++K + PIW  PP GS+MP L+ F+L+K+L Q+RV+DN+II+TF
Sbjct  48   MQESNSSLPLAPISRLQNKLVNPIWQVPPAGSKMPPLKAFKLSKKLVQQRVKDNIIIITF  107

Query  543  GNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            GNY FMDFIL WVKHLT++ ++NLLVGA+D+KLLEALYWKG+PVFD
Sbjct  108  GNYGFMDFILNWVKHLTELSIENLLVGAMDSKLLEALYWKGVPVFD  153



>ref|XP_007156343.1| hypothetical protein PHAVU_003G278500g, partial [Phaseolus vulgaris]
 gb|ESW28337.1| hypothetical protein PHAVU_003G278500g, partial [Phaseolus vulgaris]
Length=446

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 122/182 (67%), Gaps = 10/182 (5%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            ++  +E+ANSKPLFLTIY  V +G+V S+FYVFSA+YSS+ +++ +             S
Sbjct  4    RKGCEEVANSKPLFLTIYTVVVIGIVVSSFYVFSAIYSSNPSAAQSSAWL---------S  54

Query  315  YSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  494
              P     V  Q  N S       P+ P + A+++  + IW  PP   RMP L  FRLTK
Sbjct  55   SLPSENTRVTDQTLNVSRSAVHFVPR-PSSGAQNEWSRTIWDIPPTNKRMPPLSDFRLTK  113

Query  495  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  674
             L Q+RV+DNV+IVTFGNYAFMDFILTWVK L D++V N LVGA+DTKLLEALYWKGIPV
Sbjct  114  ALVQQRVKDNVVIVTFGNYAFMDFILTWVKQLRDLEVSNFLVGAMDTKLLEALYWKGIPV  173

Query  675  FD  680
            FD
Sbjct  174  FD  175



>ref|XP_010676706.1| PREDICTED: uncharacterized protein LOC104892459 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 114/187 (61%), Gaps = 32/187 (17%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             QE A SKPLF+TIYATV +G+ FS+                        ++  +  YS 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSS------------------------VYVFSAIYSS  42

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQ------AKSKS--LKPIWISPPPGSRMPSLET  479
              P A ++     S  + +   Q           AKS+S  LKPIW  P    +MP L++
Sbjct  43   KPPDAEISLSFPHSGGDPLHEAQNSSLSTTSLSPAKSRSTLLKPIWEPPSKTKKMPPLKS  102

Query  480  FRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYW  659
            FRLTKEL ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKLLEALYW
Sbjct  103  FRLTKELVEKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKLLEALYW  162

Query  660  KGIPVFD  680
            KGIPVFD
Sbjct  163  KGIPVFD  169



>ref|XP_010676705.1| PREDICTED: uncharacterized protein LOC104892459 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 114/187 (61%), Gaps = 32/187 (17%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             QE A SKPLF+TIYATV +G+ FS+                        ++  +  YS 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSS------------------------VYVFSAIYSS  42

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQ------AKSKS--LKPIWISPPPGSRMPSLET  479
              P A ++     S  + +   Q           AKS+S  LKPIW  P    +MP L++
Sbjct  43   KPPDAEISLSFPHSGGDPLHEAQNSSLSTTSLSPAKSRSTLLKPIWEPPSKTKKMPPLKS  102

Query  480  FRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYW  659
            FRLTKEL ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKLLEALYW
Sbjct  103  FRLTKELVEKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKLLEALYW  162

Query  660  KGIPVFD  680
            KGIPVFD
Sbjct  163  KGIPVFD  169



>ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis]
 gb|EEF42538.1| reticulon3-A3, putative [Ricinus communis]
Length=639

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = +3

Query  375  TVGSPQAPKTQAKSKSL--KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGN  548
            TV SP     Q K  S+   PIW  PPP S+M  ++ FRLTK+L ++RV+DNVIIVTFGN
Sbjct  77   TVSSPTTKSQQDKKSSILETPIWEIPPPNSKMLPIKKFRLTKQLVEKRVKDNVIIVTFGN  136

Query  549  YAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            +AFMDFILTWVKHLTD+ + NLLVGA+DTKLLEALYWKG+PVFD
Sbjct  137  FAFMDFILTWVKHLTDLGLSNLLVGAMDTKLLEALYWKGVPVFD  180



>ref|XP_010676703.1| PREDICTED: uncharacterized protein LOC104892459 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=629

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 114/187 (61%), Gaps = 32/187 (17%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             QE A SKPLF+TIYATV +G+ FS+                        ++  +  YS 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSS------------------------VYVFSAIYSS  42

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQ------AKSKS--LKPIWISPPPGSRMPSLET  479
              P A ++     S  + +   Q           AKS+S  LKPIW  P    +MP L++
Sbjct  43   KPPDAEISLSFPHSGGDPLHEAQNSSLSTTSLSPAKSRSTLLKPIWEPPSKTKKMPPLKS  102

Query  480  FRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYW  659
            FRLTKEL ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKLLEALYW
Sbjct  103  FRLTKELVEKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKLLEALYW  162

Query  660  KGIPVFD  680
            KGIPVFD
Sbjct  163  KGIPVFD  169



>ref|XP_006430896.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
 gb|ESR44136.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
Length=639

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 134/191 (70%), Gaps = 25/191 (13%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasss---------apiass  287
            +   QE+ NSKPLFLTIY TV VG+VFS+FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  288  fsLFPIAPSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  467
             S   +AP++SP +  + + +               P+ Q++SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSPTLKVSAIPR---------------PRPQSRSKQVKPIW-EVPQTKRLP  108

Query  468  SLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLE  647
            SL++F+LTKEL ++RV+DN+II+TFGNYAFMDFIL WV+ LTD+ + N+LVGALDTKL++
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDFILNWVRRLTDLGLSNILVGALDTKLVK  168

Query  648  ALYWKGIPVFD  680
            ALYWKG+PVFD
Sbjct  169  ALYWKGVPVFD  179



>ref|XP_008782814.1| PREDICTED: uncharacterized protein LOC103702257 isoform X2 [Phoenix 
dactylifera]
Length=286

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 111/197 (56%), Gaps = 49/197 (25%)
 Frame = +3

Query  162  SKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPDVPAAV  341
             KPLFL IYATV  G+VFS                         LF ++  YSP   A  
Sbjct  10   GKPLFLVIYATVVAGIVFST------------------------LFILSTVYSPATDANP  45

Query  342  LTQIH------------------NESLKETVGSPQA------PKTQAKSKSLKPIWISPP  449
            L+ +H                     L E+  S  A      P  + ++   + IW   P
Sbjct  46   LSFLHFSSSAAPPRLPDRDFTRKGNGLSESEASRNATANIPPPTAKPRNMFTRGIW-DAP  104

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
             G++MP L++FRLTKE+ + R RDNVIIVTFGNYA+MDFILTWVKHLTD++V NLLVGA+
Sbjct  105  VGTKMPDLKSFRLTKEMVEHRARDNVIIVTFGNYAYMDFILTWVKHLTDLNVYNLLVGAM  164

Query  630  DTKLLEALYWKGIPVFD  680
            D+K+LEALYWKGIPVFD
Sbjct  165  DSKILEALYWKGIPVFD  181



>ref|XP_004509491.1| PREDICTED: uncharacterized protein LOC101505601 [Cicer arietinum]
Length=638

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 111/198 (56%), Gaps = 40/198 (20%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            +   +E+  SKPLFLTIY  V +G+V S+                         +     
Sbjct  5    RNGCEEVVQSKPLFLTIYTIVIIGIVVSS------------------------FYVFLAI  40

Query  315  YSPDVPAA----------------VLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISP  446
            YS + PAA                V+    N S  E   +   P  + ++     +W  P
Sbjct  41   YSSNTPAAHSSAWLSSSISNENSRVIDHTLNISQSEKAQTVSTPSPEKQNVWPSFVWEVP  100

Query  447  PPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGA  626
            P   +MP L+TFRLTKEL Q+RV+DNV+IVTFGNYAFMDFILTWVK LTD++V NLLVGA
Sbjct  101  PSNKKMPPLKTFRLTKELVQQRVKDNVVIVTFGNYAFMDFILTWVKKLTDLEVSNLLVGA  160

Query  627  LDTKLLEALYWKGIPVFD  680
            +DTKLLEALYWKG+PVFD
Sbjct  161  MDTKLLEALYWKGVPVFD  178



>ref|XP_010111777.1| hypothetical protein L484_008781 [Morus notabilis]
 gb|EXC31691.1| hypothetical protein L484_008781 [Morus notabilis]
Length=635

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  387  PQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDF  566
            P   K       ++PIW +P    +MP L++FRLTKEL Q+RV+DNV+IVTFGNYAFMDF
Sbjct  80   PMPEKPTLGGVGVRPIWEAPSRTKKMPPLKSFRLTKELVQQRVKDNVVIVTFGNYAFMDF  139

Query  567  ILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            ILTWVKHLTD+++ N+LVGA+DTKLLEALYWKGIPVFD
Sbjct  140  ILTWVKHLTDLNLSNILVGAMDTKLLEALYWKGIPVFD  177



>emb|CDP12731.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +3

Query  330  PAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQE  509
            PA ++   ++     T  S  AP ++ ++K  K IW  PP GS+MP L+ F+L+K+L Q+
Sbjct  69   PAKIMAS-NSSHTTNTGNSSLAPISRLQNKLAKHIWEVPPAGSKMPPLKAFKLSKKLVQQ  127

Query  510  RVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVF  677
            RV+DN+IIVT+ NYAFMDF+L WVKHLT++ +DNLLVGALDTKLLEALYWKG+PVF
Sbjct  128  RVKDNIIIVTYANYAFMDFVLNWVKHLTELGIDNLLVGALDTKLLEALYWKGVPVF  183



>gb|KHN03113.1| hypothetical protein glysoja_049543 [Glycine soja]
Length=610

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 116/197 (59%), Gaps = 39/197 (20%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            ++  +E+ANSKPLFLTIY  V +G+V S+                         F  +  
Sbjct  4    RKGCEEVANSKPLFLTIYTVVIIGIVVSS------------------------FFVFSAI  39

Query  315  YSPDVPAAVL-----------TQIHNESLKETVGSP----QAPKTQAKSKSLKPIWISPP  449
            YS + P+A             T++ +++LK +  +       P   ++++    IW  PP
Sbjct  40   YSTNPPSAQSSAWLSSISSDETRVTDQTLKVSRSAAVLIVPTPSPGSQNEWPTSIWDDPP  99

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
            P  +MP LE FRLTK+L Q+RV+DN +IVTFGNYAFMDFILTWVK L D+ V N LVGA+
Sbjct  100  PNKKMPPLEDFRLTKKLVQQRVKDNAVIVTFGNYAFMDFILTWVKQLRDLGVSNFLVGAM  159

Query  630  DTKLLEALYWKGIPVFD  680
            DTKL+EALYWKGIPVFD
Sbjct  160  DTKLVEALYWKGIPVFD  176



>ref|XP_003548765.1| PREDICTED: uncharacterized protein LOC100819032 [Glycine max]
Length=639

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 116/197 (59%), Gaps = 39/197 (20%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPS  314
            ++  +E+ANSKPLFLTIY  V +G+V S+                         F  +  
Sbjct  4    RKGCEEVANSKPLFLTIYTVVIIGIVVSS------------------------FFVFSAI  39

Query  315  YSPDVPAAVL-----------TQIHNESLKETVGSP----QAPKTQAKSKSLKPIWISPP  449
            YS + P+A             T++ +++LK +  +       P   ++++    IW  PP
Sbjct  40   YSTNPPSAQSSAWLSSISSDETRVTDQTLKVSRSAAVLIVPTPSPGSQNEWPTSIWDDPP  99

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
            P  +MP LE FRLTK+L Q+RV+DN +IVTFGNYAFMDFILTWVK L D+ V N LVGA+
Sbjct  100  PNKKMPPLEDFRLTKKLVQQRVKDNAVIVTFGNYAFMDFILTWVKQLRDLGVSNFLVGAM  159

Query  630  DTKLLEALYWKGIPVFD  680
            DTKL+EALYWKGIPVFD
Sbjct  160  DTKLVEALYWKGIPVFD  176



>emb|CAN79199.1| hypothetical protein VITISV_040773 [Vitis vinifera]
Length=715

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            +PIW +PP G + PSL+ F+LTK L ++RV+DNVIIVTFGNYAFMDFILTWVKHLTD+ +
Sbjct  127  RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDFILTWVKHLTDLGI  186

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             NLLVGA+DTKLLEALYW+G+PVFD
Sbjct  187  SNLLVGAMDTKLLEALYWRGVPVFD  211



>ref|XP_008782812.1| PREDICTED: uncharacterized protein LOC103702257 isoform X1 [Phoenix 
dactylifera]
Length=291

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +3

Query  354  HNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVII  533
             +E+ +    +   P  + ++   + IW   P G++MP L++FRLTKE+ + R RDNVII
Sbjct  79   ESEASRNATANIPPPTAKPRNMFTRGIW-DAPVGTKMPDLKSFRLTKEMVEHRARDNVII  137

Query  534  VTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            VTFGNYA+MDFILTWVKHLTD++V NLLVGA+D+K+LEALYWKGIPVFD
Sbjct  138  VTFGNYAYMDFILTWVKHLTDLNVYNLLVGAMDSKILEALYWKGIPVFD  186



>gb|EPS61907.1| hypothetical protein M569_12886, partial [Genlisea aurea]
Length=244

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +3

Query  369  KETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGN  548
            + + G      T    K    IW  PP GS MP  E F+LTKEL Q+RV++N+I+VTFGN
Sbjct  57   RSSAGMVSRDSTSLTQKRHGIIWEVPPLGSEMPPREAFKLTKELVQKRVKNNIIVVTFGN  116

Query  549  YAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
             AFMDFIL WVKHLTDM +DNL+VGALD+K+L+ALYWKGIPVFD
Sbjct  117  LAFMDFILNWVKHLTDMGIDNLIVGALDSKVLKALYWKGIPVFD  160



>gb|KHN41773.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=1470

 Score =   144 bits (363),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 89/190 (47%), Positives = 114/190 (60%), Gaps = 38/190 (20%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSPD  326
            +E+A+S+PLFLTIY  V VGVVFS+                        L+  +    P 
Sbjct  4    EEVAHSRPLFLTIYTIVFVGVVFSS------------------------LYVFSAIRYPS  39

Query  327  VPAAVLTQIHNESLKETVGS------------PQAPKTQAKSKSLKPIWISPPPGSRMPS  470
              A+  + + NE ++ T  +            P  P  +A++   +PI   PP   +MPS
Sbjct  40   TNASTWS-LSNEDVRLTEQTLNVSQSGNAHVVPSVPP-EARNVKTRPILNIPPRNKKMPS  97

Query  471  LETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEA  650
            L TFRLT+EL Q+RV+DN+IIVTFGNYAFMDFILTWV+ L D+ V N LVGA+DTKLLEA
Sbjct  98   LNTFRLTEELVQQRVKDNIIIVTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDTKLLEA  157

Query  651  LYWKGIPVFD  680
            LYWKGIPVFD
Sbjct  158  LYWKGIPVFD  167



>ref|XP_002269181.2| PREDICTED: uncharacterized protein LOC100263017 [Vitis vinifera]
Length=631

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            +PIW +PP G + PSL+ F+LTK L ++RV+DNVIIVTFGNYAFMDFILTWVKHLTD+ +
Sbjct  88   RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDFILTWVKHLTDLGI  147

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             NLLVGA+DTKLLEALYW+G+PVFD
Sbjct  148  SNLLVGAMDTKLLEALYWRGVPVFD  172



>emb|CBI29197.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            +PIW +PP G + PSL+ F+LTK L ++RV+DNVIIVTFGNYAFMDFILTWVKHLTD+ +
Sbjct  99   RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDFILTWVKHLTDLGI  158

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             NLLVGA+DTKLLEALYW+G+PVFD
Sbjct  159  SNLLVGAMDTKLLEALYWRGVPVFD  183



>gb|KDO72261.1| hypothetical protein CISIN_1g036925mg [Citrus sinensis]
Length=639

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 133/191 (70%), Gaps = 25/191 (13%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasss---------apiass  287
            +   QE+ NSKPLFLTIY TV VG+VFS+FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  288  fsLFPIAPSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  467
             S   +AP++SP             +LK +   P  P  Q+ SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSP-------------TLKVSAIPPPLP--QSSSKQVKPIW-EVPQTKRLP  108

Query  468  SLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLE  647
            SL++F+LTKEL ++RV+DN+II+TFGNYAFMDFIL WV+ LTD+ + N+LVGALDTKL++
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDFILNWVQRLTDLGLSNILVGALDTKLVK  168

Query  648  ALYWKGIPVFD  680
            ALYWKG+PVFD
Sbjct  169  ALYWKGVPVFD  179



>ref|XP_006482352.1| PREDICTED: uncharacterized protein LOC102613765 [Citrus sinensis]
Length=639

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 133/191 (70%), Gaps = 25/191 (13%)
 Frame = +3

Query  135  KEMVQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasss---------apiass  287
            +   QE+ NSKPLFLTIY TV VG+VFS+FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  288  fsLFPIAPSYSPDVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  467
             S   +AP++SP             +LK +   P  P  Q+ SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSP-------------TLKVSAIPPPLP--QSSSKQVKPIW-EVPQTKRLP  108

Query  468  SLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLE  647
            SL++F+LTKEL ++RV+DN+II+TFGNYAFMDFIL WV+ LTD+ + N+LVGALDTKL++
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDFILNWVQRLTDLGLSNILVGALDTKLVK  168

Query  648  ALYWKGIPVFD  680
            ALYWKG+PVFD
Sbjct  169  ALYWKGVPVFD  179



>gb|KHN05539.1| hypothetical protein glysoja_020504 [Glycine soja]
Length=637

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 118/181 (65%), Gaps = 18/181 (10%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             +E+A+S+PLFLTIY  V VG+VFS+ YVFSA+   SA               I  ++S 
Sbjct  3    CEEVAHSRPLFLTIYTIVIVGIVFSSLYVFSAIRHPSA---------------IPSTWSL  47

Query  324  DVPAAVLT-QIHNESLKETVG-SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  497
                  LT Q  N S  ETV   P  P+ +A+    +PI   PP   +MPSL  FRLTKE
Sbjct  48   SNEDVRLTEQTLNGSQSETVHIVPSVPQ-EARKMRTRPILSVPPRNKKMPSLNAFRLTKE  106

Query  498  LFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVF  677
            L Q+RV+DN+II+TFGNYAFMDFILTWV+ L D+ V N LVGA+D KLLEALYWKGIPVF
Sbjct  107  LVQQRVKDNIIILTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDIKLLEALYWKGIPVF  166

Query  678  D  680
            D
Sbjct  167  D  167



>ref|XP_006590766.1| PREDICTED: uncharacterized protein LOC100789338 [Glycine max]
Length=627

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 118/181 (65%), Gaps = 18/181 (10%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             +E+A+S+PLFLTIY  V VG+VFS+ YVFSA+   SA               I  ++S 
Sbjct  3    CEEVAHSRPLFLTIYTIVIVGIVFSSLYVFSAIRHPSA---------------IPSTWSL  47

Query  324  DVPAAVLT-QIHNESLKETVG-SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  497
                  LT Q  N S  ETV   P  P+ +A+    +PI   PP   +MPSL  FRLTKE
Sbjct  48   SNEDVRLTEQTLNGSQSETVHIVPSVPQ-EARKMRTRPILSVPPRNKKMPSLNAFRLTKE  106

Query  498  LFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVF  677
            L Q+RV+DN+II+TFGNYAFMDFILTWV+ L D+ V N LVGA+D KLLEALYWKGIPVF
Sbjct  107  LVQQRVKDNIIILTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDIKLLEALYWKGIPVF  166

Query  678  D  680
            D
Sbjct  167  D  167



>ref|XP_003612490.1| hypothetical protein MTR_5g025590 [Medicago truncatula]
Length=628

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 112/179 (63%), Gaps = 13/179 (7%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             +E+A+S+P+FLTIY  V V      F       ++S+A S          FP   +  P
Sbjct  3    CEEVAHSRPVFLTIYTVVIVVSSLYVFSAIHYSSTTSSAWS---------SFPPLSNEDP  53

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  503
                 +L +  + S  ET+ +  +   + ++ S KPI   PP   +MP L+ FRLTKEL 
Sbjct  54   ----RLLDRTFDASQLETMHAVPSAFPELQNVSRKPILNVPPRNKKMPPLKEFRLTKELV  109

Query  504  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            Q+RV+DN+IIVTFGNYAFMDFILTWVK L D+ V N LVGA+DTKLLEALYWKG+PVFD
Sbjct  110  QQRVKDNIIIVTFGNYAFMDFILTWVKQLNDLGVSNYLVGAMDTKLLEALYWKGVPVFD  168



>gb|AES95448.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=688

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 112/179 (63%), Gaps = 13/179 (7%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             +E+A+S+P+FLTIY  V V      F       ++S+A S          FP   +  P
Sbjct  3    CEEVAHSRPVFLTIYTVVIVVSSLYVFSAIHYSSTTSSAWS---------SFPPLSNEDP  53

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  503
                 +L +  + S  ET+ +  +   + ++ S KPI   PP   +MP L+ FRLTKEL 
Sbjct  54   ----RLLDRTFDASQLETMHAVPSAFPELQNVSRKPILNVPPRNKKMPPLKEFRLTKELV  109

Query  504  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            Q+RV+DN+IIVTFGNYAFMDFILTWVK L D+ V N LVGA+DTKLLEALYWKG+PVFD
Sbjct  110  QQRVKDNIIIVTFGNYAFMDFILTWVKQLNDLGVSNYLVGAMDTKLLEALYWKGVPVFD  168



>gb|AAD15452.2| unknown protein [Arabidopsis thaliana]
Length=528

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +3

Query  462  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  641
            MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+D+ N+LVGA+DTKL
Sbjct  1    MPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKHLTDLDLSNILVGAMDTKL  60

Query  642  LEALYWKGIPVFD  680
            LEALYWKG+PVFD
Sbjct  61   LEALYWKGVPVFD  73



>ref|XP_003517099.1| PREDICTED: uncharacterized protein LOC100776463 [Glycine max]
Length=627

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 115/190 (61%), Gaps = 36/190 (19%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             +E+A+S+PLFLTIY  V VGVVFS+                        L+  +    P
Sbjct  3    CEEVAHSRPLFLTIYTIVFVGVVFSS------------------------LYVFSAIRYP  38

Query  324  DVPAAVLTQIHNESLK---ETVGSPQAPKT--------QAKSKSLKPIWISPPPGSRMPS  470
               A+  + + NE ++   +T+   Q+           +A++   +PI   PP   +MPS
Sbjct  39   STNASTWS-LSNEDVRLTEQTLNVSQSGNAHVVPSVPPEARNVKTRPILNIPPRNKKMPS  97

Query  471  LETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEA  650
            L TFRLT+EL Q+RV+DN+IIVTFGNYAFMDFILTWV+ L D+ V N LVGA+DTKLLEA
Sbjct  98   LNTFRLTEELVQQRVKDNIIIVTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDTKLLEA  157

Query  651  LYWKGIPVFD  680
            LYWKGIPVFD
Sbjct  158  LYWKGIPVFD  167



>gb|AET03500.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=637

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  432  IWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDN  611
            +W  PP   +MP L+ FRLTKEL Q+RV+DNV+IVTFGNYAFMDFILTWVK LTD++V N
Sbjct  95   VWEIPPSNKKMPPLKNFRLTKELVQQRVKDNVVIVTFGNYAFMDFILTWVKKLTDLEVSN  154

Query  612  LLVGALDTKLLEALYWKGIPVFD  680
             LVGA+DTKLLEALYWKG+PVFD
Sbjct  155  FLVGAMDTKLLEALYWKGVPVFD  177



>ref|XP_003629024.1| hypothetical protein MTR_8g072310 [Medicago truncatula]
Length=655

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  432  IWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDN  611
            +W  PP   +MP L+ FRLTKEL Q+RV+DNV+IVTFGNYAFMDFILTWVK LTD++V N
Sbjct  95   VWEIPPSNKKMPPLKNFRLTKELVQQRVKDNVVIVTFGNYAFMDFILTWVKKLTDLEVSN  154

Query  612  LLVGALDTKLLEALYWKGIPVFD  680
             LVGA+DTKLLEALYWKG+PVFD
Sbjct  155  FLVGAMDTKLLEALYWKGVPVFD  177



>ref|XP_011623933.1| PREDICTED: uncharacterized protein LOC18422702 isoform X1 [Amborella 
trichopoda]
Length=639

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 111/197 (56%), Gaps = 43/197 (22%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYS--  320
            QE+AN KPLF+ I ATV   ++ +                         +F   P YS  
Sbjct  7    QELANMKPLFIGIQATVLAAILLTT------------------------VFIGRPIYSGI  42

Query  321  ----PDVPAAVLTQI-HNESLKETVG-------SPQAPKTQAKSKSL-----KPIWISPP  449
                P    A +T + H  ++ +T G       S +  +T   S        K IW SPP
Sbjct  43   WSGTPSSTDAGVTHVEHVSNISQTGGNETIDNFSDRGTETIPSSSKFQNIWEKAIWESPP  102

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
             GS+MP L  F+LTK++  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+
Sbjct  103  AGSKMPDLNEFQLTKQMVADRAKDNVIIVTFGNHAFMDFILTWVKHLTDLGVYNLLVGAM  162

Query  630  DTKLLEALYWKGIPVFD  680
            D +LLEALYW+GIPVF+
Sbjct  163  DVQLLEALYWRGIPVFN  179



>ref|XP_006878624.1| PREDICTED: uncharacterized protein LOC18422702 isoform X2 [Amborella 
trichopoda]
 gb|ERM94769.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
Length=638

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 111/197 (56%), Gaps = 43/197 (22%)
 Frame = +3

Query  147  QEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYS--  320
            QE+AN KPLF+ I ATV   ++ +                         +F   P YS  
Sbjct  7    QELANMKPLFIGIQATVLAAILLTT------------------------VFIGRPIYSGI  42

Query  321  ----PDVPAAVLTQI-HNESLKETVG-------SPQAPKTQAKSKSL-----KPIWISPP  449
                P    A +T + H  ++ +T G       S +  +T   S        K IW SPP
Sbjct  43   WSGTPSSTDAGVTHVEHVSNISQTGGNETIDNFSDRGTETIPSSSKFQNIWEKAIWESPP  102

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
             GS+MP L  F+LTK++  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+
Sbjct  103  AGSKMPDLNEFQLTKQMVADRAKDNVIIVTFGNHAFMDFILTWVKHLTDLGVYNLLVGAM  162

Query  630  DTKLLEALYWKGIPVFD  680
            D +LLEALYW+GIPVF+
Sbjct  163  DVQLLEALYWRGIPVFN  179



>ref|XP_008444233.1| PREDICTED: uncharacterized protein LOC103487624 [Cucumis melo]
Length=640

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 115/179 (64%), Gaps = 5/179 (3%)
 Frame = +3

Query  144  VQEMANSKPLFLTIYATvavgvvfsafyvfsavysssaasssapiassfsLFPIAPSYSP  323
             Q+  N++PLFL IYATV  G+VFS+ YVFSAVYSSS   S +    S        S S 
Sbjct  7    CQDGVNTRPLFLVIYATVIAGIVFSSLYVFSAVYSSSNPLSDSSSWFSSPSSEFTNSDS-  65

Query  324  DVPAAVLTQIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  503
                 +  Q  + S   T  +P    T   +K  KPIW   P    MP  ETF L+KEL 
Sbjct  66   ---TLIKDQRSDVSEPSTGPTPDFSSTIVHNKGEKPIW-EAPNTKDMPPPETFHLSKELV  121

Query  504  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            Q R +DN+IIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGIPVFD
Sbjct  122  QRRAKDNIIIVTFGNYAFMDFILSWVKHLTDLGLTNLLVGAMDTKLLEALYWKGIPVFD  180



>ref|XP_007158076.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
 gb|ESW30070.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
Length=626

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +3

Query  348  QIHNESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNV  527
            Q  N S   TV  P  P  +A+    +PI   PP    MP LE F LTKEL Q+RV+DNV
Sbjct  57   QTLNGSRFATVDVPSVPP-EARDVRTRPILDVPPRNKEMPPLEAFGLTKELIQKRVKDNV  115

Query  528  IIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            IIVTF NYAFMDFILTWV+ L +++V N LVGA+DTKLLEALYWKGIPVFD
Sbjct  116  IIVTFANYAFMDFILTWVQQLNNLEVSNFLVGAMDTKLLEALYWKGIPVFD  166



>ref|XP_004142646.1| PREDICTED: uncharacterized protein LOC101203732 [Cucumis sativus]
 gb|KGN54526.1| hypothetical protein Csa_4G358640 [Cucumis sativus]
Length=640

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = +3

Query  384  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMD  563
            +P    T  ++K  +PIW   P    MP  E F L+KEL Q+R +DN+IIVTFGNYAFMD
Sbjct  83   TPDFSNTVVQNKGERPIW-EAPNTKNMPPPEAFNLSKELVQKRAKDNIIIVTFGNYAFMD  141

Query  564  FILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            FIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGIPVFD
Sbjct  142  FILSWVKHLTDLGLTNLLVGAMDTKLLEALYWKGIPVFD  180



>gb|KJB25103.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=533

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  462  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  641
            MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTKL
Sbjct  1    MPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTKL  60

Query  642  LEALYWKGIPVFD  680
            LEALYWKG+PVFD
Sbjct  61   LEALYWKGVPVFD  73



>ref|XP_004982506.1| PREDICTED: uncharacterized protein LOC101753789 [Setaria italica]
Length=619

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +3

Query  384  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMD  563
            +P  P+T       +PIW  PP GSRMPS   FRLT+++   R RD VI+VTFGNYAF+D
Sbjct  64   APAQPETMYN----RPIWKPPPRGSRMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLD  119

Query  564  FILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            FILTWV+HLTD+ VDNLLVGA+DTKLL  LY +G+PVFD
Sbjct  120  FILTWVRHLTDLGVDNLLVGAMDTKLLRELYLRGVPVFD  158



>ref|NP_001143144.1| hypothetical protein [Zea mays]
 gb|ACG29327.1| hypothetical protein [Zea mays]
 gb|ACN27867.1| unknown [Zea mays]
 gb|ACR35913.1| unknown [Zea mays]
 tpg|DAA50140.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=615

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  402  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  581
             QA++   +PIW  PP  +RMPS   FRLT+++   R RD VI+VTFGNYAF+DFILTWV
Sbjct  63   AQAETMYNRPIWKPPPRRARMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLDFILTWV  122

Query  582  KHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            +HLTD+ VDNLLVGA+DTKLL  LY++G+PVFD
Sbjct  123  RHLTDLGVDNLLVGAMDTKLLRELYFRGVPVFD  155



>ref|XP_010907097.1| PREDICTED: uncharacterized protein LOC105033849 isoform X1 [Elaeis 
guineensis]
Length=643

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  357  NESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIV  536
            +E+ +    +   P  + ++   + IW   P G++MP L++FRLTKE+ +   ++NVIIV
Sbjct  77   SEANRNATANIPPPTAKPRNMFTRDIW-DVPVGTKMPELKSFRLTKEMLEHWAKENVIIV  135

Query  537  TFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            TFGNYA+MDFILTWV+HLTD++V NLLVGA+DTK+LEALYWKGIPVFD
Sbjct  136  TFGNYAYMDFILTWVRHLTDLNVYNLLVGAMDTKILEALYWKGIPVFD  183



>ref|XP_010907098.1| PREDICTED: uncharacterized protein LOC105033849 isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +3

Query  357  NESLKETVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIV  536
            +E+ +    +   P  + ++   + IW   P G++MP L++FRLTKE+ +   ++NVIIV
Sbjct  75   SEANRNATANIPPPTAKPRNMFTRDIW-DVPVGTKMPELKSFRLTKEMLEHWAKENVIIV  133

Query  537  TFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            TFGNYA+MDFILTWV+HLTD++V NLLVGA+DTK+LEALYWKGIPVFD
Sbjct  134  TFGNYAYMDFILTWVRHLTDLNVYNLLVGAMDTKILEALYWKGIPVFD  181



>gb|EMS55953.1| hypothetical protein TRIUR3_26709 [Triticum urartu]
Length=609

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            +PIW  P  GSRMPS   FRLT+++ + R RD VI+VTFGNYAFMDFILTWV+HLT + V
Sbjct  71   RPIWKPPARGSRMPSPRAFRLTRDMVRARARDGVIVVTFGNYAFMDFILTWVRHLTGLGV  130

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
            DNLLVGA+DTKLL  LY  G+PVFD
Sbjct  131  DNLLVGAMDTKLLRQLYLTGVPVFD  155



>ref|XP_002464281.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
 gb|EER91279.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Length=615

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +3

Query  384  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMD  563
            +P  P+T       +PIW  PP  +RMPS   FRLT+++   R RD VI+VTFGNYAF+D
Sbjct  61   TPAQPETMYN----RPIWKPPPRRARMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLD  116

Query  564  FILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            FILTWV+HLTD+ VDNLLVGA+DTKLL  LY++G+PVFD
Sbjct  117  FILTWVRHLTDLGVDNLLVGAMDTKLLRELYFRGVPVFD  155



>ref|XP_010676704.1| PREDICTED: uncharacterized protein LOC104892459 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=533

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  462  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  641
            MP L++FRLTKEL ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKL
Sbjct  1    MPPLKSFRLTKELVEKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKL  60

Query  642  LEALYWKGIPVFD  680
            LEALYWKGIPVFD
Sbjct  61   LEALYWKGIPVFD  73



>ref|XP_010540709.1| PREDICTED: uncharacterized protein LOC104814389 [Tarenaya hassleriana]
Length=598

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  SPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLV  620
            +PP   +MP LETFRLTKEL   R +DN++IVTFGN+AFMDFIL WVKHLT + + N+L+
Sbjct  75   APPHDKKMPPLETFRLTKELVGGRAKDNIVIVTFGNFAFMDFILNWVKHLTCLGLSNVLI  134

Query  621  GALDTKLLEALYWKGIPVFD  680
            GALDTKLLEALYWKGIPVFD
Sbjct  135  GALDTKLLEALYWKGIPVFD  154



>ref|XP_010235552.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235553.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235554.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235555.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_003572620.2| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
Length=642

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = +3

Query  375  TVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYA  554
               +P  P+T       +PIW  PP GSRMP    FRLT+++ + R RD VI+VTFGNYA
Sbjct  84   NASAPAQPETMYN----RPIWKPPPRGSRMPPPRAFRLTRDMVRARARDGVIVVTFGNYA  139

Query  555  FMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            F+DFILTWV HLT + VDNLLVGA+DTKLL  LY +G+PVFD
Sbjct  140  FLDFILTWVHHLTGLGVDNLLVGAMDTKLLRELYLRGVPVFD  181



>ref|XP_004512439.1| PREDICTED: uncharacterized protein LOC101497257 [Cicer arietinum]
Length=623

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            KP++   P   +MP L+ FRLTKEL Q+RV+DN+IIVTFGNYAFMDFILTWVK L D+ +
Sbjct  79   KPVFDVSPRNKKMPPLKDFRLTKELVQQRVKDNIIIVTFGNYAFMDFILTWVKQLNDLGL  138

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             N LVGA+DTKLLEALY KG+PVFD
Sbjct  139  SNYLVGAMDTKLLEALYQKGVPVFD  163



>ref|XP_003562333.1| PREDICTED: uncharacterized protein LOC100845970 [Brachypodium 
distachyon]
Length=614

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = +3

Query  375  TVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYA  554
             V  P  P+T       +PIW  PP GSRMP    FRLT+++ + R RD VI+VTFGNYA
Sbjct  56   NVSGPAQPETIYN----RPIWKPPPRGSRMPPPRAFRLTRDMVRARARDGVIVVTFGNYA  111

Query  555  FMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            F+DFILTW  HLT + VDNLLVGA+DTKLL  LY +G+PVFD
Sbjct  112  FLDFILTWAHHLTALGVDNLLVGAMDTKLLRELYLRGVPVFD  153



>ref|NP_001050567.1| Os03g0586300 [Oryza sativa Japonica Group]
 gb|AAT76325.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12481.1| Os03g0586300 [Oryza sativa Japonica Group]
Length=356

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  402  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  581
             Q ++   +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DFILTWV
Sbjct  65   AQPETMYNRPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDFILTWV  124

Query  582  KHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            +HLTD+ VD+LLVGA+DTKLL  LY +G+PVFD
Sbjct  125  RHLTDLGVDSLLVGAMDTKLLRELYLRGVPVFD  157



>ref|XP_009383104.1| PREDICTED: uncharacterized protein LOC103970914 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            + +W   P  S+MP L+ F+LTKE+ + R +DN I VTFGN+AF+DFIL WVKHLTD+++
Sbjct  138  RAVW-DVPVSSKMPDLKLFQLTKEMVKHRAKDNFIFVTFGNHAFLDFILNWVKHLTDLNL  196

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             N+LVGA+DTKLLEALYWKGIPVFD
Sbjct  197  FNILVGAMDTKLLEALYWKGIPVFD  221



>gb|EEC75649.1| hypothetical protein OsI_12401 [Oryza sativa Indica Group]
Length=622

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  402  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  581
             Q ++   +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DFILTWV
Sbjct  65   AQPETMYNRPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDFILTWV  124

Query  582  KHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            +HLTD+ VD+LLVGA+DTKLL  LY +G+PVFD
Sbjct  125  RHLTDLGVDSLLVGAMDTKLLRELYLRGVPVFD  157



>gb|ABF97349.1| expressed protein [Oryza sativa Japonica Group]
Length=622

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  402  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  581
             Q ++   +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DFILTWV
Sbjct  65   AQPETMYNRPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDFILTWV  124

Query  582  KHLTDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
            +HLTD+ VD+LLVGA+DTKLL  LY +G+PVFD
Sbjct  125  RHLTDLGVDSLLVGAMDTKLLRELYLRGVPVFD  157



>ref|XP_002991425.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ07537.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=545

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            K IW  PP GS +P  E F L+KE+ + R + NVI+VTF N+AF DF+LTWV+HLTD+ V
Sbjct  8    KAIWEIPPHGSELPPREAFVLSKEMVEFRAKKNVIMVTFANHAFEDFVLTWVRHLTDVGV  67

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             NLLVGA+D K+LE L+WKG+PVFD
Sbjct  68   TNLLVGAMDRKILEELFWKGVPVFD  92



>ref|XP_002988322.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10741.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=557

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            K IW  PP GS +P  E F L+KE+ + R + NVI+VTF N+AF DF+LTWV+HLTD+ V
Sbjct  8    KAIWEIPPHGSELPPREAFVLSKEMVEFRAKKNVIMVTFANHAFEDFVLTWVRHLTDVGV  67

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             NLL+GA+D K+LE L+WKG+PVFD
Sbjct  68   TNLLIGAMDRKILEELFWKGVPVFD  92



>ref|XP_001761094.1| predicted protein [Physcomitrella patens]
 gb|EDQ74161.1| predicted protein, partial [Physcomitrella patens]
Length=526

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  462  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  641
            +P  + F LTKE+ + R + NVI VTF N+AFMDF+L WV+HLTD++V N+LVGA+DTK+
Sbjct  1    LPPRDAFALTKEMIEFRAKKNVIAVTFANFAFMDFVLNWVRHLTDVEVTNILVGAMDTKI  60

Query  642  LEALYWKGIPVFD  680
            LEAL+WKG+PVFD
Sbjct  61   LEALFWKGVPVFD  73



>gb|EPS68350.1| hypothetical protein M569_06419, partial [Genlisea aurea]
Length=546

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  444  PPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVG  623
            P  GS MP  E+FRLT+EL  ER  DNV+++TFGN+AF+DF++ W +HL  + V N LVG
Sbjct  1    PGDGSEMPPPESFRLTRELVAERAEDNVVVITFGNFAFVDFMVNWAEHLMRLGVTNFLVG  60

Query  624  ALDTKLLEALYWKGIPVFD  680
            A+D K LEALY +G+PVFD
Sbjct  61   AMDAKALEALYRRGVPVFD  79



>ref|XP_006650304.1| PREDICTED: uncharacterized protein LOC102706084 [Oryza brachyantha]
Length=618

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  426  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  605
            +PIW  PP   RMP    FRLT+E+   R R  VI+VTFGN+AF+DFILTWV+HLTD+ V
Sbjct  73   RPIWKPPPRRERMPPPRAFRLTREMVGARARGGVIVVTFGNHAFLDFILTWVRHLTDLGV  132

Query  606  DNLLVGALDTKLLEALYWKGIPVFD  680
             NLLVGA+DTKL+  LY +G+PVFD
Sbjct  133  VNLLVGAMDTKLVRELYLRGVPVFD  157



>emb|CDX84232.1| BnaC04g09940D [Brassica napus]
Length=156

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  405  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  584
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNY FMDFILTWV+
Sbjct  92   EAEGKSLGKIWVSPPREKKMPPLETFKLTKELFGERVKDNVIIVTFGNYVFMDFILTWVQ  151

Query  585  HL  590
             +
Sbjct  152  WI  153



>ref|XP_005758156.1| hypothetical protein EMIHUDRAFT_77405 [Emiliania huxleyi CCMP1516]
 gb|EOD05727.1| hypothetical protein EMIHUDRAFT_77405 [Emiliania huxleyi CCMP1516]
Length=581

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +3

Query  420  SLKPIWISPPPGSRMPSL--ETFRLTKELFQERVR-DNVIIVTFGNYAFMDFILTWVKHL  590
            S  P   S PP +   S+    +RLT+EL + R    N+I+VTF N+   D+ LTW  H+
Sbjct  25   SHPPETASHPPAASNASVGRAAYRLTRELIRSRCNAHNIILVTFVNFQRCDYGLTWSGHV  84

Query  591  TDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
              + + N LVGA+D K LE L  K +P FD
Sbjct  85   VRLGLSNYLVGAMDGKALELLASKKVPTFD  114



>ref|XP_005649227.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24683.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
Length=857

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  483  RLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWK  662
            +LT  L   R RD +++VT+ + A++DF+  W+ HLT ++V+N L+GA+D ++ E L  +
Sbjct  340  QLTAALANSRSRDGIVLVTWASAAYLDFLRNWIHHLTILEVENFLIGAMDNEVSEYLRQQ  399

Query  663  GIPVFD  680
             IP FD
Sbjct  400  NIPYFD  405



>ref|XP_005843950.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
 gb|EFN51848.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
Length=631

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  486  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  665
            LT++L  +  +DN I+VT+ N+ + DF++ WV+HL     D  +VGA+D KLLE L  K 
Sbjct  101  LTRDLVGKVAKDNTIMVTWANWHYHDFVMNWVEHLQAAGCDAFIVGAMDDKLLEFLVSKN  160

Query  666  IPVF  677
            IP F
Sbjct  161  IPAF  164



>ref|XP_002956226.1| hypothetical protein VOLCADRAFT_97156 [Volvox carteri f. nagariensis]
 gb|EFJ42765.1| hypothetical protein VOLCADRAFT_97156 [Volvox carteri f. nagariensis]
Length=658

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  483  RLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWK  662
            +++KEL Q   R   +IVT+ N+A  DF+ TW+ H  ++ +DN LVGA+D ++   L   
Sbjct  142  QISKELAQSVARGGAVIVTWANFALWDFVKTWISHTKEVGLDNFLVGAMDAQIGSELVAA  201

Query  663  GIPVF  677
            G+P F
Sbjct  202  GVPCF  206



>gb|KDD76569.1| nucleotide-diphospho-sugar transferase [Helicosporidium sp. ATCC 
50920]
Length=662

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = +3

Query  471  LETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEA  650
            L   RL+K L     RD  I+VT+ NY + DF+  WV H+      N +VGALD ++LE 
Sbjct  131  LRKHRLSKALIAPLSRDGAIVVTWANYHYRDFVNNWVVHIRKAGCQNFVVGALDDRMLEW  190

Query  651  LYWKGIPVF  677
            L   GIP F
Sbjct  191  LVENGIPAF  199



>ref|XP_005852062.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
 gb|EFN59960.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
Length=727

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  486  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  665
            L+++L +   RD +IIVT+ NY F DF+L WV+H+    + N LVGA+D    +AL  +G
Sbjct  131  LSRDLARSHARDGIIIVTWANYHFFDFVLNWVEHMQRHGIKNYLVGAMDVDTGQALAAQG  190

Query  666  IPVF  677
            + VF
Sbjct  191  LNVF  194



>ref|XP_005760837.1| hypothetical protein EMIHUDRAFT_465597 [Emiliania huxleyi CCMP1516]
 gb|EOD08408.1| hypothetical protein EMIHUDRAFT_465597 [Emiliania huxleyi CCMP1516]
Length=1547

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +3

Query  420   SLKPIWISPPPGSRMPSL--ETFRLTKELFQERVR-DNVIIVTFGNYAFMDFILTWVKHL  590
             S  P   S PP +   S+    +RLT+EL + R    N+I+VTF N+   D+ LTW  H+
Sbjct  991   SHPPETASHPPAASNASVGRAAYRLTRELIRSRCNAHNIILVTFVNFQRCDYGLTWSGHV  1050

Query  591   TDMDVDNLLVGALDTKLLEALYWKGIPVFD  680
               + + N LVGA+D K LE L  K +P FD
Sbjct  1051  VRLGLSNYLVGAMDGKALELLASKKVPTFD  1080



>ref|XP_011398427.1| hypothetical protein F751_0558 [Auxenochlorella protothecoides]
 gb|KFM25531.1| hypothetical protein F751_0558 [Auxenochlorella protothecoides]
Length=334

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = +3

Query  447  PPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGA  626
            PP  +   +    L+++L +     N ++VT+ ++   DF+  WV HL       LLVGA
Sbjct  9    PPSGQFKGIRAHLLSRDLVELHASSNHLVVTWSDWDNRDFVRNWVYHLHKAGCSALLVGA  68

Query  627  LDTKLLEALYWKGIPVF  677
             DT+LLE L+  GIP F
Sbjct  69   TDTQLLEWLFEAGIPAF  85



>ref|XP_003078397.1| unnamed protein product, partial [Ostreococcus tauri]
Length=556

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +3

Query  486  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  665
            ++KEL Q   +D  +IVT+ N  + DF L W++HL  + V+N L+GA+D ++   L   G
Sbjct  36   VSKELVQRVAKDGAVIVTWANSHYYDFALNWLRHLDALGVENYLIGAMDEEMYAKLRKIG  95

Query  666  IPVF  677
            +P +
Sbjct  96   VPCW  99



>ref|XP_011397700.1| hypothetical protein F751_1691 [Auxenochlorella protothecoides]
 gb|KFM24812.1| hypothetical protein F751_1691 [Auxenochlorella protothecoides]
Length=524

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +3

Query  486  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  665
            LT+EL +   +D  I+VT+ N+ + DF+  WV HL        +VGA+D KLL  L   G
Sbjct  133  LTRELIEPLAQDKYIMVTWANWHYRDFVGNWVYHLKKTGCSAFVVGAMDDKLLAWLQENG  192

Query  666  IPVF  677
            IP F
Sbjct  193  IPTF  196



>emb|CEF97310.1| Nucleotide-diphospho-sugar transferase [Ostreococcus tauri]
Length=771

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +3

Query  486  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  665
            ++KEL Q   +D  +IVT+ N  + DF L W++HL  + V+N L+GA+D ++   L   G
Sbjct  86   VSKELVQRVAKDGAVIVTWANSHYYDFALNWLRHLDALGVENYLIGAMDEEMYAKLRKIG  145

Query  666  IPVF  677
            +P +
Sbjct  146  VPCW  149



>gb|KIZ02110.1| hypothetical protein MNEG_5845 [Monoraphidium neglectum]
Length=479

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  486  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  665
            L++EL Q    D  ++VT+ N+ + DF LTWV H+  + +   +VGA+D  +L  L  + 
Sbjct  187  LSRELVQSLAEDGYLVVTWANHHYTDFALTWVYHVQQVGIKGYMVGAMDEAILITLAKRK  246

Query  666  IPVF  677
            IP F
Sbjct  247  IPTF  250



>ref|XP_007509006.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20092.1| predicted protein [Bathycoccus prasinos]
Length=980

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = +3

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
            P S+ P  E  +L + L +    +N+++VT+ N  + DF+  WVKH+ D  ++N LVGA+
Sbjct  463  PISKRP--EDNQLNEALAKRYSHENIVMVTWANNHYYDFVKNWVKHIRDCGMNNFLVGAM  520

Query  630  DTKLLEALYWKGIPVF  677
            D +LL  L    +P F
Sbjct  521  DNELLVRLIDDKVPTF  536



>ref|XP_002506735.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
 gb|ACO67993.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
Length=746

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = +3

Query  450  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  629
            P S++   E  +LT EL      DN+++VT+ N+ + DF+  WV+++    + N +VGA+
Sbjct  207  PKSKLA--EDNQLTAELVGRYAEDNIVMVTWANHHYHDFVRNWVRNVRKCGMRNYMVGAM  264

Query  630  DTKLLEALYWKGIPVF  677
            D +LLE L    +P F
Sbjct  265  DNELLEKLIDDEVPTF  280



>ref|XP_005772161.1| hypothetical protein EMIHUDRAFT_117868 [Emiliania huxleyi CCMP1516]
 gb|EOD19732.1| hypothetical protein EMIHUDRAFT_117868 [Emiliania huxleyi CCMP1516]
Length=585

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query  462  MPSLETFRLTKELFQERV-RDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            + S ET RLT EL ++   +DN++I T+ N+  +DF LT V HL  M   + LVGA+D +
Sbjct  75   LASAETPRLTAELAKKHASKDNLLIATYVNFNRLDFALTLVMHLLAMGNPHYLVGAMDDQ  134

Query  639  LLEALYWKGIPVF  677
            +  AL  +G+  F
Sbjct  135  VGHALASRGVNTF  147



>ref|XP_005709932.1| glycosyl transferase family GT77 cell wall polysaccharide biosynthesis 
[Chondrus crispus]
 emb|CDF39638.1| glycosyl transferase family GT77 cell wall polysaccharide biosynthesis 
[Chondrus crispus]
Length=555

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = +3

Query  390  QAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVR-DNVIIVTFGNYAFMDF  566
            Q      ++K+   I I+ P   + PS     LT     ERV  +N +IVT  NY + D 
Sbjct  243  QCGMVSKEAKNDYNIPIAKPGDEKEPSSFGMPLTLPSVSERVAINNTVIVTALNYGYRDI  302

Query  567  ILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPVF  677
            ++ WV +L  +++ N ++ A D  L E  Y +G+PV+
Sbjct  303  MMNWVCNLRHLNITNFIISAFDRDLYEYAYVRGLPVY  339



>ref|XP_007512211.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66299.1| predicted protein [Bathycoccus prasinos]
Length=750

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  486  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTD-MDVDNLLVGALDTKLLEAL  653
            LT E  Q+  +DN IIVT+ N+ ++DF   W+ H+ + + + N ++GA+D K+ E+L
Sbjct  118  LTIEHIQKIAKDNTIIVTWANHHYLDFARNWINHVQNRLGLSNFIIGAMDEKMYESL  174



>ref|XP_001692787.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03806.1| predicted protein [Chlamydomonas reinhardtii]
Length=703

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query  456  SRMPSLET-FRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALD  632
             ++  L+T ++ T+E+ Q+  ++  ++VT+ N+ + DF+ TWVKH+  + V   +VGA+D
Sbjct  149  GKITELDTQYKPTREMVQKIAQNGYLMVTWANFHYFDFVKTWVKHVQRVGVTGYIVGAMD  208

Query  633  TKLLEAL  653
              LL  +
Sbjct  209  DHLLREM  215



>ref|XP_011395852.1| hypothetical protein F751_0343 [Auxenochlorella protothecoides]
 gb|KFM22985.1| hypothetical protein F751_0343 [Auxenochlorella protothecoides]
Length=603

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +3

Query  459  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  638
            R+P+ E  +L+KEL         I VT+ N  F DF + W  HL D+ V N+LVGA+D  
Sbjct  41   RVPTDEVPQLSKELAWAAADGGEIFVTWANEHFSDFAVNWALHLKDVGVHNILVGAMDVG  100

Query  639  LLEA  650
              +A
Sbjct  101  AAKA  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1161397529311