BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10922

Length=1669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802140.1|  PREDICTED: 26S proteasome regulatory subunit...    824   0.0     Nicotiana sylvestris
ref|XP_004242383.1|  PREDICTED: 26S proteasome regulatory subunit...    822   0.0     Solanum lycopersicum
ref|XP_009601763.1|  PREDICTED: 26S proteasome regulatory subunit...    821   0.0     Nicotiana tomentosiformis
emb|CDP03836.1|  unnamed protein product                                819   0.0     Coffea canephora [robusta coffee]
ref|XP_011080157.1|  PREDICTED: 26S proteasome regulatory subunit...    818   0.0     Sesamum indicum [beniseed]
ref|XP_006352708.1|  PREDICTED: 26S proteasome regulatory subunit...    817   0.0     Solanum tuberosum [potatoes]
gb|EYU17968.1|  hypothetical protein MIMGU_mgv1a006475mg                815   0.0     Erythranthe guttata [common monkey flower]
gb|EPS64118.1|  hypothetical protein M569_10659                         811   0.0     Genlisea aurea
ref|NP_001275024.1|  26S proteasome subunit 4-like                      811   0.0     Solanum tuberosum [potatoes]
ref|XP_007048401.1|  Regulatory particle AAA-ATPase 2A isoform 1        810   0.0     
gb|KJB18716.1|  hypothetical protein B456_003G066800                    810   0.0     Gossypium raimondii
ref|XP_007049878.1|  Regulatory particle AAA-ATPase 2A                  810   0.0     Theobroma cacao [chocolate]
gb|KHG18015.1|  26S proteasome regulatory subunit 4 A -like protein     810   0.0     Gossypium arboreum [tree cotton]
ref|XP_010069676.1|  PREDICTED: 26S proteasome regulatory subunit...    809   0.0     Eucalyptus grandis [rose gum]
gb|KHG23423.1|  26S proteasome regulatory subunit 4 A -like protein     809   0.0     Gossypium arboreum [tree cotton]
ref|XP_006443671.1|  hypothetical protein CICLE_v10020143mg             809   0.0     Citrus clementina [clementine]
ref|XP_003521331.1|  PREDICTED: 26S proteasome regulatory subunit...    808   0.0     Glycine max [soybeans]
ref|XP_003537160.1|  PREDICTED: 26S proteasome regulatory subunit...    808   0.0     Glycine max [soybeans]
gb|KHG28065.1|  26S proteasome regulatory subunit 4 B -like protein     807   0.0     Gossypium arboreum [tree cotton]
gb|KJB10976.1|  hypothetical protein B456_001G234700                    807   0.0     Gossypium raimondii
dbj|BAJ79010.1|  regulatory particle triple-A ATPase 2                  806   0.0     Sophora flavescens
ref|XP_003542453.1|  PREDICTED: 26S proteasome regulatory subunit...    806   0.0     Glycine max [soybeans]
ref|XP_003554317.1|  PREDICTED: 26S proteasome regulatory subunit...    806   0.0     Glycine max [soybeans]
ref|XP_002263334.1|  PREDICTED: 26S proteasome regulatory subunit...    806   0.0     Vitis vinifera
ref|XP_006845594.1|  PREDICTED: 26S proteasome regulatory subunit...    806   0.0     Amborella trichopoda
ref|XP_007144443.1|  hypothetical protein PHAVU_007G156500g             806   0.0     Phaseolus vulgaris [French bean]
ref|XP_004493865.1|  PREDICTED: 26S proteasome regulatory subunit...    806   0.0     Cicer arietinum [garbanzo]
ref|XP_008382660.1|  PREDICTED: 26S proteasome regulatory subunit...    806   0.0     
ref|XP_010109676.1|  26S proteasome regulatory subunit 4-B-like p...    805   0.0     Morus notabilis
ref|XP_008235533.1|  PREDICTED: 26S proteasome regulatory subunit...    805   0.0     Prunus mume [ume]
ref|XP_007162652.1|  hypothetical protein PHAVU_001G168800g             805   0.0     Phaseolus vulgaris [French bean]
ref|XP_008372431.1|  PREDICTED: 26S proteasome regulatory subunit...    805   0.0     Malus domestica [apple tree]
ref|XP_004152012.1|  PREDICTED: 26S proteasome regulatory subunit...    805   0.0     Cucumis sativus [cucumbers]
ref|XP_004290031.1|  PREDICTED: 26S proteasome regulatory subunit...    804   0.0     Fragaria vesca subsp. vesca
ref|XP_010245668.1|  PREDICTED: 26S proteasome regulatory subunit...    803   0.0     Nelumbo nucifera [Indian lotus]
gb|KHN09416.1|  26S proteasome regulatory subunit 4 like A              803   0.0     Glycine soja [wild soybean]
ref|XP_010264024.1|  PREDICTED: 26S proteasome regulatory subunit...    803   0.0     Nelumbo nucifera [Indian lotus]
ref|XP_002301829.1|  26S protease regulatory complex subunit 4 fa...    803   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004149071.1|  PREDICTED: 26S proteasome regulatory subunit...    803   0.0     Cucumis sativus [cucumbers]
ref|XP_011011091.1|  PREDICTED: 26S proteasome regulatory subunit...    803   0.0     Populus euphratica
ref|XP_010928641.1|  PREDICTED: 26S proteasome regulatory subunit...    803   0.0     Elaeis guineensis
ref|XP_011024543.1|  PREDICTED: 26S proteasome regulatory subunit...    803   0.0     Populus euphratica
ref|XP_003625484.1|  26S proteasome regulatory subunit-like protein     802   0.0     Medicago truncatula
ref|XP_008789682.1|  PREDICTED: 26S proteasome regulatory subunit...    802   0.0     Phoenix dactylifera
ref|XP_008800188.1|  PREDICTED: 26S proteasome regulatory subunit...    802   0.0     Phoenix dactylifera
ref|XP_010913635.1|  PREDICTED: 26S proteasome regulatory subunit...    801   0.0     
ref|XP_009371109.1|  PREDICTED: 26S proteasome regulatory subunit...    801   0.0     
ref|XP_010099046.1|  26S proteasome regulatory subunit 4-A-like p...    800   0.0     Morus notabilis
ref|XP_004495023.1|  PREDICTED: 26S proteasome regulatory subunit...    798   0.0     Cicer arietinum [garbanzo]
gb|KEH42402.1|  regulatory particle triple-A ATPase                     797   0.0     Medicago truncatula
ref|XP_009395473.1|  PREDICTED: 26S protease regulatory subunit 4...    796   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395470.1|  PREDICTED: 26S protease regulatory subunit 4...    796   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012085169.1|  PREDICTED: 26S proteasome regulatory subunit...    796   0.0     Jatropha curcas
ref|XP_006283684.1|  hypothetical protein CARUB_v10004747mg             796   0.0     
ref|XP_002526219.1|  26S protease regulatory subunit, putative          795   0.0     Ricinus communis
ref|NP_194633.1|  regulatory particle AAA-ATPase 2A                     792   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526468.1|  PREDICTED: 26S proteasome regulatory subunit...    791   0.0     Tarenaya hassleriana [spider flower]
ref|XP_002885999.1|  hypothetical protein ARALYDRAFT_480455             791   0.0     
ref|NP_179604.1|  26S proteasome subunit RPT2B                          791   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540956.1|  PREDICTED: 26S proteasome regulatory subunit...    790   0.0     Tarenaya hassleriana [spider flower]
ref|XP_010416236.1|  PREDICTED: 26S proteasome regulatory subunit...    790   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_002869455.1|  regulatory particle triple-a 2A                    790   0.0     Arabidopsis lyrata subsp. lyrata
ref|XP_012065309.1|  PREDICTED: 26S proteasome regulatory subunit...    790   0.0     Jatropha curcas
gb|ABR16267.1|  unknown                                                 790   0.0     Picea sitchensis
ref|XP_010489089.1|  PREDICTED: 26S proteasome regulatory subunit...    790   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_006297610.1|  hypothetical protein CARUB_v10013630mg             790   0.0     
gb|KFK29443.1|  hypothetical protein AALP_AA7G135000                    789   0.0     Arabis alpina [alpine rockcress]
gb|AAF22522.1|AF123391_1  26S proteasome AAA-ATPase subunit RPT2a       789   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAK50114.1|AF372977_1  At2g20140/T2G17.6                             789   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433142.1|  PREDICTED: 26S proteasome regulatory subunit...    788   0.0     Camelina sativa [gold-of-pleasure]
gb|KJB26079.1|  hypothetical protein B456_004G224000                    788   0.0     Gossypium raimondii
ref|XP_009129033.1|  PREDICTED: 26S proteasome regulatory subunit...    787   0.0     Brassica rapa
ref|XP_006408928.1|  hypothetical protein EUTSA_v10001985mg             787   0.0     
emb|CDY06847.1|  BnaC01g09460D                                          786   0.0     
ref|XP_001769084.1|  predicted protein                                  787   0.0     
ref|XP_002320617.2|  hypothetical protein POPTR_0014s18530g             785   0.0     
gb|KDP43828.1|  hypothetical protein JCGZ_23036                         786   0.0     Jatropha curcas
ref|XP_010438356.1|  PREDICTED: 26S proteasome regulatory subunit...    786   0.0     Camelina sativa [gold-of-pleasure]
gb|AAM65126.1|  26S proteasome subunit 4                                785   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CAC14432.1|  26S proteasome subunit 4-like protein                  785   0.0     Brassica napus [oilseed rape]
ref|XP_009109057.1|  PREDICTED: 26S proteasome regulatory subunit...    781   0.0     Brassica rapa
ref|XP_001752421.1|  predicted protein                                  781   0.0     
ref|XP_001754191.1|  predicted protein                                  781   0.0     
gb|KEH23989.1|  regulatory particle triple-A ATPase                     780   0.0     Medicago truncatula
emb|CDX97472.1|  BnaC08g13370D                                          780   0.0     
ref|XP_010684990.1|  PREDICTED: 26S proteasome regulatory subunit...    776   0.0     Beta vulgaris subsp. vulgaris [field beet]
dbj|BAA04615.1|  rice homologue of Tat binding protein                  775   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049843.1|  Os03g0298400                                       775   0.0     
ref|NP_001060719.1|  Os07g0691800                                       774   0.0     
ref|XP_002966632.1|  hypothetical protein SELMODRAFT_267030             774   0.0     Selaginella moellendorffii
ref|NP_001146268.1|  uncharacterized protein LOC100279843               772   0.0     Zea mays [maize]
ref|XP_006412885.1|  hypothetical protein EUTSA_v10026925mg             778   0.0     
gb|EMS67713.1|  26S protease regulatory subunit 4-like protein          772   0.0     Triticum urartu
ref|XP_004984889.1|  PREDICTED: 26S protease regulatory subunit 4...    771   0.0     Setaria italica
ref|XP_003558120.1|  PREDICTED: 26S protease regulatory subunit 4...    769   0.0     Brachypodium distachyon [annual false brome]
gb|AAL73395.1|AF432345_1  26S proteasome regulatory subunit IV          768   0.0     Syntrichia ruralis
dbj|BAK03283.1|  predicted protein                                      768   0.0     Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG31403.1|  26S protease regulatory subunit 4                       766   0.0     Zea mays [maize]
ref|XP_002463440.1|  hypothetical protein SORBIDRAFT_02g043840          765   0.0     Sorghum bicolor [broomcorn]
ref|XP_004958786.1|  PREDICTED: 26S protease regulatory subunit 4...    765   0.0     Setaria italica
ref|XP_008653527.1|  PREDICTED: 26S protease regulatory subunit 4...    763   0.0     Zea mays [maize]
ref|XP_010233630.1|  PREDICTED: 26S protease regulatory subunit 4...    761   0.0     Brachypodium distachyon [annual false brome]
gb|KCW58093.1|  hypothetical protein EUGRSUZ_H00817                     757   0.0     Eucalyptus grandis [rose gum]
gb|KJB18718.1|  hypothetical protein B456_003G066800                    755   0.0     Gossypium raimondii
emb|CBI37252.3|  unnamed protein product                                738   0.0     Vitis vinifera
gb|EMT04844.1|  26S protease regulatory subunit 4-like protein          746   0.0     
gb|KJB18717.1|  hypothetical protein B456_003G066800                    718   0.0     Gossypium raimondii
ref|XP_002959240.1|  26S proteasome regulatory complex                  707   0.0     Volvox carteri f. nagariensis
gb|KFK40382.1|  hypothetical protein AALP_AA3G366200                    702   0.0     Arabis alpina [alpine rockcress]
ref|XP_010548707.1|  PREDICTED: 26S proteasome regulatory subunit...    704   0.0     
gb|EYU46362.1|  hypothetical protein MIMGU_mgv1a023433mg                704   0.0     Erythranthe guttata [common monkey flower]
ref|XP_001690446.1|  26S proteasome regulatory subunit                  703   0.0     Chlamydomonas reinhardtii
ref|XP_004294291.1|  PREDICTED: 26S proteasome regulatory subunit...    702   0.0     Fragaria vesca subsp. vesca
gb|EEE58887.1|  hypothetical protein OsJ_10505                          702   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EEC75058.1|  hypothetical protein OsI_11173                          701   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007048402.1|  Regulatory particle AAA-ATPase 2A isoform 2        696   0.0     
gb|KHN05911.1|  26S proteasome regulatory subunit 4 like A              696   0.0     Glycine soja [wild soybean]
gb|KIZ04434.1|  26S proteasome regulatory subunit T2                    693   0.0     Monoraphidium neglectum
gb|KEH42401.1|  regulatory particle triple-A ATPase                     685   0.0     Medicago truncatula
ref|XP_005847625.1|  26S proteasome AAA-ATPase subunit RPT2a            684   0.0     Chlorella variabilis
gb|EEE67865.1|  hypothetical protein OsJ_25676                          681   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004335995.1|  26S proteasome AAAATPase subunit RPT2a, puta...    684   0.0     Acanthamoeba castellanii str. Neff
ref|XP_001655853.1|  AAEL012095-PA                                      682   0.0     Aedes aegypti
gb|KFB53205.1|  hypothetical protein ZHAS_00021511                      681   0.0     Anopheles sinensis
ref|XP_005710517.1|  26S proteasome ATP-dependent regulatory subunit    681   0.0     Chondrus crispus [carageen]
ref|XP_001861875.1|  26S protease regulatory subunit 4                  680   0.0     Culex quinquefasciatus
dbj|BAM19425.1|  proteasome 26S subunit subunit 4 ATPase                680   0.0     Papilio xuthus [Chinese swallowtail]
ref|XP_312923.4|  AGAP003215-PA                                         679   0.0     Anopheles gambiae str. PEST
emb|CEF97142.1|  26S proteasome subunit P45                             680   0.0     Ostreococcus tauri
ref|XP_003062555.1|  predicted protein                                  679   0.0     Micromonas pusilla CCMP1545
emb|CCA21636.1|  26S proteasome AAAATPase subunit RPT2a putative        679   0.0     Albugo laibachii Nc14
gb|ETN59541.1|  26S protease regulatory subunit 4                       678   0.0     Anopheles darlingi [American malaria mosquito]
ref|XP_001416670.1|  predicted protein                                  678   0.0     Ostreococcus lucimarinus CCE9901
dbj|BAN20514.1|  proteasome 26S subunit subunit 4 ATPase                676   0.0     Riptortus pedestris
emb|CCI47533.1|  unnamed protein product                                676   0.0     Albugo candida
ref|XP_001982075.1|  GG12390                                            676   0.0     Drosophila erecta
ref|NP_524469.2|  regulatory particle triple-A ATPase 2, isoform A      676   0.0     Drosophila melanogaster
ref|NP_001229616.1|  proteasome 26S subunit subunit 4 ATPase-like       676   0.0     Strongylocentrotus purpuratus [purple urchin]
ref|XP_001993700.1|  GH19692                                            676   0.0     Drosophila grimshawi
ref|XP_005179926.1|  PREDICTED: 26S protease regulatory subunit 4       676   0.0     Musca domestica
ref|XP_002000888.1|  GI22277                                            676   0.0     Drosophila mojavensis
ref|XP_002613460.1|  hypothetical protein BRAFLDRAFT_119863             675   0.0     Branchiostoma floridae
ref|XP_001358781.1|  GA18789                                            675   0.0     Drosophila pseudoobscura pseudoobscura
ref|XP_001953861.1|  GF17023                                            675   0.0     
ref|XP_002053771.1|  GJ24070                                            675   0.0     
gb|KDR19574.1|  26S protease regulatory subunit 4                       675   0.0     Zootermopsis nevadensis
ref|XP_974859.1|  PREDICTED: 26S protease regulatory subunit 4          674   0.0     Tribolium castaneum [rust-red flour beetle]
gb|AEE62840.1|  unknown                                                 673   0.0     Dendroctonus ponderosae
ref|XP_012150316.1|  PREDICTED: 26S protease regulatory subunit 4       673   0.0     Megachile rotundata
gb|KFH72195.1|  26S protease regulatory subunit 4                       672   0.0     Mortierella verticillata NRRL 6337
ref|XP_005838339.1|  26S proteasome regulatory complex, ATPase RPT2     672   0.0     Guillardia theta CCMP2712
ref|XP_003395819.1|  PREDICTED: 26S protease regulatory subunit 4...    672   0.0     Bombus terrestris [large earth bumblebee]
ref|XP_004523315.1|  PREDICTED: 26S protease regulatory subunit 4...    672   0.0     Ceratitis capitata [medfly]
ref|XP_008550534.1|  PREDICTED: 26S protease regulatory subunit 4       672   0.0     Microplitis demolitor
ref|XP_011185945.1|  PREDICTED: 26S protease regulatory subunit 4       671   0.0     Zeugodacus cucurbitae [melon fruit fly]
ref|XP_623527.1|  PREDICTED: 26S protease regulatory subunit 4 is...    671   0.0     Apis mellifera [bee]
gb|AAB34134.1|  P26s4                                                   671   0.0     Drosophila melanogaster
ref|XP_003696714.1|  PREDICTED: 26S protease regulatory subunit 4...    671   0.0     Apis florea [dwarf honeybee]
ref|XP_011146352.1|  PREDICTED: 26S protease regulatory subunit 4       670   0.0     Harpegnathos saltator
gb|EFN79932.1|  26S protease regulatory subunit 4                       672   0.0     Harpegnathos saltator
ref|XP_011260462.1|  PREDICTED: 26S protease regulatory subunit 4       670   0.0     Camponotus floridanus
ref|XP_005773763.1|  hypothetical protein EMIHUDRAFT_444500             670   0.0     Emiliania huxleyi CCMP1516
ref|XP_011343804.1|  PREDICTED: 26S protease regulatory subunit 4       670   0.0     Ooceraea biroi
ref|XP_005106466.1|  PREDICTED: 26S protease regulatory subunit 4...    670   0.0     Aplysia californica
ref|XP_011303495.1|  PREDICTED: 26S protease regulatory subunit 4       669   0.0     Fopius arisanus
ref|XP_009521651.1|  hypothetical protein PHYSODRAFT_354148             670   0.0     Phytophthora sojae
ref|XP_011051171.1|  PREDICTED: 26S protease regulatory subunit 4       669   0.0     Acromyrmex echinatior
ref|XP_008896011.1|  26S protease regulatory subunit 4                  669   0.0     Phytophthora parasitica INRA-310
gb|EGI70823.1|  26S protease regulatory subunit 4                       669   0.0     Acromyrmex echinatior
ref|XP_002900803.1|  26S protease regulatory subunit 4                  669   0.0     Phytophthora infestans T30-4
ref|XP_002521148.1|  26S protease regulatory subunit, putative          667   0.0     
ref|XP_011640062.1|  PREDICTED: 26S protease regulatory subunit 4       668   0.0     Pogonomyrmex barbatus
ref|XP_009829202.1|  26S protease regulatory subunit 4                  668   0.0     Aphanomyces astaci
gb|ESA02536.1|  hypothetical protein GLOINDRAFT_337332                  668   0.0     
emb|CDH57868.1|  26s proteasome subunit p45                             667   0.0     Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH57869.1|  26s proteasome subunit p45                             667   0.0     Lichtheimia corymbifera JMRC:FSU:9682
gb|AII16487.1|  26S protease regulatory subunit 4                       667   0.0     Paracyclopina nana
ref|XP_002501620.1|  predicted protein                                  667   0.0     Micromonas commoda
gb|KDO27797.1|  26S proteasome regulatory subunit 4 A                   667   0.0     Saprolegnia parasitica CBS 223.65
gb|ETP34278.1|  26S protease regulatory subunit 4                       667   0.0     Phytophthora parasitica P10297
ref|XP_002431748.1|  26S protease regulatory subunit, putative          666   0.0     Pediculus humanus corporis [human body lice]
ref|XP_008605817.1|  26S proteasome regulatory subunit 4 like A         666   0.0     Saprolegnia diclina VS20
ref|XP_002165829.1|  PREDICTED: 26S protease regulatory subunit 4...    666   0.0     Hydra vulgaris
gb|ACO12018.1|  26S protease regulatory subunit 4                       665   0.0     Lepeophtheirus salmonis
ref|XP_008875734.1|  26S protease regulatory subunit 4                  665   0.0     Aphanomyces invadans
ref|XP_011504351.1|  PREDICTED: 26S protease regulatory subunit 4       665   0.0     Ceratosolen solmsi marchali
emb|CEG65804.1|  Putative 26s protease regulatory subunit 4             665   0.0     Rhizopus microsporus
ref|XP_003746341.1|  PREDICTED: 26S protease regulatory subunit 4...    665   0.0     
dbj|BAD96388.1|  proteasome 26S ATPase subunit 1 variant                664   0.0     Homo sapiens [man]
emb|CEP14990.1|  hypothetical protein                                   664   0.0     Parasitella parasitica
ref|XP_010876963.1|  PREDICTED: 26S protease regulatory subunit 4       664   0.0     Esox lucius
dbj|GAN01086.1|  26S proteasome subunit P45                             663   0.0     Mucor ambiguus
gb|EPB87829.1|  26S protease regulatory subunit 4                       662   0.0     Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009065811.1|  hypothetical protein LOTGIDRAFT_197242             662   0.0     Lottia gigantea
ref|XP_010880812.1|  PREDICTED: 26S protease regulatory subunit 4...    662   0.0     Esox lucius
gb|ACI68908.1|  26S protease regulatory subunit 4                       662   0.0     Salmo salar
ref|XP_007253845.1|  PREDICTED: 26S protease regulatory subunit 4...    660   0.0     
ref|XP_011425280.1|  PREDICTED: 26S protease regulatory subunit 4       660   0.0     Crassostrea gigas
gb|ACH85269.1|  proteasome (prosome, macropain) 26S subunit, ATPa...    660   0.0     Salmo salar
gb|KDD76237.1|  AAA+ ATPase                                             660   0.0     Helicosporidium sp. ATCC 50920
ref|XP_010780333.1|  PREDICTED: 26S protease regulatory subunit 4...    660   0.0     Notothenia coriiceps [yellowbelly rockcod]
gb|ACN10996.1|  26S protease regulatory subunit 4                       660   0.0     Salmo salar
ref|XP_004924561.1|  PREDICTED: 26S protease regulatory subunit 4...    658   0.0     
gb|ELU12421.1|  hypothetical protein CAPTEDRAFT_160726                  659   0.0     Capitella teleta
ref|XP_001604655.1|  PREDICTED: 26S protease regulatory subunit 4       660   0.0     Nasonia vitripennis
ref|XP_004083702.1|  PREDICTED: 26S protease regulatory subunit 4       659   0.0     
emb|CDJ05993.1|  proteasome 26s subunit subunit 4 atpase                659   0.0     
ref|XP_002141206.1|  26S proteasome subunit 4                           659   0.0     Cryptosporidium muris RN66
ref|NP_001002091.1|  proteasome (prosome, macropain) 26S subunit,...    659   0.0     Danio rerio [leopard danio]
gb|EMD34033.1|  hypothetical protein CERSUDRAFT_117543                  659   0.0     Gelatoporia subvermispora B
gb|ACO10548.1|  26S protease regulatory subunit 4                       658   0.0     Caligus rogercresseyi
ref|XP_007846015.1|  putative rpt2-26s proteasome regulatory subunit    658   0.0     
ref|XP_005769175.1|  hypothetical protein EMIHUDRAFT_355962             657   0.0     Emiliania huxleyi CCMP1516
emb|CDS33761.1|  proteasome 26s subunit subunit 4 atpase                657   0.0     Hymenolepis microstoma
ref|XP_003322501.1|  26S protease regulatory subunit 4                  657   0.0     Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EFX87779.1|  hypothetical protein DAPPUDRAFT_306388                  657   0.0     Daphnia pulex
ref|XP_009951400.1|  PREDICTED: 26S protease regulatory subunit 4       657   0.0     Leptosomus discolor
ref|XP_002117269.1|  26S proteasome regulatory chain 4                  656   0.0     Trichoplax adhaerens
ref|XP_011571254.1|  PREDICTED: 26S protease regulatory subunit 4...    657   0.0     Aquila chrysaetos canadensis
emb|CDS23259.1|  proteasome 26s subunit subunit 4 atpase                658   0.0     Echinococcus granulosus
ref|XP_009100602.1|  PREDICTED: 26S protease regulatory subunit 4       657   0.0     
ref|XP_009688138.1|  PREDICTED: 26S protease regulatory subunit 4       657   0.0     Struthio camelus australis
ref|XP_010392357.1|  PREDICTED: 26S protease regulatory subunit 4...    656   0.0     
ref|XP_005285442.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     Chrysemys picta bellii
ref|XP_005438976.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     
ref|XP_006042318.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     
ref|XP_003987959.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     Felis catus [cat]
ref|XP_009279221.1|  PREDICTED: 26S protease regulatory subunit 4       658   0.0     
gb|KIY61485.1|  26S proteasome subunit P45                              656   0.0     Cylindrobasidium torrendii FP15055 ss-10
gb|EHB02601.1|  26S protease regulatory subunit 4                       656   0.0     Heterocephalus glaber [naked mole rat]
ref|XP_007180940.1|  PREDICTED: 26S protease regulatory subunit 4...    656   0.0     
gb|EUB61439.1|  26S protease regulatory subunit 4                       657   0.0     Echinococcus granulosus
ref|XP_005149701.1|  PREDICTED: 26S protease regulatory subunit 4       658   0.0     Melopsittacus undulatus
ref|XP_003027303.1|  hypothetical protein SCHCODRAFT_238082             656   0.0     Schizophyllum commune H4-8
ref|XP_006028418.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     
gb|EPQ10744.1|  26S protease regulatory subunit 4                       656   0.0     Myotis brandtii
ref|XP_003214402.1|  PREDICTED: 26S protease regulatory subunit 4       655   0.0     Anolis carolinensis [Carolina anole]
ref|XP_006122416.1|  PREDICTED: 26S protease regulatory subunit 4       657   0.0     
ref|XP_010002048.1|  PREDICTED: 26S protease regulatory subunit 4       658   0.0     Chaetura pelagica
ref|XP_006158084.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     
ref|XP_008049593.1|  PREDICTED: 26S protease regulatory subunit 4       655   0.0     Carlito syrichta
ref|XP_007318478.1|  hypothetical protein SERLADRAFT_348772             655   0.0     Serpula lacrymans var. lacrymans S7.9
gb|AAA35484.1|  26S protease (S4) regulatory subunit                    655   0.0     Homo sapiens [man]
ref|XP_007526891.1|  PREDICTED: 26S protease regulatory subunit 4       655   0.0     Erinaceus europaeus [common hedgehog]
ref|NP_032973.1|  26S protease regulatory subunit 4                     655   0.0     Mus musculus [mouse]
ref|XP_010307096.1|  PREDICTED: 26S protease regulatory subunit 4       655   0.0     Balearica regulorum gibbericeps
ref|XP_010151155.1|  PREDICTED: 26S protease regulatory subunit 4       655   0.0     Eurypyga helias
ref|XP_012037609.1|  PREDICTED: 26S protease regulatory subunit 4...    655   0.0     
ref|XP_009584690.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    655   0.0     Fulmarus glacialis
ref|XP_001103312.1|  PREDICTED: 26S protease regulatory subunit 4...    655   0.0     
ref|XP_003206722.2|  PREDICTED: 26S protease regulatory subunit 4       658   0.0     
ref|XP_004884174.1|  PREDICTED: 26S protease regulatory subunit 4...    656   0.0     
ref|XP_009914241.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     Haliaeetus albicilla
ref|XP_007414749.1|  ATP-dependent 26S proteasome regulatory subunit    654   0.0     Melampsora larici-populina 98AG31
ref|XP_005417623.1|  PREDICTED: 26S protease regulatory subunit 4       657   0.0     
gb|KFO76440.1|  26S protease regulatory subunit 4                       654   0.0     Cuculus canorus
ref|XP_006632337.1|  PREDICTED: 26S protease regulatory subunit 4...    655   0.0     
ref|NP_001232241.1|  putative 26S ATPase complex subunit 4              654   0.0     Taeniopygia guttata
ref|XP_005983102.1|  PREDICTED: 26S protease regulatory subunit 4       654   0.0     Pantholops hodgsonii [Tibetan antelope]
ref|XP_010392353.1|  PREDICTED: 26S protease regulatory subunit 4...    657   0.0     
ref|XP_010132796.1|  PREDICTED: 26S protease regulatory subunit 4       654   0.0     Buceros rhinoceros silvestris
gb|KGL73273.1|  26S protease regulatory subunit 4                       654   0.0     Tinamus guttatus
emb|CAX73881.1|  Proteasome 26S subunit subunit 4 ATPase                654   0.0     Schistosoma japonicum
ref|XP_009018363.1|  hypothetical protein HELRODRAFT_185636             654   0.0     Helobdella robusta
ref|XP_008491049.1|  PREDICTED: 26S protease regulatory subunit 4       655   0.0     Calypte anna
ref|XP_007253016.1|  PREDICTED: 26S protease regulatory subunit 4...    654   0.0     Astyanax mexicanus [blind cave fish]
ref|XP_010392347.1|  PREDICTED: 26S protease regulatory subunit 4...    656   0.0     
emb|CAZ36600.1|  26S protease regulatory subunit, putative              653   0.0     Schistosoma mansoni
ref|NP_001014855.1|  26S protease regulatory subunit 4                  653   0.0     Bos taurus [bovine]
ref|XP_010348883.1|  PREDICTED: 26S protease regulatory subunit 4       653   0.0     Saimiri boliviensis boliviensis
dbj|GAA49174.1|  26S proteasome regulatory subunit T2                   652   0.0     Clonorchis sinensis [oriental liver fluke]
ref|XP_010582318.1|  PREDICTED: 26S protease regulatory subunit 4       655   0.0     Haliaeetus leucocephalus
ref|XP_007908313.1|  PREDICTED: 26S protease regulatory subunit 4       653   0.0     Callorhinchus milii [Australian ghost shark]
ref|XP_004055612.1|  PREDICTED: 26S protease regulatory subunit 4...    653   0.0     
ref|XP_004363832.1|  proteasome 26S subunit                             653   0.0     Capsaspora owczarzaki ATCC 30864
gb|ELK01127.1|  26S protease regulatory subunit 4                       655   0.0     Pteropus alecto
ref|XP_011810030.1|  PREDICTED: 26S protease regulatory subunit 4       653   0.0     Colobus angolensis palliatus
emb|CDO70660.1|  hypothetical protein BN946_scf184756.g27               653   0.0     Trametes cinnabarina
ref|XP_007869061.1|  26S proteasome subunit P45                         653   0.0     Gloeophyllum trabeum ATCC 11539
ref|XP_005725123.1|  PREDICTED: 26S protease regulatory subunit 4...    653   0.0     
gb|AAH67741.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    652   0.0     
ref|XP_008039737.1|  26S proteasome subunit P45                         652   0.0     
emb|CAG00116.1|  unnamed protein product                                652   0.0     
gb|KFO18267.1|  26S protease regulatory subunit 4                       654   0.0     
ref|XP_007362693.1|  26S proteasome subunit P45                         652   0.0     
ref|XP_006681706.1|  hypothetical protein BATDEDRAFT_32324              652   0.0     
gb|KFV70634.1|  26S protease regulatory subunit 4                       652   0.0     
emb|CBJ33278.1|  conserved unknown protein                              652   0.0     
gb|AAH16368.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    651   0.0     
ref|XP_005047560.1|  PREDICTED: 26S protease regulatory subunit 4       657   0.0     
gb|KIL58753.1|  hypothetical protein M378DRAFT_132186                   651   0.0     
ref|XP_003756221.1|  PREDICTED: 26S protease regulatory subunit 4       654   0.0     
ref|NP_990289.1|  26S protease regulatory subunit 4                     651   0.0     
emb|CCO30814.1|  26S protease regulatory subunit 4 Short=P26s4          651   0.0     
gb|KIP07625.1|  hypothetical protein PHLGIDRAFT_89262                   651   0.0     
ref|XP_625714.1|  26S proteasome regulatory subunit S4 like AAA A...    650   0.0     
gb|KDE06590.1|  26S protease regulatory subunit 4                       650   0.0     
emb|CDJ39342.1|  26S proteasome subunit 4, putative                     650   0.0     
ref|XP_009903131.1|  PREDICTED: 26S protease regulatory subunit 4       650   0.0     
gb|ABB71588.1|  26S proteasome subunit ATPase 4                         649   0.0     
ref|NP_001271694.1|  uncharacterized protein LOC101925039               650   0.0     
gb|KIK62983.1|  hypothetical protein GYMLUDRAFT_57752                   650   0.0     
gb|EUC64951.1|  26S proteasome regulatory complex, ATPase RPT2          650   0.0     
ref|XP_003440735.1|  PREDICTED: 26S protease regulatory subunit 4...    650   0.0     
ref|XP_005705264.1|  AAA-type ATPase                                    649   0.0     
emb|CEJ02486.1|  Putative Proteasome regulatory particle subunit ...    649   0.0     
gb|KDQ19257.1|  hypothetical protein BOTBODRAFT_170378                  650   0.0     
ref|XP_007262774.1|  26S proteasome subunit P45                         650   0.0     
gb|KFQ92146.1|  26S protease regulatory subunit 4                       650   0.0     
ref|XP_009559613.1|  PREDICTED: 26S protease regulatory subunit 4       652   0.0     
ref|XP_009474195.1|  PREDICTED: 26S protease regulatory subunit 4       650   0.0     
gb|EHH62123.1|  hypothetical protein EGM_20328                          649   0.0     
ref|XP_007299755.1|  26S proteasome subunit P45                         649   0.0     
ref|XP_007383110.1|  26S proteasome subunit P45                         649   0.0     
gb|KIM73259.1|  hypothetical protein PILCRDRAFT_829271                  649   0.0     
gb|KII85055.1|  hypothetical protein PLICRDRAFT_178815                  649   0.0     
ref|XP_005992765.1|  PREDICTED: 26S protease regulatory subunit 4       649   0.0     
ref|NP_001080548.1|  proteasome (prosome, macropain) 26S subunit,...    649   0.0     
ref|XP_001948523.1|  PREDICTED: 26S protease regulatory subunit 4       649   0.0     
emb|CEG65805.1|  Putative 26s protease regulatory subunit 4             647   0.0     
gb|EJU04754.1|  26S proteasome subunit P45                              649   0.0     
gb|ACO07810.1|  26S protease regulatory subunit 4                       648   0.0     
gb|KDQ24457.1|  hypothetical protein PLEOSDRAFT_170485                  648   0.0     
emb|CBY14503.1|  unnamed protein product                                647   0.0     
gb|EKC29780.1|  26S protease regulatory subunit 4                       664   0.0     
gb|KDQ57318.1|  hypothetical protein JAAARDRAFT_157515                  647   0.0     
ref|XP_007330473.1|  hypothetical protein AGABI1DRAFT_114231            647   0.0     
ref|XP_001880695.1|  predicted protein                                  647   0.0     
ref|XP_006459243.1|  hypothetical protein AGABI2DRAFT_191249            647   0.0     
gb|ACN10104.1|  26S protease regulatory subunit 4                       647   0.0     
ref|XP_008310982.1|  PREDICTED: 26S protease regulatory subunit 4...    647   0.0     
gb|KIK10182.1|  hypothetical protein K443DRAFT_141943                   647   0.0     
ref|XP_004649113.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    649   0.0     
gb|KIJ51065.1|  hypothetical protein M422DRAFT_44261                    645   0.0     
gb|EWM27689.1|  26s proteasome subunit 4                                645   0.0     
gb|KIM33574.1|  hypothetical protein M408DRAFT_310025                   645   0.0     
gb|KFP32693.1|  26S protease regulatory subunit 4                       645   0.0     
ref|XP_009073865.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    645   0.0     
ref|XP_004649731.1|  PREDICTED: 26S protease regulatory subunit 4       656   0.0     
ref|XP_009871810.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    645   0.0     
gb|AAI54337.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    644   0.0     
ref|XP_005888676.1|  PREDICTED: 26S protease regulatory subunit 4       645   0.0     
ref|XP_002677130.1|  predicted protein                                  644   0.0     
ref|XP_007342133.1|  26S proteasome subunit P45                         644   0.0     
gb|KIO31628.1|  hypothetical protein M407DRAFT_128871                   644   0.0     
ref|XP_009545449.1|  26S proteasome regulatory complex, ATPase RPT2     644   0.0     
ref|XP_010078854.1|  PREDICTED: 26S protease regulatory subunit 4       643   0.0     
ref|XP_002778080.1|  26S protease regulatory subunit, putative          643   0.0     
gb|EPT01431.1|  hypothetical protein FOMPIDRAFT_1023309                 643   0.0     
gb|KIJ66972.1|  hypothetical protein HYDPIDRAFT_128491                  642   0.0     
ref|NP_956327.1|  proteasome (prosome, macropain) 26S subunit, AT...    642   0.0     
gb|KIY42837.1|  putative RPT2-26S proteasome regulatory subunit         642   0.0     
ref|XP_002765620.1|  26S protease regulatory subunit, putative          642   0.0     
ref|XP_010114824.1|  PREDICTED: 26S protease regulatory subunit 4       642   0.0     
ref|XP_010013217.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    642   0.0     
ref|XP_005645317.1|  26S proteasome subunit P45                         639   0.0     
gb|KIK16118.1|  hypothetical protein PISMIDRAFT_16051                   642   0.0     
ref|XP_007393654.1|  hypothetical protein PHACADRAFT_252589             644   0.0     
ref|XP_008697005.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    642   0.0     
ref|XP_002127866.1|  PREDICTED: 26S protease regulatory subunit 4       642   0.0     
ref|XP_010202613.1|  PREDICTED: 26S protease regulatory subunit 4       642   0.0     
gb|KIM67558.1|  hypothetical protein SCLCIDRAFT_1210213                 641   0.0     
gb|KIO15228.1|  hypothetical protein M404DRAFT_208810                   641   0.0     
gb|KIJ13444.1|  hypothetical protein PAXINDRAFT_81037                   641   0.0     
ref|XP_007765789.1|  26S proteasome subunit P45                         641   0.0     
gb|EUD72611.1|  26S proteasome regulatory subunit 4 like B              640   0.0     
ref|XP_007877676.1|  hypothetical protein PFL1_01974                    640   0.0     
gb|KJP87829.1|  26S protease regulatory subunit 4                       640   0.0     
ref|XP_004221963.1|  26S proteasome regulatory subunit 4                640   0.0     
gb|KFB53206.1|  AGAP003215-PA-like protein                              640   0.0     
ref|XP_001614391.1|  26S proteasome regulatory subunit 4                640   0.0     
gb|KFR12490.1|  26S protease regulatory subunit 4                       639   0.0     
gb|KFQ29040.1|  26S protease regulatory subunit 4                       640   0.0     
gb|KIK96783.1|  hypothetical protein PAXRUDRAFT_825584                  640   0.0     
gb|KFP40116.1|  26S protease regulatory subunit 4                       640   0.0     
gb|ERE73673.1|  26S protease regulatory subunit 4-like protein          639   0.0     
ref|XP_002258715.1|  26S proteasome regulatory subunit 4                640   0.0     
ref|XP_009968495.1|  PREDICTED: 26S protease regulatory subunit 4       639   0.0     
ref|XP_009702606.1|  PREDICTED: 26S protease regulatory subunit 4       639   0.0     
ref|XP_008623308.1|  26S proteasome regulatory subunit 4 like B         639   0.0     
ref|XP_726782.1|  26S proteasome subunit 4 protein                      639   0.0     
gb|KFO56091.1|  26S protease regulatory subunit 4                       639   0.0     
ref|XP_007510866.1|  26S protease regulatory subunit 4                  639   0.0     
emb|CDI80922.1|  26S proteasome subunit 4, putative                     642   0.0     
ref|XP_008816013.1|  26S proteasome regulatory subunit 4 like B         639   0.0     
emb|CCA75216.1|  probable RPT2-26S proteasome regulatory subunit        638   0.0     
gb|EMS22541.1|  26S proteasome regulatory subunit T2                    638   0.0     
gb|ELR61578.1|  26S protease regulatory subunit 4                       638   0.0     
ref|XP_011550572.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    637   0.0     
ref|XP_011809801.1|  PREDICTED: 26S protease regulatory subunit 4...    637   0.0     
ref|XP_010192568.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    637   0.0     
dbj|GAK64532.1|  RPT2-26S proteasome regulatory subunit                 639   0.0     
gb|ELK36973.1|  26S protease regulatory subunit 4                       639   0.0     
gb|KFQ49939.1|  26S protease regulatory subunit 4                       637   0.0     
gb|EYC28352.1|  hypothetical protein Y032_0007g3178                     637   0.0     
gb|KHJ79755.1|  26S proteasome subunit P45 family protein               637   0.0     
gb|KDR79003.1|  hypothetical protein GALMADRAFT_137968                  636   0.0     
emb|CEG65806.1|  Putative 26S protease regulatory subunit 4             634   0.0     
ref|XP_011388969.1|  putative proteasome regulatory particle base...    636   0.0     
ref|XP_003880859.1|  probable 26S protease regulatory subunit 6B,...    636   0.0     
gb|KHJ90255.1|  26S proteasome subunit P45 family protein               636   0.0     
emb|CDW53193.1|  26S proteasome regulatory complex ATPase RPT2          635   0.0     
gb|EIE84800.1|  26S protease regulatory subunit 4                       633   0.0     
gb|KDN53131.1|  putative RPT2-26S proteasome regulatory subunit         635   0.0     
gb|EST05622.1|  26S proteasome regulatory complex, ATPase RPT2          635   0.0     
ref|XP_009935165.1|  PREDICTED: 26S protease regulatory subunit 4       639   0.0     
gb|KGB38635.1|  26S protease regulatory subunit 4                       634   0.0     
dbj|GAC94094.1|  hypothetical protein PHSY_001663                       635   0.0     
emb|CDI53416.1|  probable RPT2-26S proteasome regulatory subunit        635   0.0     
gb|KIK45338.1|  hypothetical protein CY34DRAFT_78088                    634   0.0     
gb|KHN02432.1|  26S protease regulatory subunit 4 like                  630   0.0     
emb|CCF52771.1|  probable RPT2-26S proteasome regulatory subunit        634   0.0     
gb|KJH50328.1|  26S proteasome subunit P45 family protein               634   0.0     
dbj|GAC71901.1|  26S proteasome regulatory complex, ATPase RPT2         634   0.0     
gb|KFV59426.1|  26S protease regulatory subunit 4                       633   0.0     
emb|CDO64515.1|  26S proteasome regulatory subunit 4, putative          633   0.0     
emb|CBQ72941.1|  probable RPT2-26S proteasome regulatory subunit        633   0.0     
gb|KIM40506.1|  hypothetical protein M413DRAFT_445956                   633   0.0     
ref|XP_008628045.1|  PREDICTED: 26S protease regulatory subunit 4       634   0.0     
ref|XP_009817125.1|  PREDICTED: 26S protease regulatory subunit 4       632   0.0     
ref|XP_004357511.1|  26S proteasome ATPase 1 subunit                    632   0.0     
gb|ERG79797.1|  putative 26s protease regulatory subunit 4              632   0.0     
dbj|GAM28912.1|  hypothetical protein SAMD00019534_120880               632   0.0     
ref|XP_001347366.2|  26S proteasome regulatory subunit 4, putative      632   0.0     
ref|XP_010293470.1|  PREDICTED: 26S protease regulatory subunit 4       631   0.0     
gb|ETW18248.1|  26S protease regulatory subunit 4                       631   0.0     
gb|KGB79542.1|  endopeptidase                                           631   0.0     
gb|KGL93771.1|  26S protease regulatory subunit 4                       630   0.0     
gb|EWC88460.1|  26S protease regulatory subunit 4                       631   0.0     
gb|ETW56499.1|  26S protease regulatory subunit 4                       632   0.0     
ref|XP_008921933.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    629   0.0     
ref|XP_009883909.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    630   0.0     
emb|CDP96417.1|  Protein BM-RPT-2, isoform b                            629   0.0     
ref|XP_001431072.1|  hypothetical protein                               629   0.0     
ref|XP_008670686.1|  PREDICTED: 26S protease regulatory subunit 4...    624   0.0     
gb|KIR45991.1|  26S protease regulatory subunit 4                       628   0.0     
ref|XP_012049793.1|  26S protease regulatory subunit 4                  628   0.0     
gb|KIR29118.1|  26S protease regulatory subunit 4                       628   0.0     
ref|XP_003194541.1|  26S proteasome regulatory subunit 4                628   0.0     
gb|KFQ83018.1|  26S protease regulatory subunit 4                       628   0.0     
gb|EFA82511.1|  26S proteasome ATPase 1 subunit                         628   0.0     
ref|XP_001944737.2|  PREDICTED: 26S protease regulatory subunit 4...    627   0.0     
ref|XP_003135955.1|  RPT-2 protein                                      627   0.0     
gb|KKA76184.1|  AAA protein                                             627   0.0     
ref|XP_570849.1|  endopeptidase                                         626   0.0     
ref|XP_008550368.1|  PREDICTED: 26S protease regulatory subunit 4...    625   0.0     
ref|XP_005534916.1|  26S proteasome ATP-dependent regulatory subunit    625   0.0     
ref|XP_009987575.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    625   0.0     
gb|KFG43050.1|  putative 26S protease regulatory subunit 4              624   0.0     
gb|KFG29822.1|  putative 26S protease regulatory subunit 4              624   0.0     
ref|XP_011400256.1|  26S proteasome regulatory subunit 4-like pro...    624   0.0     
ref|XP_007633803.1|  PREDICTED: 26S protease regulatory subunit 4...    624   0.0     
ref|XP_646726.1|  26S proteasome ATPase 1 subunit                       623   0.0     
gb|EPR57151.1|  putative 26S protease regulatory subunit 4              623   0.0     
ref|XP_002368787.1|  26S proteasome subunit 4, putative                 623   0.0     
ref|XP_002636822.1|  C. briggsae CBR-RPT-2 protein                      622   0.0     
ref|XP_008888467.1|  26S protease regulatory subunit 4, putative        622   0.0     
ref|XP_004833397.1|  26S proteasome subunit 4, putative                 622   0.0     
ref|XP_001836399.1|  endopeptidase                                      623   0.0     
emb|CEF61023.1|  26S protease regulatory subunit 4                      622   0.0     
emb|CDW71228.1|  26s protease regulatory subunit 4                      622   0.0     
ref|XP_003112636.1|  CRE-RPT-2 protein                                  622   0.0     
gb|KJA26247.1|  hypothetical protein HYPSUDRAFT_199006                  621   0.0     
dbj|BAM11111.1|  proteasome (prosome, macropain) 26S subunit, ATP...    618   0.0     
ref|XP_003381185.1|  26S protease regulatory subunit 4                  629   0.0     
ref|XP_009499601.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    620   0.0     
gb|KGG51566.1|  hypothetical protein DI09_31p170                        621   0.0     
gb|EGT47046.1|  hypothetical protein CAEBREN_12205                      620   0.0     
emb|CDR94373.1|  26S protease regulatory subunit 4, putative            619   0.0     
ref|NP_504558.1|  Protein RPT-2                                         619   0.0     
ref|XP_007005697.1|  hypothetical protein TREMEDRAFT_44632              618   0.0     
ref|XP_011410414.1|  PREDICTED: 26S protease regulatory subunit 4...    617   0.0     
emb|CCM00111.1|  predicted protein                                      618   0.0     
emb|CCG80742.1|  26S protease regulatory subunit 4                      617   0.0     
gb|KDN50658.1|  26S protease regulatory subunit 4                       618   0.0     
ref|XP_001610851.1|  26S protease regulatory subunit 4                  616   0.0     
gb|EPZ33147.1|  26S protease regulatory subunit 4                       616   0.0     
ref|XP_002286831.1|  26S proteasome ATPase regulatory subunit 4         616   0.0     
gb|KFD63631.1|  hypothetical protein M514_09682                         630   0.0     
ref|XP_009647646.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    619   0.0     
ref|XP_504910.1|  YALI0F02585p                                          615   0.0     
gb|KFV19800.1|  26S protease regulatory subunit 4                       615   0.0     
gb|EJY88541.1|  26S protease regulatory subunit 4                       615   0.0     
gb|EJK59304.1|  hypothetical protein THAOC_20491                        615   0.0     
ref|XP_953936.1|  26S proteasome subunit 4                              614   0.0     
ref|XP_001730706.1|  hypothetical protein MGL_2160                      617   0.0     
ref|XP_005242001.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    615   0.0     
ref|XP_009317798.1|  PREDICTED: 26S protease regulatory subunit 4       614   0.0     
ref|XP_002013487.1|  GL24166                                            613   0.0     
gb|KFW89199.1|  26S protease regulatory subunit 4                       613   0.0     
gb|EKC99535.1|  endopeptidase                                           619   0.0     
ref|XP_006960777.1|  26S proteasome subunit P45                         613   0.0     
gb|EJT48081.1|  endopeptidase                                           619   0.0     
ref|XP_004032363.1|  hypothetical protein IMG5_123630                   613   0.0     
gb|KFP11560.1|  26S protease regulatory subunit 4                       610   0.0     
ref|XP_009270441.1|  26S protease regulatory subunit 4                  610   0.0     
ref|XP_007735746.1|  26S protease regulatory subunit 4                  609   0.0     
ref|XP_009689636.1|  26S proteasome subunit 4                           608   0.0     
gb|KEQ61812.1|  26S protease regulatory subunit 4                       609   0.0     
ref|XP_001744260.1|  hypothetical protein                               606   0.0     



>ref|XP_009802140.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Nicotiana sylvestris]
Length=444

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/444 (99%), Positives = 442/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQLPGDRKND DKK+KKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT
Sbjct  1     MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
             ADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   ADFKKAKDKVMFKKKEGVPEGLYM  444



>ref|XP_004242383.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Solanum 
lycopersicum]
Length=444

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/444 (99%), Positives = 441/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQLPGDRKND DKK+KKFEPAAPPARVGRKQRKQKGSEAAAR+P VTPLT
Sbjct  1     MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARIPAVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
             ADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   ADFKKAKDKVMFKKKEGVPEGLYM  444



>ref|XP_009601763.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana 
tomentosiformis]
 ref|XP_009769924.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana 
sylvestris]
Length=444

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/444 (99%), Positives = 440/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQ PGDRKND DKK+KKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT
Sbjct  1     MGQGTPGGLNRQQPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   PDFKKAKDKVMFKKKEGVPEGLYM  444



>emb|CDP03836.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/444 (98%), Positives = 441/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQLPGDRKND DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1     MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFV+NQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
             ADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   ADFKKAKDKVMFKKKEGVPEGLYM  444



>ref|XP_011080157.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Sesamum 
indicum]
 ref|XP_011083104.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Sesamum 
indicum]
Length=444

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/444 (98%), Positives = 441/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQLPGDRKND DKK+KKFEPAAPPARVGRKQRKQKG EAAAR+PTVTPLT
Sbjct  1     MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARIPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
             ADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   ADFKKAKDKVMFKKKEGVPEGLYM  444



>ref|XP_006352708.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Solanum tuberosum]
Length=444

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/444 (98%), Positives = 439/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQLPGDRKND DKK+KKFEPAAPPARVGRKQRKQKGSEAAAR+P VTPLT
Sbjct  1     MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGSEAAARIPAVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             K KLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KSKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   PDFKKAKDKVMFKKKEGVPEGLYM  444



>gb|EYU17968.1| hypothetical protein MIMGU_mgv1a006475mg [Erythranthe guttata]
Length=443

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/443 (96%), Positives = 435/443 (98%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQGTPGGLNRQLP  + + DKK+KKFEPAAPPARVGRKQRKQKG +AAAR+PTVTPLTK
Sbjct  1     MGQGTPGGLNRQLPDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPDAAARIPTVTPLTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLR LKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID
Sbjct  61    CKLRFLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKT+RRIFQIHT+RMTL+DDVNLEEFVMTKDEFSGADIKAICTEAGL ALRERRMKVTHA
Sbjct  361   IKTKRRIFQIHTSRMTLSDDVNLEEFVMTKDEFSGADIKAICTEAGLHALRERRMKVTHA  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKDKVMFKKKEGVPEGLYM  443



>gb|EPS64118.1| hypothetical protein M569_10659 [Genlisea aurea]
Length=444

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/444 (97%), Positives = 438/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQ PGDRKND DKK+KKFEPAAPPARVGRKQRKQKG EAAAR+PTVTPLT
Sbjct  1     MGQGTPGGLNRQHPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARIPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFV NQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121   DESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   GDFKKAKDKVMFKKKEGVPEGLYM  444



>ref|NP_001275024.1| 26S proteasome subunit 4-like [Solanum tuberosum]
 gb|ABB02638.1| 26S proteasome subunit 4-like [Solanum tuberosum]
Length=444

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/444 (98%), Positives = 437/444 (98%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQLPGDRKND DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1     MGQGTPGGLNRQLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDY LMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYFLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAV TKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVRTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT +MTL+DDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV H
Sbjct  361   DIKTRRRIFQIHTGKMTLSDDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVIH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
             ADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   ADFKKAKDKVMFKKKEGVPEGLYM  444



>ref|XP_007048401.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao]
 gb|EOX92558.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao]
Length=446

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/446 (97%), Positives = 439/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK+   DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKSDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>gb|KJB18716.1| hypothetical protein B456_003G066800 [Gossypium raimondii]
Length=446

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/446 (96%), Positives = 438/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK    +KK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_007049878.1| Regulatory particle AAA-ATPase 2A [Theobroma cacao]
 gb|EOX94035.1| Regulatory particle AAA-ATPase 2A [Theobroma cacao]
Length=446

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/446 (97%), Positives = 439/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK+   DKK+KKFEPAAPPARVGR+QRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKSDGSDKKEKKFEPAAPPARVGRRQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>gb|KHG18015.1| 26S proteasome regulatory subunit 4 A -like protein [Gossypium 
arboreum]
Length=446

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/446 (97%), Positives = 438/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGG+NRQ  PGDRK    DKKDKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTP
Sbjct  1     MGQGTPGGMNRQGFPGDRKPDGSDKKDKKFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLD+QIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDSQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_010069676.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Eucalyptus 
grandis]
 gb|KCW58092.1| hypothetical protein EUGRSUZ_H00817 [Eucalyptus grandis]
Length=444

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/444 (96%), Positives = 434/444 (98%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrkn-ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQ    +++  DKK+KKFEPAAPP+RVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1     MGQGTPGGLNRQSGDRKQDGSDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   VDFKKAKEKVMFKKKEGVPEGLYM  444



>gb|KHG23423.1| 26S proteasome regulatory subunit 4 A -like protein [Gossypium 
arboreum]
Length=446

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/446 (96%), Positives = 437/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK    +KK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTLRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_006443671.1| hypothetical protein CICLE_v10020143mg [Citrus clementina]
 ref|XP_006480183.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Citrus sinensis]
 gb|ESR56911.1| hypothetical protein CICLE_v10020143mg [Citrus clementina]
Length=446

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/446 (96%), Positives = 433/446 (97%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrkn---ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ PG  +     DKKDKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGPGGDRKGDGADKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THTDFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_003521331.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=446

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/446 (97%), Positives = 439/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKDKVMFKKKEGVPEGLYM  446



>ref|XP_003537160.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=443

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/443 (96%), Positives = 432/443 (98%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQGTPGG+NRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP+TK
Sbjct  1     MGQGTPGGMNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPVTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHA
Sbjct  361   IKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHA  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKDKVMFKKKEGVPEGLYM  443



>gb|KHG28065.1| 26S proteasome regulatory subunit 4 B -like protein [Gossypium 
arboreum]
 gb|KJB26078.1| hypothetical protein B456_004G224000 [Gossypium raimondii]
Length=446

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/446 (96%), Positives = 436/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ  PGDRK    DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGFPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
              TKCKLRLLKLER+KDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    HTKCKLRLLKLERVKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>gb|KJB10976.1| hypothetical protein B456_001G234700 [Gossypium raimondii]
Length=446

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/446 (96%), Positives = 437/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGG+NRQ  PGDRK    DKKDKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGMNRQGFPGDRKPDGSDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLD+QIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDSQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>dbj|BAJ79010.1| regulatory particle triple-A ATPase 2 [Sophora flavescens]
Length=446

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/446 (97%), Positives = 439/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG+PGGLNRQ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGSPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKDKVMFKKKEGVPEGLYM  446



>ref|XP_003542453.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=443

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/443 (96%), Positives = 432/443 (98%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQGTPGG+NRQ        DKK+KKFEP+APPARVGRKQRKQKG EAAARLPTVTP+TK
Sbjct  1     MGQGTPGGMNRQGDRKPDGGDKKEKKFEPSAPPARVGRKQRKQKGPEAAARLPTVTPVTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHA
Sbjct  361   IKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHA  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKDKVMFKKKEGVPEGLYM  443



>ref|XP_003554317.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=446

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/446 (97%), Positives = 439/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKDKVMFKKKEGVPEGLYM  446



>ref|XP_002263334.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Vitis 
vinifera]
 emb|CAN78907.1| hypothetical protein VITISV_029788 [Vitis vinifera]
Length=445

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/445 (97%), Positives = 438/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG  GGLNRQ LPGDRKND DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGASGGLNRQGLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             +KCKLRLLKLERIKDYLLMEEEFV+NQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    SKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HVDFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_006845594.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Amborella 
trichopoda]
 gb|ERN07269.1| hypothetical protein AMTR_s00019p00202640 [Amborella trichopoda]
Length=444

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/444 (96%), Positives = 439/444 (99%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQG+PGG+N+Q LPG+RK+DDKK+KKFEPAAPP+RVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1     MGQGSPGGMNKQGLPGERKHDDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFV+ QERLKPQE+K EEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVSGQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
             ADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   ADFKKAKEKVMFKKKEGVPEGLYM  444



>ref|XP_007144443.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris]
 gb|ESW16437.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris]
Length=443

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/443 (96%), Positives = 431/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQGTPGG+NRQ        DKK+KKFEPAAPP RVGRKQRKQKG EAAARLPTVTP+TK
Sbjct  1     MGQGTPGGMNRQGDRKPDGGDKKEKKFEPAAPPTRVGRKQRKQKGPEAAARLPTVTPVTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHA
Sbjct  361   IKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHA  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKDKVMFKKKEGVPEGLYM  443



>ref|XP_004493865.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Cicer arietinum]
Length=446

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/446 (97%), Positives = 437/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK    DKKDKKFEPAAPPARVGRKQRKQKG E+AARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGSDKKDKKFEPAAPPARVGRKQRKQKGPESAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIF IHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFTIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKDKVMFKKKEGVPEGLYM  446



>ref|XP_008382660.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Malus 
domestica]
Length=446

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/446 (96%), Positives = 436/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK   +DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEF GADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFXGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THTDFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_010109676.1| 26S proteasome regulatory subunit 4-B-like protein [Morus notabilis]
 gb|EXC24146.1| 26S proteasome regulatory subunit 4-B-like protein [Morus notabilis]
Length=446

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/446 (96%), Positives = 437/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNR  LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRPGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFV+NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THVDFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_008235533.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Prunus 
mume]
Length=446

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/446 (96%), Positives = 437/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK   +DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKL+RIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLDRIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THIDFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_007162652.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris]
 gb|ESW34646.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris]
Length=446

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/446 (97%), Positives = 438/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EED SKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDLSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKDKVMFKKKEGVPEGLYM  446



>ref|XP_008372431.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Malus domestica]
Length=446

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/446 (96%), Positives = 437/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK   +DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVFIDEIDA+GTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVFIDEIDAIGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
              HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   MHADFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_004152012.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Cucumis sativus]
 ref|XP_008447342.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Cucumis melo]
 gb|KGN58327.1| hypothetical protein Csa_3G623950 [Cucumis sativus]
Length=445

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/445 (95%), Positives = 433/445 (97%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkk--FEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGGLNRQ PGDRK+D  K K   +EPAAPP RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGTPGGLNRQAPGDRKSDADKKKDKKYEPAAPPTRVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKC+LRLLKLER+KDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    TKCRLRLLKLERVKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV I+SFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGIMSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVM+KKKEGVPEGLYM
Sbjct  421   HADFKKAKEKVMYKKKEGVPEGLYM  445



>ref|XP_004290031.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Fragaria 
vesca subsp. vesca]
Length=446

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/446 (96%), Positives = 437/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK   +DKK+KK+EPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGNDKKEKKYEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTL+DDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLSDDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THPDFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_010245668.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nelumbo 
nucifera]
Length=445

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/445 (96%), Positives = 439/445 (99%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGGLN+  LPGDRK+D DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGTPGGLNKGGLPGDRKHDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKLERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    TKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HADFKKAKEKVMFKKKEGVPEGLYM  445



>gb|KHN09416.1| 26S proteasome regulatory subunit 4 like A [Glycine soja]
Length=447

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/447 (97%), Positives = 438/447 (98%), Gaps = 4/447 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGS-EAAARLPTVT  219
             MGQGTPGGLNRQ LPGDRK    DKK+KKFEPAAPPARVGRKQRKQKG  EAAARLPTVT
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGGPEAAARLPTVT  60

Query  220   PLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLE  399
             PL+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLE
Sbjct  61    PLSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLE  120

Query  400   ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  579
             ELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSV
Sbjct  121   ELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSV  180

Query  580   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  759
             MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT
Sbjct  181   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  240

Query  760   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK  939
             LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTK
Sbjct  241   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTK  300

Query  940   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEF  1119
             RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEF
Sbjct  301   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEF  360

Query  1120  PLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  1299
             PLPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK
Sbjct  361   PLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  420

Query  1300  VTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VTHADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   VTHADFKKAKDKVMFKKKEGVPEGLYM  447



>ref|XP_010264024.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Nelumbo 
nucifera]
Length=445

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/445 (96%), Positives = 438/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGGLN+  LPGDRK+D DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGTPGGLNKGGLPGDRKHDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKLERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    TKCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HVDFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_002301829.1| 26S protease regulatory complex subunit 4 family protein [Populus 
trichocarpa]
 gb|EEE81102.1| 26S protease regulatory complex subunit 4 family protein [Populus 
trichocarpa]
Length=446

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/446 (96%), Positives = 434/446 (97%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG  GGLNRQ LPGDRK    DKKDKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGPSGGLNRQGLPGDRKQDGSDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
              TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    HTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THTDFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_004149071.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Cucumis 
sativus]
 ref|XP_008452203.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome regulatory subunit 
4 homolog B-like [Cucumis melo]
 gb|KGN61098.1| hypothetical protein Csa_2G049870 [Cucumis sativus]
Length=447

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/447 (96%), Positives = 437/447 (98%), Gaps = 4/447 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVT  219
             MGQGTPGGLNRQ  LPGDRK D  +KKDKKFEPAAPP+RVGRKQRKQKG +AAARLPTVT
Sbjct  1     MGQGTPGGLNRQGGLPGDRKQDDPNKKDKKFEPAAPPSRVGRKQRKQKGPDAAARLPTVT  60

Query  220   PLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLE  399
             P TKCKLRLLKLER+KDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLE
Sbjct  61    PHTKCKLRLLKLERVKDYLLMEEEFVTNQERLKPQEEKNEEDRSKVDDLRGSPMSVGNLE  120

Query  400   ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  579
             ELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSV
Sbjct  121   ELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSV  180

Query  580   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  759
             MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT
Sbjct  181   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  240

Query  760   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK  939
             LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTK
Sbjct  241   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTK  300

Query  940   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEF  1119
             RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEF
Sbjct  301   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEF  360

Query  1120  PLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  1299
             PLPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK
Sbjct  361   PLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  420

Query  1300  VTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VTHADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   VTHADFKKAKEKVMFKKKEGVPEGLYM  447



>ref|XP_011011091.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Populus euphratica]
Length=445

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/445 (96%), Positives = 434/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG  GGLNRQLPGDRK    DKKDKKFEPAAPP RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGPSGGLNRQLPGDRKQDGSDKKDKKFEPAAPPVRVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQE+K EEDRSKVDDLRGSPMSVG+LEEL
Sbjct  61    TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEDKVEEDRSKVDDLRGSPMSVGSLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             V+KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VDKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDA+GTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAIGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IE+LDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIETLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HTDFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_010928641.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Elaeis 
guineensis]
 ref|XP_010928642.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Elaeis 
guineensis]
Length=445

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/445 (95%), Positives = 435/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkk-FEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGG+N+Q LPGDRK+D  K  K FEPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKC+LRLLKLERIKDYLLMEEEFV NQERL+P E+K EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    TKCRLRLLKLERIKDYLLMEEEFVTNQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HADFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_011024543.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Populus 
euphratica]
Length=446

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/446 (96%), Positives = 434/446 (97%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG  GGLNRQ LPGDRK    DKKDKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGPSGGLNRQGLPGDRKQDGSDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQ +VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQHEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THTDFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_003625484.1| 26S proteasome regulatory subunit-like protein [Medicago truncatula]
 gb|ABD32889.1| AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula]
 gb|ABN08912.1| AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula]
 gb|AES81702.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=445

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/446 (97%), Positives = 438/446 (98%), Gaps = 4/446 (1%)
 Frame = +1

Query  52    MGQGTPGG-LNRQLPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGG LNRQ PGDRK   +DKKDKKFEPAAPPARVGRKQRKQKGSEAA+RLPTVTP
Sbjct  1     MGQGTPGGGLNRQ-PGDRKPDGNDKKDKKFEPAAPPARVGRKQRKQKGSEAASRLPTVTP  59

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  60    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  119

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  120   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  179

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  180   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  239

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  240   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  299

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  300   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  359

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIF IHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  360   LPDIKTRRRIFTIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  419

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  420   THADFKKAKDKVMFKKKEGVPEGLYM  445



>ref|XP_008789682.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform 
X1 [Phoenix dactylifera]
 ref|XP_008789683.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform 
X2 [Phoenix dactylifera]
Length=445

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/445 (95%), Positives = 436/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkk-FEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGG+N+Q LPGDRK+D  K  K FEPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKC+LRLLKLERIKDYLLMEEEFVANQERL+P E+K EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    TKCRLRLLKLERIKDYLLMEEEFVANQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+I+SLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIDSLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HADFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_008800188.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Phoenix dactylifera]
Length=445

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/445 (95%), Positives = 435/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkk-FEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGG+N+Q LPGDRK+D  K  K FEPAAPP+RVGRKQRKQKG EAAARLPTVTP+
Sbjct  1     MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPV  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKC+LRLLKLERIKDYLLMEEEFV NQERL+P E+K EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    TKCRLRLLKLERIKDYLLMEEEFVTNQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDA+GTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAIGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HADFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_010913635.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010913636.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
isoform X2 [Elaeis guineensis]
Length=445

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/445 (95%), Positives = 435/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkk-FEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGG+N+Q LPGDRK+D  K  K FEPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGTPGGMNKQGLPGDRKHDGDKKDKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKC+LRLLKLERIKDYLLMEEEFV NQERL+P E+K EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    TKCRLRLLKLERIKDYLLMEEEFVTNQERLRPHEDKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLD+QIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDSQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HADFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_009371109.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Pyrus 
x bretschneideri]
Length=446

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/446 (96%), Positives = 436/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK   +DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKPDGNDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFV NQER KPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVTNQERQKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVFIDEIDA+GTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVFIDEIDAIGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
              HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   MHADFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_010099046.1| 26S proteasome regulatory subunit 4-A-like protein [Morus notabilis]
 gb|EXB76506.1| 26S proteasome regulatory subunit 4-A-like protein [Morus notabilis]
Length=446

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/446 (96%), Positives = 434/446 (97%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNR+ LPGDRK D  DKK+KKFEPAAPPARVGRKQRKQKG EAAARLP VTP
Sbjct  1     MGQGTPGGLNRKGLPGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPVVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFV NQE LKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVTNQECLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDS+GDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSKGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH D KKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THVDVKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_004495023.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Cicer arietinum]
Length=446

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/446 (95%), Positives = 435/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGG+NRQ  PGDRK    DKK+KKFEPAAPPARVGRKQRKQKG +AA+RLPTVTP
Sbjct  1     MGQGTPGGMNRQGHPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPDAASRLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             ++KCKLRLLKLER+KDYLLMEEEFVA QERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    VSKCKLRLLKLERVKDYLLMEEEFVAYQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   THPDFKKAKDKVMFKKKEGVPEGLYM  446



>gb|KEH42402.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=446

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/446 (95%), Positives = 435/446 (98%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGG+NRQ  PGDRK    DKK+KKFEPAAPPARVGRKQRKQKG +AA+RLPTVTP
Sbjct  1     MGQGTPGGMNRQGHPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPDAASRLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             ++KCKLRLLKLER+KDYLLMEEEFVA QERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    VSKCKLRLLKLERVKDYLLMEEEFVAYQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             TH DFKKAKDKVMFKKKEGVPEGLYM
Sbjct  421   THPDFKKAKDKVMFKKKEGVPEGLYM  446



>ref|XP_009395473.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395474.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/445 (94%), Positives = 435/445 (98%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLP--GdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGG+ +Q P    +++ DKKDKKFEPAAPP+RVGRKQR+QKG EAAARLP VTPL
Sbjct  1     MGQGTPGGMGKQGPPGDRKRDGDKKDKKFEPAAPPSRVGRKQRRQKGPEAAARLPAVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             +KC+LR+LKLERIKDYLLMEEEFVANQERL+PQEEK EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    SKCRLRVLKLERIKDYLLMEEEFVANQERLRPQEEKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLD+QIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDSQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HADFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_009395470.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395472.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/445 (94%), Positives = 433/445 (97%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkk-FEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQGTPGG+ +Q LPGDRK D  K  K FEPAAPP+RVGRKQR+QKG EAAARLP VTPL
Sbjct  1     MGQGTPGGMGKQGLPGDRKRDGDKKDKKFEPAAPPSRVGRKQRRQKGPEAAARLPAVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             +KC+LRLLKLER+KDYLLMEEEFVANQERL+PQEEK EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    SKCRLRLLKLERVKDYLLMEEEFVANQERLRPQEEKNEEDRSKVDDLRGSPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLD+QIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLDSQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HTDFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_012085169.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Jatropha 
curcas]
 gb|KDP26427.1| hypothetical protein JCGZ_17585 [Jatropha curcas]
Length=444

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/446 (96%), Positives = 436/446 (98%), Gaps = 5/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG  G  NRQ LPGDRK+D  DKKDKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGPSG--NRQGLPGDRKSDGGDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  58

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  59    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  118

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  119   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  178

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  179   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  238

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  239   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  298

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  299   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  358

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  359   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  418

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  419   THADFKKAKEKVMFKKKEGVPEGLYM  444



>ref|XP_006283684.1| hypothetical protein CARUB_v10004747mg, partial [Capsella rubella]
 gb|EOA16582.1| hypothetical protein CARUB_v10004747mg, partial [Capsella rubella]
Length=466

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/447 (93%), Positives = 430/447 (96%), Gaps = 0/447 (0%)
 Frame = +1

Query  40    GRTIMGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVT  219
              + IMGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVT
Sbjct  20    AKRIMGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVT  79

Query  220   PLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLE  399
             P TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLE
Sbjct  80    PSTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLE  139

Query  400   ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  579
             ELIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSV
Sbjct  140   ELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSV  199

Query  580   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  759
             MKVEKAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT
Sbjct  200   MKVEKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  259

Query  760   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK  939
             LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTK
Sbjct  260   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTK  319

Query  940   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEF  1119
             RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEF
Sbjct  320   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEF  379

Query  1120  PLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  1299
             PLPDIKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK
Sbjct  380   PLPDIKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  439

Query  1300  VTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VTH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  440   VTHPDFKKAKEKVMFKKKEGVPEGLYM  466



>ref|XP_002526219.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF36160.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=443

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/445 (95%), Positives = 433/445 (97%), Gaps = 4/445 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPG--drknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG P G+NR  PG     +D+KKDKK+EPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQG-PSGMNRP-PGDRKNDSDNKKDKKYEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  58

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  59    TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKNEEDRSKVDDLRGSPMSVGNLEEL  118

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  119   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  178

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  179   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  238

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  239   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  298

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  299   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  358

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  359   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  418

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  419   HADFKKAKEKVMFKKKEGVPEGLYM  443



>ref|NP_194633.1| regulatory particle AAA-ATPase 2A [Arabidopsis thaliana]
 sp|Q9SZD4.1|PRS4A_ARATH RecName: Full=26S proteasome regulatory subunit 4 homolog A; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2a; AltName: 
Full=26S proteasome subunit 4 homolog A; AltName: Full=Protein 
HALTED ROOT; AltName: Full=Regulatory particle triple-A 
ATPase subunit 2a [Arabidopsis thaliana]
 emb|CAB43918.1| 26S proteasome subunit 4-like protein [Arabidopsis thaliana]
 emb|CAB79662.1| 26S proteasome subunit 4-like protein [Arabidopsis thaliana]
 gb|AAK59480.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 dbj|BAD18016.1| 26S proteasome subunit AtRPT2a [Arabidopsis thaliana]
 gb|AEE85578.1| regulatory particle AAA-ATPase 2A [Arabidopsis thaliana]
Length=443

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/443 (94%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_010526468.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
Length=443

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/443 (94%), Positives = 427/443 (96%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG   GLNRQ      + DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP  K
Sbjct  1     MGQGPSSGLNRQGDRKPNSGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSAK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHG  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_002885999.1| hypothetical protein ARALYDRAFT_480455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62258.1| hypothetical protein ARALYDRAFT_480455 [Arabidopsis lyrata subsp. 
lyrata]
Length=443

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/443 (94%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|NP_179604.1| 26S proteasome subunit RPT2B [Arabidopsis thaliana]
 sp|Q9SL67.1|PRS4B_ARATH RecName: Full=26S proteasome regulatory subunit 4 homolog B; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2b; AltName: 
Full=26S proteasome subunit 4 homolog B; AltName: Full=Regulatory 
particle triple-A ATPase subunit 2b [Arabidopsis thaliana]
 gb|AAD24384.1| 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AAK59577.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AAL07184.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AEC06970.1| 26S proteasome subunit RPT2B [Arabidopsis thaliana]
Length=443

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        +KK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_010540956.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Tarenaya 
hassleriana]
Length=443

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/443 (94%), Positives = 426/443 (96%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG   GLNRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP  K
Sbjct  1     MGQGPSSGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSAK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHG  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_010416236.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Camelina 
sativa]
 ref|XP_010467933.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B isoform 
X1 [Camelina sativa]
 ref|XP_010467934.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B isoform 
X2 [Camelina sativa]
Length=443

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQR+QKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRRQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_002869455.1| regulatory particle triple-a 2A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45714.1| regulatory particle triple-a 2A [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDA+GTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAIGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IE+LDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIETLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_012065309.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X1 [Jatropha curcas]
 ref|XP_012065310.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X2 [Jatropha curcas]
Length=443

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/445 (95%), Positives = 432/445 (97%), Gaps = 4/445 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPG--drknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG P G+NR  PG     +D+KKDKK+EPAAPP+RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQG-PSGMNRP-PGDRKNDSDNKKDKKYEPAAPPSRVGRKQRKQKGPEAAARLPTVTPL  58

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKLERIKDYLLMEEEFVANQERLKP EEK EEDRSKVDDLRGSPMSVGNLEEL
Sbjct  59    TKCKLRLLKLERIKDYLLMEEEFVANQERLKPLEEKNEEDRSKVDDLRGSPMSVGNLEEL  118

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  119   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  178

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  179   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  238

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  239   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  298

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  299   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  358

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  359   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  418

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             HADFKKAK+KVMFKKKEGVPEGLY+
Sbjct  419   HADFKKAKEKVMFKKKEGVPEGLYL  443



>gb|ABR16267.1| unknown [Picea sitchensis]
Length=444

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/444 (94%), Positives = 431/444 (97%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQ   GGLNR+  P DRK DDKK+KKFEPAAPP RVGR+QRKQKG EAAARLP VTPLT
Sbjct  1     MGQAHGGGLNRKGSPDDRKQDDKKEKKFEPAAPPTRVGRRQRKQKGPEAAARLPVVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRGSPMSVGNLEE+I
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVSNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEEII  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFD+RGDVKVILATN+I+SLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDARGDVKVILATNRIDSLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT 
Sbjct  361   DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTQ  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   IDFKKAKEKVMFKKKEGVPEGLYM  444



>ref|XP_010489089.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X1 [Camelina sativa]
 ref|XP_010489090.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X2 [Camelina sativa]
Length=443

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQR+QKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKTDGGDKKEKKFEPAAPPARVGRKQRRQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_006297610.1| hypothetical protein CARUB_v10013630mg, partial [Capsella rubella]
 gb|EOA30508.1| hypothetical protein CARUB_v10013630mg, partial [Capsella rubella]
Length=468

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/445 (93%), Positives = 429/445 (96%), Gaps = 0/445 (0%)
 Frame = +1

Query  46    TIMGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             T MGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQRKQ+G EAAARLPTVTP 
Sbjct  24    TPMGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQRGPEAAARLPTVTPS  83

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKL+RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  84    TKCKLRLLKLDRIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  143

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  144   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  203

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  204   VEKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  263

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  264   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  323

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DA+SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  324   DANSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  383

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  384   PDIKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  443

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  444   HVDFKKAKEKVMFKKKEGVPEGLYM  468



>gb|KFK29443.1| hypothetical protein AALP_AA7G135000 [Arabis alpina]
Length=443

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKL+RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLDRIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>gb|AAF22522.1|AF123391_1 26S proteasome AAA-ATPase subunit RPT2a [Arabidopsis thaliana]
Length=443

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/443 (93%), Positives = 427/443 (96%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPPARV RKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVVRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>gb|AAK50114.1|AF372977_1 At2g20140/T2G17.6 [Arabidopsis thaliana]
Length=443

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        +KK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSV+KVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVVKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_010433142.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Camelina 
sativa]
 ref|XP_010447896.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Camelina 
sativa]
Length=444

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/444 (94%), Positives = 428/444 (96%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGd-rknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQG  GGLNRQ         DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP T
Sbjct  1     MGQGPSGGLNRQGDRKPDGGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPST  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT++MTL+DDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTSKMTLSDDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   PDFKKAKEKVMFKKKEGVPEGLYM  444



>gb|KJB26079.1| hypothetical protein B456_004G224000 [Gossypium raimondii]
Length=423

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/420 (96%), Positives = 410/420 (98%), Gaps = 3/420 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ  PGDRK    DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGFPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
              TKCKLRLLKLER+KDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    HTKCKLRLLKLERVKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420



>ref|XP_009129033.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Brassica 
rapa]
 emb|CDY35245.1| BnaA01g07860D [Brassica napus]
Length=443

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPP+RVGRKQR+QKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDKKPDGGDKKEKKFEPAAPPSRVGRKQRRQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_006408928.1| hypothetical protein EUTSA_v10001985mg [Eutrema salsugineum]
 gb|ESQ50381.1| hypothetical protein EUTSA_v10001985mg [Eutrema salsugineum]
Length=443

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/443 (93%), Positives = 427/443 (96%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        +KK+KKFEPAAPPARVGRKQRK KG EAA+RLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDRKPDGGEKKEKKFEPAAPPARVGRKQRKLKGPEAASRLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLK+ERIKDYLLMEEEFV+NQERLKPQE+K EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKMERIKDYLLMEEEFVSNQERLKPQEDKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>emb|CDY06847.1| BnaC01g09460D [Brassica napus]
Length=443

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNRQ        DKK+KKFEPAAPP+RVGRKQR+QKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRQGDKKPDGGDKKEKKFEPAAPPSRVGRKQRRQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDA+GTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAIGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_001769084.1| predicted protein [Physcomitrella patens]
 gb|EDQ66162.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/446 (92%), Positives = 428/446 (96%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPG---drknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG  GGL +Q PG    + +  KK+KK+EPAAPP+RVGRKQRKQKGSEAAARLP VTP
Sbjct  1     MGQGQSGGLPKQGPGGDRTKGDGGKKEKKYEPAAPPSRVGRKQRKQKGSEAAARLPVVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
              TKCKLRLLKLER+KDYLLMEEEFV NQERLKPQE+K EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    ATKCKLRLLKLERVKDYLLMEEEFVTNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             +IDENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM
Sbjct  121   IIDENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLD QIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDPQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPTIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFD+RGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDARGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKT+RRIFQIHT+RMT+ADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTKRRIFQIHTSRMTMADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             T  DFKKAK+KVM+KKKEGVPEGLYM
Sbjct  421   TQVDFKKAKEKVMYKKKEGVPEGLYM  446



>ref|XP_002320617.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa]
 gb|EEE98932.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa]
Length=423

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/420 (96%), Positives = 410/420 (98%), Gaps = 2/420 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG  GGLNRQLPGDRK    DKKDKKFEPAAPP RVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGPSGGLNRQLPGDRKQDGSDKKDKKFEPAAPPVRVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVG+LEEL
Sbjct  61    TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKVEEDRSKVDDLRGSPMSVGSLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             V+KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VDKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDA+GTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAIGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IE+LDPALLRPGRIDRKIEFPL
Sbjct  301   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIETLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV+
Sbjct  361   PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVS  420



>gb|KDP43828.1| hypothetical protein JCGZ_23036 [Jatropha curcas]
Length=436

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/417 (97%), Positives = 413/417 (99%), Gaps = 0/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EPAAPP+RVGRKQRKQKG EAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE
Sbjct  20    YEPAAPPSRVGRKQRKQKGPEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  79

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKP EEK EEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYV ILSFVDKDQ
Sbjct  80    RLKPLEEKNEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVGILSFVDKDQ  139

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL
Sbjct  140   LEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  199

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG
Sbjct  200   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  259

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG
Sbjct  260   PKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  319

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHT+RMTLADDVNLEEF
Sbjct  320   DVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEF  379

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAK+KVMFKKKEGVPEGLY+
Sbjct  380   VMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMFKKKEGVPEGLYL  436



>ref|XP_010438356.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Camelina sativa]
Length=444

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/444 (93%), Positives = 427/444 (96%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGd-rknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQG  GGLNRQ         DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP T
Sbjct  1     MGQGPSGGLNRQGDRKPDGGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPST  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             A SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AQSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DIKTRRRIFQIHT++MTL+DDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  361   DIKTRRRIFQIHTSKMTLSDDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   PDFKKAKEKVMFKKKEGVPEGLYM  444



>gb|AAM65126.1| 26S proteasome subunit 4 [Arabidopsis thaliana]
Length=443

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/443 (93%), Positives = 427/443 (96%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGL+RQ        +KK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLHRQGDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSI FIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIGFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>emb|CAC14432.1| 26S proteasome subunit 4-like protein [Brassica napus]
 emb|CDX92914.1| BnaC07g41720D [Brassica napus]
Length=443

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/443 (93%), Positives = 428/443 (97%), Gaps = 0/443 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG  GGLNR        ++KK+KKFEPAAPP+RVGRKQRKQKG EAAARLPTVTP TK
Sbjct  1     MGQGPSGGLNRPGDRKPDGNEKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPSTK  60

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELID
Sbjct  61    CKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID  120

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             ENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVE
Sbjct  121   ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE  180

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
Sbjct  181   KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  240

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA
Sbjct  241   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA  300

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPD
Sbjct  301   NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD  360

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             IKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH 
Sbjct  361   IKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP  420

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   DFKKAKEKVMFKKKEGVPEGLYM  443



>ref|XP_009109057.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Brassica rapa]
 emb|CDY14224.1| BnaA08g13550D [Brassica napus]
Length=445

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/445 (92%), Positives = 429/445 (96%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdr--knddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG  GGLNRQ    +     DKK+KKFEPAAPP+RVGRKQRKQ+G EAAARLPTVTP 
Sbjct  1     MGQGPSGGLNRQGGDRKPDGGGDKKEKKFEPAAPPSRVGRKQRKQRGPEAAARLPTVTPS  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61    TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV I+SFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGIMSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DA+SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DANSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HPDFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_001752421.1| predicted protein [Physcomitrella patens]
 gb|EDQ82660.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/446 (92%), Positives = 429/446 (96%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPG---drknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG  GGL +Q PG   ++ N +KK+KK++P APP RVGRKQRKQKGSEAAARLP VTP
Sbjct  1     MGQGQSGGLPKQGPGGDRNKGNGEKKEKKYDPPAPPTRVGRKQRKQKGSEAAARLPVVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
              TKCKLRLLKL+R+KDYLLMEEEFV NQERLKPQE+K EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    ATKCKLRLLKLDRVKDYLLMEEEFVTNQERLKPQEDKNEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             +IDENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM
Sbjct  121   IIDENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLD QIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDPQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPTIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFD+RGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDARGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKT+RRIFQIHT+RMT+ADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDIKTKRRIFQIHTSRMTMADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             T ADFKKAKDKVM+KKKEGVPEGLYM
Sbjct  421   TQADFKKAKDKVMYKKKEGVPEGLYM  446



>ref|XP_001754191.1| predicted protein [Physcomitrella patens]
 gb|EDQ81092.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/417 (95%), Positives = 409/417 (98%), Gaps = 0/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EPAAPP RVGRKQRKQKGSEAAARLP VTP TKCKLRLLKLER+KDYLLMEEEFV NQE
Sbjct  30    YEPAAPPTRVGRKQRKQKGSEAAARLPVVTPATKCKLRLLKLERVKDYLLMEEEFVTNQE  89

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQE+K EEDRSKVDDLRGSPMSVGNLEE+IDENHAIVSSSVGPEYYV+ILSFVDKDQ
Sbjct  90    RLKPQEDKNEEDRSKVDDLRGSPMSVGNLEEIIDENHAIVSSSVGPEYYVNILSFVDKDQ  149

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLD QIQEIKEAVEL
Sbjct  150   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDPQIQEIKEAVEL  209

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG
Sbjct  210   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  269

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG
Sbjct  270   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  329

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKT+RRIFQIHT+RMT+ADDVNLEEF
Sbjct  330   DVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTKRRIFQIHTSRMTMADDVNLEEF  389

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VMTKDEFSGADIKAICTEAGLLALRERRMKVT  DFKKAK+KVM+KKKEGVPEGLYM
Sbjct  390   VMTKDEFSGADIKAICTEAGLLALRERRMKVTQVDFKKAKEKVMYKKKEGVPEGLYM  446



>gb|KEH23989.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=425

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/420 (96%), Positives = 412/420 (98%), Gaps = 4/420 (1%)
 Frame = +1

Query  52    MGQGTPGG-LNRQLPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGG LNRQ PGDRK   +DKKDKKFEPAAPPARVGRKQRKQKGSEAA+RLPTVTP
Sbjct  1     MGQGTPGGGLNRQ-PGDRKPDGNDKKDKKFEPAAPPARVGRKQRKQKGSEAASRLPTVTP  59

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  60    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  119

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  120   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  179

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  180   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  239

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  240   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  299

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  300   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  359

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIF IHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK+
Sbjct  360   LPDIKTRRRIFTIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKL  419



>emb|CDX97472.1| BnaC08g13370D [Brassica napus]
Length=445

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/445 (92%), Positives = 428/445 (96%), Gaps = 2/445 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdr--knddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG  GGLNRQ    +     DKK+KKFEPAAPP+RVGRKQRKQKG EAAARLP VTP 
Sbjct  1     MGQGPSGGLNRQGGDRKPDGGGDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPAVTPS  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLK+ERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEEL
Sbjct  61    TKCKLRLLKMERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEEL  120

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV I+SFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMK
Sbjct  121   IDENHAIVSSSVGPEYYVGIMSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMK  180

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  181   VEKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  240

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  241   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  300

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DA+SGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  301   DANSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  360

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  361   PDIKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  420

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   HPDFKKAKEKVMFKKKEGVPEGLYM  445



>ref|XP_010684990.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/446 (93%), Positives = 427/446 (96%), Gaps = 4/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrknddkkdkkFE-PAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQ +  GLNRQ   PGDRK D  K  K   P APPARVGRKQRKQKG +AAAR+P VTP
Sbjct  1     MGQNS-SGLNRQGGPPGDRKQDGDKKDKKYDPPAPPARVGRKQRKQKGPDAAARIPVVTP  59

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLER+KDYLLMEEEFVANQERLKPQEEKTEEDRSKVDD+RGSPMSVG+LEE
Sbjct  60    LTKCKLRLLKLERVKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDIRGSPMSVGSLEE  119

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  120   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGLLQDEVDPMVSVM  179

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTL
Sbjct  180   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTL  239

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  240   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  299

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP
Sbjct  300   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  359

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIF IHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  360   LPDIKTRRRIFTIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  419

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAKDKVMFKKKEGVPEGLYM
Sbjct  420   THADFKKAKDKVMFKKKEGVPEGLYM  445



>dbj|BAA04615.1| rice homologue of Tat binding protein [Oryza sativa Japonica 
Group]
Length=448

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/448 (92%), Positives = 433/448 (97%), Gaps = 5/448 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrk---nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTV  216
             MGQGTPGG+ +Q   PGDRK   + DKKD+KFEP+A P+RVGRKQRKQKG EAAARLP V
Sbjct  1     MGQGTPGGMGKQGGAPGDRKPGGDGDKKDRKFEPSAAPSRVGRKQRKQKGPEAAARLPNV  60

Query  217   TPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNL  396
              PL+KC+LRLLKLER+KDYLLMEEEFVA QERL+P E+KTEEDRSKVDDLRG+PMSVG+L
Sbjct  61    APLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPTEDKTEEDRSKVDDLRGTPMSVGSL  120

Query  397   EELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVS  576
             EE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVS
Sbjct  121   EEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVS  180

Query  577   VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGK  756
             VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGK
Sbjct  181   VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGK  240

Query  757   TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT  936
             TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT
Sbjct  241   TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT  300

Query  937   KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIE  1116
             KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIE
Sbjct  301   KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIE  360

Query  1117  FPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM  1296
             FPLPDIKTRRRIFQIHT++MTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM
Sbjct  361   FPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM  420

Query  1297  KVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             KVTHADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   KVTHADFKKAKEKVMFKKKEGVPEGLYM  448



>ref|NP_001049843.1| Os03g0298400 [Oryza sativa Japonica Group]
 ref|XP_006649937.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Oryza brachyantha]
 dbj|BAB78491.1| 26S proteasome regulatory particle triple-A ATPase subunit2b 
[Oryza sativa Japonica Group]
 gb|ABF95461.1| 26S protease regulatory subunit 4, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11757.1| Os03g0298400 [Oryza sativa Japonica Group]
 dbj|BAG91617.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/450 (90%), Positives = 429/450 (95%), Gaps = 7/450 (2%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-------LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLP  210
             MGQGTPGG+ +Q        PGD    DKKD+KFEP A P+RVGRKQRKQKG EAAARLP
Sbjct  1     MGQGTPGGMGKQGGLPGDRKPGDGGAGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLP  60

Query  211   TVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVG  390
              V PL+KC+LRLLKLER+KDYLLMEEEFV +QERL+P E+KTEEDRSKVDDLRG+PMSVG
Sbjct  61    AVAPLSKCRLRLLKLERVKDYLLMEEEFVVSQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  391   NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPM  570
             +LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPM
Sbjct  121   SLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPM  180

Query  571   VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGT  750
             VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGT
Sbjct  181   VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGT  240

Query  751   GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAV  930
             GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAV
Sbjct  241   GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAV  300

Query  931   GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRK  1110
             GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRK
Sbjct  301   GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRK  360

Query  1111  IEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER  1290
             IEFPLPDIKTRRRIFQIHT++MTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER
Sbjct  361   IEFPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER  420

Query  1291  RMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             RMKVTHADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   RMKVTHADFKKAKEKVMFKKKEGVPEGLYM  450



>ref|NP_001060719.1| Os07g0691800 [Oryza sativa Japonica Group]
 ref|XP_006658170.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Oryza brachyantha]
 sp|P46466.2|PRS4_ORYSJ RecName: Full=26S protease regulatory subunit 4 homolog; AltName: 
Full=Tat-binding protein homolog 2 [Oryza sativa Japonica 
Group]
 dbj|BAC75555.1| 26S proteasome regulatory subunit 4 homolog [Oryza sativa Japonica 
Group]
 dbj|BAF22633.1| Os07g0691800 [Oryza sativa Japonica Group]
 gb|EAY95233.1| hypothetical protein OsI_17051 [Oryza sativa Indica Group]
 dbj|BAG94028.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97398.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86657.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/448 (92%), Positives = 432/448 (96%), Gaps = 5/448 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrk---nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTV  216
             MGQGTPGG+ +Q   PGDRK   + DKKD+KFEP A P+RVGRKQRKQKG EAAARLP V
Sbjct  1     MGQGTPGGMGKQGGAPGDRKPGGDGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLPNV  60

Query  217   TPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNL  396
              PL+KC+LRLLKLER+KDYLLMEEEFVA QERL+P E+KTEEDRSKVDDLRG+PMSVG+L
Sbjct  61    APLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPTEDKTEEDRSKVDDLRGTPMSVGSL  120

Query  397   EELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVS  576
             EE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVS
Sbjct  121   EEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVS  180

Query  577   VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGK  756
             VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGK
Sbjct  181   VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGK  240

Query  757   TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT  936
             TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT
Sbjct  241   TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT  300

Query  937   KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIE  1116
             KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIE
Sbjct  301   KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIE  360

Query  1117  FPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM  1296
             FPLPDIKTRRRIFQIHT++MTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM
Sbjct  361   FPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM  420

Query  1297  KVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             KVTHADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   KVTHADFKKAKEKVMFKKKEGVPEGLYM  448



>ref|XP_002966632.1| hypothetical protein SELMODRAFT_267030 [Selaginella moellendorffii]
 ref|XP_002978110.1| hypothetical protein SELMODRAFT_271301 [Selaginella moellendorffii]
 gb|EFJ20767.1| hypothetical protein SELMODRAFT_271301 [Selaginella moellendorffii]
 gb|EFJ32659.1| hypothetical protein SELMODRAFT_267030 [Selaginella moellendorffii]
Length=444

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/445 (92%), Positives = 428/445 (96%), Gaps = 3/445 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG   G  RQ   PGDR+ +DKK+KK+EPAAPP RVGRKQRKQKG EAAARLP VTP 
Sbjct  1     MGQGQ-SGFPRQGGPPGDRRQEDKKEKKYEPAAPPTRVGRKQRKQKGPEAAARLPFVTPA  59

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             TKCKLRLLKLER+KDYLLMEEE+V NQERLKPQE+K EEDRSKVDDLRGSPMSVG+LEE+
Sbjct  60    TKCKLRLLKLERVKDYLLMEEEYVTNQERLKPQEDKNEEDRSKVDDLRGSPMSVGSLEEI  119

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV+ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  120   IDENHAIVSSSVGPEYYVNILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  179

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQ+QEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  180   VEKAPLESYADIGGLDAQVQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  239

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  240   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  299

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFD+RGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  300   DAHSGGEREIQRTMLELLNQLDGFDARGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  359

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTL+DDVN EEFVMTKDEFSGADIKA+CTEAGLLALRERRMKVT
Sbjct  360   PDIKTRRRIFQIHTSRMTLSDDVNFEEFVMTKDEFSGADIKAMCTEAGLLALRERRMKVT  419

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
              ADFKKAK+KVM+KKKEGVPEGLYM
Sbjct  420   QADFKKAKEKVMYKKKEGVPEGLYM  444



>ref|NP_001146268.1| uncharacterized protein LOC100279843 [Zea mays]
 gb|ACL53605.1| unknown [Zea mays]
 tpg|DAA44915.1| TPA: 26S protease regulatory subunit 4 [Zea mays]
Length=446

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/446 (91%), Positives = 434/446 (97%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrkndd-kkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG+PGG+ +Q  LPGDRK  D KK+KK+EP A P+RVGRKQ++QKGSEAAARLP V P
Sbjct  1     MGQGSPGGMGKQPGLPGDRKQGDGKKEKKYEPPAAPSRVGRKQKRQKGSEAAARLPAVAP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KC+LRLLKLER+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRG+PM+VG+LEE
Sbjct  61    LSKCRLRLLKLERVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMNVGSLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             +IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  121   IIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPD+KTRRRIFQIHT++MTLADDVNLEEF+M+KDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDVKTRRRIFQIHTSKMTLADDVNLEEFIMSKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_006412885.1| hypothetical protein EUTSA_v10026925mg, partial [Eutrema salsugineum]
 gb|ESQ54338.1| hypothetical protein EUTSA_v10026925mg, partial [Eutrema salsugineum]
Length=589

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/481 (86%), Positives = 429/481 (89%), Gaps = 37/481 (8%)
 Frame = +1

Query  49    IMGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             IMGQG  GGLNRQ        DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP T
Sbjct  109   IMGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPST  168

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRG+PMSVGNLEELI
Sbjct  169   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELI  228

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKV
Sbjct  229   DENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKV  288

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  289   EKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  348

Query  769   K-------------------------------------AVANSTSATFLRVVGSELIQKY  837
             K                                     AVANSTSATFLRVVGSELIQKY
Sbjct  349   KVCLSTFNLMIIGAYTKYSLVHYLQSHLRSLGCSVESRAVANSTSATFLRVVGSELIQKY  408

Query  838   LGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1017
             LGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  409   LGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  468

Query  1018  DSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVN  1197
             DSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHT++MTL++DVN
Sbjct  469   DSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLSEDVN  528

Query  1198  LEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLY  1377
             LEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH DFKKAK+KVMFKKKEGVPEGLY
Sbjct  529   LEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHPDFKKAKEKVMFKKKEGVPEGLY  588

Query  1378  M  1380
             M
Sbjct  589   M  589



>gb|EMS67713.1| 26S protease regulatory subunit 4-like protein [Triticum urartu]
Length=450

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/450 (90%), Positives = 431/450 (96%), Gaps = 7/450 (2%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-------LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLP  210
             MGQG+PGG+ +Q        PGD    DKKDKKFEP A P+RVGRKQRKQ+G EAAARLP
Sbjct  1     MGQGSPGGMGKQGGLPGDRKPGDGAAGDKKDKKFEPPAAPSRVGRKQRKQRGPEAAARLP  60

Query  211   TVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVG  390
              V PL+KC+LRLLKL+R+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRG+PMSVG
Sbjct  61    PVAPLSKCRLRLLKLDRVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  391   NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPM  570
             +LEE+IDE+HAIVSSSVGPEYYVS+LSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPM
Sbjct  121   SLEEIIDESHAIVSSSVGPEYYVSVLSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPM  180

Query  571   VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGT  750
             VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGT
Sbjct  181   VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGT  240

Query  751   GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAV  930
             GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAV
Sbjct  241   GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAV  300

Query  931   GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRK  1110
             GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRK
Sbjct  301   GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRK  360

Query  1111  IEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER  1290
             IEFPLPDIKTRRRIFQIHTA+MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRER
Sbjct  361   IEFPLPDIKTRRRIFQIHTAKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER  420

Query  1291  RMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             RMKVTHADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   RMKVTHADFKKAKEKVMFKKKEGVPEGLYM  450



>ref|XP_004984889.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Setaria 
italica]
Length=447

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/447 (90%), Positives = 433/447 (97%), Gaps = 4/447 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrk--nddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVT  219
             MGQGTPGG+ +Q  LPGDRK  +  KKDKK+EP A P+RVGR+Q++QKGSEAAARLP V 
Sbjct  1     MGQGTPGGMGKQGGLPGDRKPGDGGKKDKKYEPPAAPSRVGRRQKRQKGSEAAARLPAVA  60

Query  220   PLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLE  399
             PL+KC+LRLLKLER+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRG+PMSVG+LE
Sbjct  61    PLSKCRLRLLKLERVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMSVGSLE  120

Query  400   ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  579
             E+IDE+HAIVSSSVGPEYYV ++SFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSV
Sbjct  121   EIIDESHAIVSSSVGPEYYVGVMSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSV  180

Query  580   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  759
             MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKT
Sbjct  181   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKT  240

Query  760   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK  939
             LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTK
Sbjct  241   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTK  300

Query  940   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEF  1119
             RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEF
Sbjct  301   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEF  360

Query  1120  PLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  1299
             PLPD+KTRRRIFQIHT++MTLADDVNLEEF+M+KDEFSGADIKAICTEAGLLALRERRMK
Sbjct  361   PLPDVKTRRRIFQIHTSKMTLADDVNLEEFIMSKDEFSGADIKAICTEAGLLALRERRMK  420

Query  1300  VTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VTH DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   VTHVDFKKAKEKVMFKKKEGVPEGLYM  447



>ref|XP_003558120.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Brachypodium 
distachyon]
Length=450

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/450 (90%), Positives = 429/450 (95%), Gaps = 7/450 (2%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-------LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLP  210
             MGQGTPGG+ +Q        PGD    DKKDKKFEP A P+RVGRKQR+QKG + AARLP
Sbjct  1     MGQGTPGGMGKQGGLPGDRKPGDGNAGDKKDKKFEPPAAPSRVGRKQRRQKGPDVAARLP  60

Query  211   TVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVG  390
              V PL+KC+LRLLKL+R+KDYLLMEEEFV +QERL+P E+KTEEDRSKVDDLRG+PMSVG
Sbjct  61    PVAPLSKCRLRLLKLDRVKDYLLMEEEFVVSQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  391   NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPM  570
             +LEE+IDE+HAIVSSSVGPEYYVSILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPM
Sbjct  121   SLEEIIDESHAIVSSSVGPEYYVSILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPM  180

Query  571   VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGT  750
             VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGT
Sbjct  181   VSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGT  240

Query  751   GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAV  930
             GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAV
Sbjct  241   GKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAV  300

Query  931   GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRK  1110
             GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRK
Sbjct  301   GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRK  360

Query  1111  IEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER  1290
             IEFPLPDIKTRRRIFQIHTA+MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRER
Sbjct  361   IEFPLPDIKTRRRIFQIHTAKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRER  420

Query  1291  RMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             RMKVTHADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   RMKVTHADFKKAKEKVMFKKKEGVPEGLYM  450



>gb|AAL73395.1|AF432345_1 26S proteasome regulatory subunit IV [Syntrichia ruralis]
Length=446

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/446 (91%), Positives = 422/446 (95%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknd---dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG  GGL +Q PG  +N     KK+KK+EPAAPP RVGRKQRKQKGSEAAARLP VTP
Sbjct  1     MGQGQSGGLPKQGPGGERNKGDGQKKEKKYEPAAPPTRVGRKQRKQKGSEAAARLPVVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
              TKC LRLLKL+R KDYLLM+EEFV  Q+RL PQE+KTE+DRSKVDDLRGSPMSVGNLEE
Sbjct  61    ATKCNLRLLKLDRAKDYLLMKEEFVRTQKRLNPQEDKTEKDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             +IDENHAIVSSSVGPEYYV+ILSFVDKDQ  PGCAILMHNKVLSVVGLLQDDVDPMVSVM
Sbjct  121   IIDENHAIVSSSVGPEYYVNILSFVDKDQPGPGCAILMHNKVLSVVGLLQDDVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLD QIQEIKEAVELPLTHPELYEDIGIKP KGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDPQIQEIKEAVELPLTHPELYEDIGIKPLKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVFIDEIDA+GTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPTIVFIDEIDAIGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPD KTRRRIFQIHT+RMT+ADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDTKTRRRIFQIHTSRMTMADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVM+KKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMYKKKEGVPEGLYM  446



>dbj|BAK03283.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/449 (91%), Positives = 429/449 (96%), Gaps = 6/449 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrkn----ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPT  213
             MGQGTPGG+ +    PGDR       DKKDKKFEP A P+RVGRKQR+QKG EAAARLP 
Sbjct  1     MGQGTPGGMGKPGGAPGDRNKPGGDGDKKDKKFEPPAAPSRVGRKQRRQKGPEAAARLPN  60

Query  214   VTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGN  393
             V PL+KC+LRLLKL+R+KDYLLMEEEFVA QERL+P EEKTEEDRSKVDDLRG+PMSVG+
Sbjct  61    VAPLSKCRLRLLKLDRVKDYLLMEEEFVAAQERLRPTEEKTEEDRSKVDDLRGTPMSVGS  120

Query  394   LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  573
             LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMV
Sbjct  121   LEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV  180

Query  574   SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTG  753
             SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTG
Sbjct  181   SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTG  240

Query  754   KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG  933
             KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG
Sbjct  241   KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG  300

Query  934   TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKI  1113
             TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKI
Sbjct  301   TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKI  360

Query  1114  EFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERR  1293
             EFPLPDIKTRRRIFQIHTA+MTL+DDVNLEEFVMTKDEFSGADIKAICTE+GLLALRERR
Sbjct  361   EFPLPDIKTRRRIFQIHTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALRERR  420

Query  1294  MKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             MKVTHADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   MKVTHADFKKAKEKVMFKKKEGVPEGLYM  449



>gb|ACG31403.1| 26S protease regulatory subunit 4 [Zea mays]
Length=446

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/446 (90%), Positives = 431/446 (97%), Gaps = 3/446 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrkndd-kkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG+PGG+ +Q  LPGDRK  D KK+KK+EP A P+RVGRKQ++QKGSEAAARLP V P
Sbjct  1     MGQGSPGGMGKQPGLPGDRKQGDGKKEKKYEPPAAPSRVGRKQKRQKGSEAAARLPAVAP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KC+LRLLKLER+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRG+PM+VG+LEE
Sbjct  61    LSKCRLRLLKLERVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMNVGSLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             +IDE HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVG+LQD+VDPMVSVM
Sbjct  121   IIDETHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGILQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSR DVKVILATN+IESLDPA LRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRVDVKVILATNRIESLDPAXLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPD+KTRRRIFQIHT++MTLADDVNLEEF+M+KDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  361   LPDVKTRRRIFQIHTSKMTLADDVNLEEFIMSKDEFSGADIKAICTEAGLLALRERRMKV  420

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  421   THADFKKAKEKVMFKKKEGVPEGLYM  446



>ref|XP_002463440.1| hypothetical protein SORBIDRAFT_02g043840 [Sorghum bicolor]
 gb|EER99961.1| hypothetical protein SORBIDRAFT_02g043840 [Sorghum bicolor]
Length=447

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/417 (94%), Positives = 410/417 (98%), Gaps = 0/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP A P+RVGRKQRKQKG+EAAARLP V PL+KC+LRLLKLER+KDYLLMEEEFVA QE
Sbjct  31    FEPPAAPSRVGRKQRKQKGAEAAARLPNVAPLSKCRLRLLKLERVKDYLLMEEEFVAAQE  90

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RL+PQE+K EEDRSKVDDLRG+PMSVG+LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQ
Sbjct  91    RLRPQEDKAEEDRSKVDDLRGTPMSVGSLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQ  150

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL
Sbjct  151   LEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  210

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYEDIGI+PPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG
Sbjct  211   PLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  270

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG
Sbjct  271   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  330

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTA+MTLADDVNLEEF
Sbjct  331   DVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTAKMTLADDVNLEEF  390

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAK+KVM+KKKEGVP+GLYM
Sbjct  391   VMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMYKKKEGVPDGLYM  447



>ref|XP_004958786.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Setaria 
italica]
Length=447

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/449 (89%), Positives = 426/449 (95%), Gaps = 8/449 (2%)
 Frame = +1

Query  52    MGQGTPGGLNR------QLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPT  213
             MGQGTPGG+ +      + PGD  +   K   FEP A P+RVGRKQRKQKG+EAAARLP 
Sbjct  1     MGQGTPGGMGKQGGAGDRKPGDGADKKDKK--FEPPAAPSRVGRKQRKQKGAEAAARLPN  58

Query  214   VTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGN  393
             V PL+KC+LRLLKLER+KDYLLMEEEFVA QERL+PQE+K EEDRSKVDDLRG+PMSVG+
Sbjct  59    VAPLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPQEDKAEEDRSKVDDLRGTPMSVGS  118

Query  394   LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  573
             LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMV
Sbjct  119   LEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV  178

Query  574   SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTG  753
             SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTG
Sbjct  179   SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTG  238

Query  754   KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG  933
             KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG
Sbjct  239   KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG  298

Query  934   TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKI  1113
             TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKI
Sbjct  299   TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKI  358

Query  1114  EFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERR  1293
             EFPLPDIKTRRRIFQIHT++MTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERR
Sbjct  359   EFPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERR  418

Query  1294  MKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             MKVTHADFKKAK+KVM+KKKEGVP+GLYM
Sbjct  419   MKVTHADFKKAKEKVMYKKKEGVPDGLYM  447



>ref|XP_008653527.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Zea mays]
 tpg|DAA64239.1| TPA: hypothetical protein ZEAMMB73_409330 [Zea mays]
Length=447

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/449 (89%), Positives = 426/449 (95%), Gaps = 8/449 (2%)
 Frame = +1

Query  52    MGQGTPGGLNR------QLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPT  213
             MGQGTPGG+ +      + PGD  +   K   FEP A P+RVGRKQRKQKG+EAAARLP 
Sbjct  1     MGQGTPGGMGKQGGAGDRKPGDAGDKKDKK--FEPPAAPSRVGRKQRKQKGAEAAARLPN  58

Query  214   VTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGN  393
             V PL+KC+LRLLKL+R+KDYLLMEEEFVA QERL+PQE+K EEDRSKVDDLRG+PMSVG+
Sbjct  59    VAPLSKCRLRLLKLDRVKDYLLMEEEFVAAQERLRPQEDKAEEDRSKVDDLRGTPMSVGS  118

Query  394   LEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMV  573
             LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMV
Sbjct  119   LEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV  178

Query  574   SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTG  753
             SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTG
Sbjct  179   SVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTG  238

Query  754   KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG  933
             KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG
Sbjct  239   KTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVG  298

Query  934   TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKI  1113
             TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKI
Sbjct  299   TKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKI  358

Query  1114  EFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERR  1293
             EFPLPDIKTRRRIFQIHT++MTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERR
Sbjct  359   EFPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERR  418

Query  1294  MKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             MKVTHADFKKAK+KVM+KKKEGVP+GLYM
Sbjct  419   MKVTHADFKKAKEKVMYKKKEGVPDGLYM  447



>ref|XP_010233630.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Brachypodium 
distachyon]
Length=450

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/452 (88%), Positives = 423/452 (94%), Gaps = 11/452 (2%)
 Frame = +1

Query  52    MGQGTPGGL---------NRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAAR  204
             MGQGTPGG+         +R  PG   +   +   FEP A P+RVGRKQR+QKG EAAAR
Sbjct  1     MGQGTPGGMGKQGGGAPGDRNKPGGDGDKKDRK--FEPPAAPSRVGRKQRRQKGPEAAAR  58

Query  205   LPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMS  384
             LP V PL+KC+LRLLKLER+KDYLLMEEEFVA QERL+P EEKTEEDRSKVDDLRG+PMS
Sbjct  59    LPHVAPLSKCRLRLLKLERVKDYLLMEEEFVAAQERLRPTEEKTEEDRSKVDDLRGTPMS  118

Query  385   VGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVD  564
             VG+LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VD
Sbjct  119   VGSLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVD  178

Query  565   PMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEP  744
             PMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEP
Sbjct  179   PMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEP  238

Query  745   GTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEID  924
             GTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEID
Sbjct  239   GTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEID  298

Query  925   AVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRID  1104
             AVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRID
Sbjct  299   AVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRID  358

Query  1105  RKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALR  1284
             RKIEFPLPDIKTRRRIFQIHTA+MTL+DDVNLEEFVMTKDEFSGADIKAICTE+GLLALR
Sbjct  359   RKIEFPLPDIKTRRRIFQIHTAKMTLSDDVNLEEFVMTKDEFSGADIKAICTESGLLALR  418

Query  1285  ERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ERRMKV HADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  419   ERRMKVMHADFKKAKEKVMFKKKEGVPEGLYM  450



>gb|KCW58093.1| hypothetical protein EUGRSUZ_H00817 [Eucalyptus grandis]
Length=402

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/402 (96%), Positives = 393/402 (98%), Gaps = 1/402 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrkn-ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQGTPGGLNRQ    +++  DKK+KKFEPAAPP+RVGRKQRKQKG EAAARLPTVTPLT
Sbjct  1     MGQGTPGGLNRQSGDRKQDGSDKKEKKFEPAAPPSRVGRKQRKQKGPEAAARLPTVTPLT  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFV NQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEELI
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVTNQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA
Sbjct  181   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAI  1254
             DIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAI
Sbjct  361   DIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAI  402



>gb|KJB18718.1| hypothetical protein B456_003G066800 [Gossypium raimondii]
Length=424

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/446 (92%), Positives = 416/446 (93%), Gaps = 25/446 (6%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK    +KK+KKFEPAAPPARVGRKQRKQKG E          
Sbjct  1     MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPE----------  50

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
                         RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  51    ------------RIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  98

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  99    LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  158

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  159   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  218

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  219   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  278

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  279   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  338

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  339   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  398

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  399   THADFKKAKEKVMFKKKEGVPEGLYM  424



>emb|CBI37252.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/445 (91%), Positives = 411/445 (92%), Gaps = 29/445 (7%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd-dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPL  225
             MGQG  GGLNRQ LPGDRKND DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTPL
Sbjct  1     MGQGASGGLNRQGLPGDRKNDGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPL  60

Query  226   TKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  405
             +K                           LKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL
Sbjct  61    SK---------------------------LKPQEEKTEEDRSKVDDLRGSPMSVGNLEEL  93

Query  406   IDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMK  585
             IDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMK
Sbjct  94    IDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMK  153

Query  586   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  765
             VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL
Sbjct  154   VEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLL  213

Query  766   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRY  945
             AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRY
Sbjct  214   AKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRY  273

Query  946   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPL  1125
             DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPL
Sbjct  274   DAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPL  333

Query  1126  PDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  1305
             PDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT
Sbjct  334   PDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVT  393

Query  1306  HadfkkakdkvmfkkkEGVPEGLYM  1380
             H DFKKAK+KVMFKKKEGVPEGLYM
Sbjct  394   HVDFKKAKEKVMFKKKEGVPEGLYM  418



>gb|EMT04844.1| 26S protease regulatory subunit 4-like protein [Aegilops tauschii]
Length=655

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/456 (83%), Positives = 403/456 (88%), Gaps = 37/456 (8%)
 Frame = +1

Query  52    MGQGTPGGLNRQ--LPGdrknddkkdkkFE-----PAAPPARVGRKQRKQKGSEAAARLP  210
             MGQG+PGG+ +Q  LPGDR        K +     P A P+RVGRKQRKQ+G EAAARLP
Sbjct  1     MGQGSPGGMGKQGGLPGDRTRAGGAPAKKKDRKSGPPAAPSRVGRKQRKQRGPEAAARLP  60

Query  211   TVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVG  390
              V PL+KC+LRLLKL+R+KDYLLMEEEFVA+QERL+P E+KTEEDRSKVDDLRG+PMSVG
Sbjct  61    PVAPLSKCRLRLLKLDRVKDYLLMEEEFVASQERLRPSEDKTEEDRSKVDDLRGTPMSVG  120

Query  391   NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK---------------  525
             +LEE+IDE+HAIVSSSVGPEYYVS+LSFVDKDQLEPGC+ILMHNK               
Sbjct  121   SLEEIIDESHAIVSSSVGPEYYVSVLSFVDKDQLEPGCSILMHNKLGHFDDIETCGMGAM  180

Query  526   ---------------VLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEA  660
                            VLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEA
Sbjct  181   GQNMGIEMNVAIACSVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEA  240

Query  661   VELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYL  840
             VELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYL
Sbjct  241   VELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYL  300

Query  841   GDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD  1020
             GDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD
Sbjct  301   GDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD  360

Query  1021  SRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNL  1200
             SRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTA+MTLA+DVNL
Sbjct  361   SRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTAKMTLAEDVNL  420

Query  1201  EEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             EEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH
Sbjct  421   EEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  456



>gb|KJB18717.1| hypothetical protein B456_003G066800 [Gossypium raimondii]
Length=411

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/446 (89%), Positives = 403/446 (90%), Gaps = 38/446 (9%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK    +KK+KKFEPAAPPARVGRKQRKQKG E          
Sbjct  1     MGQGTPGGLNRQGLPGDRKGDGSNKKEKKFEPAAPPARVGRKQRKQKGPE----------  50

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
                         RIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  51    ------------RIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  98

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  99    LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  158

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  159   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  218

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTK 
Sbjct  219   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTK-  277

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
                         RTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  278   ------------RTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  325

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
             LPDIKTRRRIFQIHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  326   LPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  385

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  386   THADFKKAKEKVMFKKKEGVPEGLYM  411



>ref|XP_002959240.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ39700.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=444

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/444 (83%), Positives = 404/444 (91%), Gaps = 1/444 (0%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEA-AARLPTVTPLT  228
             MGQ   G      P D+K D +K KK+EP APP RVG+KQ+K+  + +  A+LPTV P  
Sbjct  1     MGQNQSGQGGTGAPNDQKKDQEKKKKYEPPAPPPRVGKKQKKRDTAASLGAKLPTVYPTA  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRLLKLERIKDYLLMEEEFV NQE+LKPQEE+ EEDRSKVDDLRG+P+SVG LEE+I
Sbjct  61    KCKLRLLKLERIKDYLLMEEEFVQNQEQLKPQEERNEEDRSKVDDLRGTPLSVGTLEEII  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAIVSSSVGPEYYV ILSFVDK QLEPGC++L+H K +SVVG+L D+ DPMVSVMKV
Sbjct  121   DENHAIVSSSVGPEYYVCILSFVDKTQLEPGCSVLLHYKSMSVVGILSDETDPMVSVMKV  180

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLESYAD+GGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYG+PGTGKTLLA
Sbjct  181   EKAPLESYADVGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGDPGTGKTLLA  240

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEL+PSIVFIDEIDA+GTKRY+
Sbjct  241   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELAPSIVFIDEIDAIGTKRYE  300

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             AHSGGEREIQRTMLELLNQLDGFDS  DVKVI+ATN+IESLDPAL+RPGRIDRKIEFPLP
Sbjct  301   AHSGGEREIQRTMLELLNQLDGFDSMSDVKVIMATNRIESLDPALIRPGRIDRKIEFPLP  360

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             D KT+RRIF IHT RMTL+DDVNLEEFVM KDE SGADIKA+CTEAGLLALRERRM+VT 
Sbjct  361   DAKTKRRIFGIHTGRMTLSDDVNLEEFVMAKDELSGADIKAVCTEAGLLALRERRMRVTQ  420

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
             ADF+KAK+KV++KKKEGVPEGLYM
Sbjct  421   ADFRKAKEKVLYKKKEGVPEGLYM  444



>gb|KFK40382.1| hypothetical protein AALP_AA3G366200 [Arabis alpina]
Length=376

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/376 (95%), Positives = 375/376 (99%), Gaps = 0/376 (0%)
 Frame = +1

Query  253   LERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVS  432
             +ERIKDYLLMEEEFV+NQERLKPQEEKTEEDRSKVDDLRG+PMSVGNLEELIDENHAIVS
Sbjct  1     MERIKDYLLMEEEFVSNQERLKPQEEKTEEDRSKVDDLRGTPMSVGNLEELIDENHAIVS  60

Query  433   SSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESY  612
             SSVGPEYYV+ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVEKAPLESY
Sbjct  61    SSVGPEYYVAILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESY  120

Query  613   ADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTS  792
             ADIGGL+AQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTS
Sbjct  121   ADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTS  180

Query  793   ATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGERE  972
             ATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDA+SGGERE
Sbjct  181   ATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDANSGGERE  240

Query  973   IQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRI  1152
             IQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRI
Sbjct  241   IQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRI  300

Query  1153  FQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakd  1332
             FQIHT++MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH DFKKAK+
Sbjct  301   FQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHPDFKKAKE  360

Query  1333  kvmfkkkEGVPEGLYM  1380
             KVMFKKKEGVPEGLYM
Sbjct  361   KVMFKKKEGVPEGLYM  376



>ref|XP_010548707.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
 ref|XP_010548708.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
Length=436

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/412 (88%), Positives = 387/412 (94%), Gaps = 0/412 (0%)
 Frame = +1

Query  145   PPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQ  324
             PPARVGRKQRK KG EAAARLPTVTP  KC LR LKLERI +YLLMEE+F+ +QERLKPQ
Sbjct  25    PPARVGRKQRKLKGPEAAARLPTVTPSAKCMLRFLKLERIIEYLLMEEDFIESQERLKPQ  84

Query  325   EEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGC  504
             EEK EEDRSKVDD+RG+PM VG L+ELIDENHAIVSSS   EYYV ILSFVDKDQLEPGC
Sbjct  85    EEKAEEDRSKVDDIRGTPMEVGKLKELIDENHAIVSSSHDREYYVGILSFVDKDQLEPGC  144

Query  505   AILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHP  684
             +ILMH+KV SVVG+LQD+VDPMVS+MKV KAP ESYADIGGL+ QIQEIKEAVELPLT P
Sbjct  145   SILMHSKVRSVVGILQDEVDPMVSMMKVVKAPSESYADIGGLEDQIQEIKEAVELPLTRP  204

Query  685   ELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVR  864
             ELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATF RVVGSELIQK+ GDGPKLVR
Sbjct  205   ELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFFRVVGSELIQKHSGDGPKLVR  264

Query  865   ELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVI  1044
             ELFRVAD+LSPSIVFIDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVI
Sbjct  265   ELFRVADDLSPSIVFIDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVI  324

Query  1045  LATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKD  1224
             LATN+IESLDPALLRPGRIDRKI FPLPDIKTRRRIFQIHT++MT+A+DVNLEEFVMTKD
Sbjct  325   LATNRIESLDPALLRPGRIDRKIRFPLPDIKTRRRIFQIHTSKMTMAEDVNLEEFVMTKD  384

Query  1225  EFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             EFSGADIKAICTEAGLLALR+RRMKVTH DFKKAK+KVMFKKKEGV EGLYM
Sbjct  385   EFSGADIKAICTEAGLLALRDRRMKVTHGDFKKAKEKVMFKKKEGVHEGLYM  436



>gb|EYU46362.1| hypothetical protein MIMGU_mgv1a023433mg [Erythranthe guttata]
Length=440

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/443 (83%), Positives = 404/443 (91%), Gaps = 5/443 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQG P GLNR      +K+ DKK+KKF+PAAPPARVGR+QRKQ+G  AAAR+P VTPL 
Sbjct  1     MGQGAPAGLNRPPRGEKKKDGDKKEKKFKPAAPPARVGRRQRKQRGYGAAARIPAVTPLA  60

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             KCKLRL+KL+RIKDYLLMEEEFV +QERL P+ EK   +RS++D  RGSPM VG L E+I
Sbjct  61    KCKLRLMKLDRIKDYLLMEEEFVTSQERLNPRLEKKAINRSRIDIFRGSPMRVGRLAEMI  120

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             DENHAI+S      YYV++LSFVDKDQLEPGC IL+H+K+LSVVGLLQDDVDPMVSVMKV
Sbjct  121   DENHAIISQG----YYVTVLSFVDKDQLEPGCKILLHDKLLSVVGLLQDDVDPMVSVMKV  176

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAPLE+YADIGGLDAQIQEIKEAVELPLTHPELYEDIG+KPPKGVILYGEPGTGKTLLA
Sbjct  177   EKAPLETYADIGGLDAQIQEIKEAVELPLTHPELYEDIGVKPPKGVILYGEPGTGKTLLA  236

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVANSTSATFLRVVGSELIQKYLG+GPKLVRE+FRVAD+LSPSIVFIDEIDAVGTKRYD
Sbjct  237   KAVANSTSATFLRVVGSELIQKYLGEGPKLVREIFRVADDLSPSIVFIDEIDAVGTKRYD  296

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             A SG EREIQRTMLELLNQLDGFDSR DVKVILATNKIESLDPALLRPGRIDRKIEFPLP
Sbjct  297   ARSGAEREIQRTMLELLNQLDGFDSRADVKVILATNKIESLDPALLRPGRIDRKIEFPLP  356

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             DI TRRRIFQIHT+RM L++DVNL+EFVMTKDE SGADIKAICTEAGL ALRERRMKVTH
Sbjct  357   DINTRRRIFQIHTSRMPLSEDVNLDEFVMTKDELSGADIKAICTEAGLFALRERRMKVTH  416

Query  1309  adfkkakdkvmfkkkEGVPEGLY  1377
              DF+KAK+K+M+KKK+GVPEG+Y
Sbjct  417   PDFEKAKEKIMYKKKDGVPEGMY  439



>ref|XP_001690446.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP05705.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
Length=443

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/448 (82%), Positives = 405/448 (90%), Gaps = 7/448 (2%)
 Frame = +1

Query  40    GRTIMGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEA-AARLPTV  216
             G+    QG PG      PG+ K D +K KK+EP APP RVG+KQ+K+  + +  A+LPTV
Sbjct  2     GQNQSAQG-PGA-----PGEGKKDQEKKKKYEPPAPPPRVGKKQKKRDTAASLGAKLPTV  55

Query  217   TPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNL  396
              P  KCKLRLLKLERIKDYLLMEEEFV NQE+LKPQEE+ EEDRSKVDDLRG+P+SVG L
Sbjct  56    YPTAKCKLRLLKLERIKDYLLMEEEFVQNQEQLKPQEERNEEDRSKVDDLRGTPLSVGTL  115

Query  397   EELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVS  576
             EE+IDENHAIVSSSVGPEYYV ILSFVDK QLEPGC++L+H K +SVVG+L D+ DPMVS
Sbjct  116   EEIIDENHAIVSSSVGPEYYVCILSFVDKTQLEPGCSVLLHYKSMSVVGILSDETDPMVS  175

Query  577   VMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGK  756
             VMKVEKAPLESYAD+GGL+ QIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGK
Sbjct  176   VMKVEKAPLESYADVGGLEPQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGK  235

Query  757   TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGT  936
             TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEL+PSIVFIDEIDA+GT
Sbjct  236   TLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELAPSIVFIDEIDAIGT  295

Query  937   KRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIE  1116
             KRYDAHSGGEREIQRTMLELLNQLDGFDS  DVKVI+ATN+IESLDPAL+RPGRIDRKIE
Sbjct  296   KRYDAHSGGEREIQRTMLELLNQLDGFDSMSDVKVIMATNRIESLDPALIRPGRIDRKIE  355

Query  1117  FPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRM  1296
             FPLPD KT+RRIF IHT RMTL++DVNLEEFVM KDE SGADIKA+CTEAGLLALRERRM
Sbjct  356   FPLPDAKTKRRIFGIHTGRMTLSEDVNLEEFVMAKDELSGADIKAVCTEAGLLALRERRM  415

Query  1297  KVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +VT ADF+KAK+KV++KKKEGVPEGLYM
Sbjct  416   RVTQADFRKAKEKVLYKKKEGVPEGLYM  443



>ref|XP_004294291.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Fragaria vesca subsp. vesca]
Length=446

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/447 (83%), Positives = 407/447 (91%), Gaps = 5/447 (1%)
 Frame = +1

Query  52    MGQ--GTPGGLNRQL-PGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQ  GT GG N+Q       +  ++ KK+EPAAPPARVG+KQ KQKG +AA RLP+V P
Sbjct  1     MGQQLGTQGGSNQQGDQNPNGDKKEEKKKYEPAAPPARVGKKQLKQKGPDAATRLPSVRP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKV-DDLRGSPMSVGNLE  399
             LTKCKLRLLKLERIKDYLLMEEEFV+NQE+ KP+E   EED+SKV ++LRGSPM VG L+
Sbjct  61    LTKCKLRLLKLERIKDYLLMEEEFVSNQEQRKPKENAEEEDKSKVVEELRGSPMDVGTLQ  120

Query  400   ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  579
             ELID+NHAIVSSS G  +YV I+SFVDKDQLEPGC +L+HNK  SVVGLLQD+VDP+V+V
Sbjct  121   ELIDDNHAIVSSSSGT-HYVGIMSFVDKDQLEPGCDVLLHNKQHSVVGLLQDEVDPLVAV  179

Query  580   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  759
             MKVEKAP+ESYADIGGL+ QIQEIKE VELPLTHPELYEDIGIKPPKGVILYGEPGTGKT
Sbjct  180   MKVEKAPVESYADIGGLECQIQEIKETVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  239

Query  760   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK  939
             LLAKAVANSTSATFLRVVGSELIQKY G+G KLVRE+FRVADE SPSIVFIDE+DAVGTK
Sbjct  240   LLAKAVANSTSATFLRVVGSELIQKYSGEGQKLVREIFRVADECSPSIVFIDEVDAVGTK  299

Query  940   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEF  1119
             RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIE+LDPAL+RPGRIDRKIEF
Sbjct  300   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIENLDPALIRPGRIDRKIEF  359

Query  1120  PLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  1299
             PLPDI+TRRRIF IHT++MTLADDVNLEE VMTKDE+SGADIKAICTEAG+LALRERRMK
Sbjct  360   PLPDIQTRRRIFHIHTSKMTLADDVNLEELVMTKDEYSGADIKAICTEAGMLALRERRMK  419

Query  1300  VTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VTH DFKKAK+KVM+KKKEGVPEGLY+
Sbjct  420   VTHGDFKKAKEKVMYKKKEGVPEGLYL  446



>gb|EEE58887.1| hypothetical protein OsJ_10505 [Oryza sativa Japonica Group]
Length=460

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/484 (80%), Positives = 405/484 (84%), Gaps = 65/484 (13%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-------LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLP  210
             MGQGTPGG+ +Q        PGD    DKKD+KFEP A P+RVGRKQRKQKG EAAARLP
Sbjct  1     MGQGTPGGMGKQGGLPGDRKPGDGGAGDKKDRKFEPPAAPSRVGRKQRKQKGPEAAARLP  60

Query  211   TVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVG  390
              V PL                         NQERL+P E+KTEEDRSKVDDLRG+PMSVG
Sbjct  61    AVAPLF------------------------NQERLRPSEDKTEEDRSKVDDLRGTPMSVG  96

Query  391   NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK---------------  525
             +LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNK               
Sbjct  97    SLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKWDWKHHTNTSVVHGL  156

Query  526   -------------------VLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQE  648
                                VLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQE
Sbjct  157   VIGSKRQSDQMVHIRYLQMVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQE  216

Query  649   IKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELI  828
             IKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELI
Sbjct  217   IKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELI  276

Query  829   QKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQL  1008
             QKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQL
Sbjct  277   QKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQL  336

Query  1009  DGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLAD  1188
             DGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHT++MTLAD
Sbjct  337   DGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLAD  396

Query  1189  DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPE  1368
             DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAK+KVMFKKKEGVPE
Sbjct  397   DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMFKKKEGVPE  456

Query  1369  GLYM  1380
             GLYM
Sbjct  457   GLYM  460



>gb|EEC75058.1| hypothetical protein OsI_11173 [Oryza sativa Indica Group]
Length=460

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/484 (80%), Positives = 405/484 (84%), Gaps = 65/484 (13%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-------LPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLP  210
             MGQGTPGG+ +Q        PGD    DKKD+KFEP A P+RVGRKQRKQKG EA ARLP
Sbjct  1     MGQGTPGGMGKQGGLPGDRKPGDGGAGDKKDRKFEPPAAPSRVGRKQRKQKGPEAEARLP  60

Query  211   TVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVG  390
              V P                        ++NQERL+P E+KTEEDRSKVDDLRG+PMSVG
Sbjct  61    AVAP------------------------ISNQERLRPSEDKTEEDRSKVDDLRGTPMSVG  96

Query  391   NLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNK---------------  525
             +LEE+IDE+HAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNK               
Sbjct  97    SLEEIIDESHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKWDWKHHTNTSVVHGL  156

Query  526   -------------------VLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQE  648
                                VLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQIQE
Sbjct  157   VIGSKRQSDQMVHIRYLQMVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQIQE  216

Query  649   IKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELI  828
             IKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELI
Sbjct  217   IKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELI  276

Query  829   QKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQL  1008
             QKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQL
Sbjct  277   QKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQL  336

Query  1009  DGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLAD  1188
             DGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHT++MTLAD
Sbjct  337   DGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLAD  396

Query  1189  DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPE  1368
             DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAK+KVMFKKKEGVPE
Sbjct  397   DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMFKKKEGVPE  456

Query  1369  GLYM  1380
             GLYM
Sbjct  457   GLYM  460



>ref|XP_007048402.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao]
 gb|EOX92559.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao]
Length=382

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/373 (96%), Positives = 366/373 (98%), Gaps = 3/373 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGGLNRQ LPGDRK+   DKK+KKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGTPGGLNRQGLPGDRKSDGSDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             L+KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    LSKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQI  1161
             LPDIKTRRRIFQ+
Sbjct  361   LPDIKTRRRIFQV  373



>gb|KHN05911.1| 26S proteasome regulatory subunit 4 like A [Glycine soja]
 gb|KHN48977.1| 26S proteasome regulatory subunit 4 like A [Glycine soja]
Length=367

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/367 (98%), Positives = 365/367 (99%), Gaps = 0/367 (0%)
 Frame = +1

Query  280   MEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYV  459
             MEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYV
Sbjct  1     MEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYV  60

Query  460   SILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQ  639
              ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVMKVEKAPLESYADIGGLDAQ
Sbjct  61    GILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVEKAPLESYADIGGLDAQ  120

Query  640   IQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS  819
             IQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS
Sbjct  121   IQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS  180

Query  820   ELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELL  999
             ELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELL
Sbjct  181   ELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELL  240

Query  1000  NQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMT  1179
             NQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHT+RMT
Sbjct  241   NQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMT  300

Query  1180  LADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEG  1359
             LADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKDKVMFKKKEG
Sbjct  301   LADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKDKVMFKKKEG  360

Query  1360  VPEGLYM  1380
             VPEGLYM
Sbjct  361   VPEGLYM  367



>gb|KIZ04434.1| 26S proteasome regulatory subunit T2 [Monoraphidium neglectum]
Length=461

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/435 (80%), Positives = 394/435 (91%), Gaps = 18/435 (4%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEA-AARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQ  306
             +EP APP RVG+KQ+K+  + +   +LPTVTP T+CKLRLLKLERIKDYLLME EFV NQ
Sbjct  27    WEPPAPPPRVGKKQKKRDAAASLGTKLPTVTPSTRCKLRLLKLERIKDYLLMEHEFVQNQ  86

Query  307   ERLKPQEEKTEEDRSK-----------------VDDLRGSPMSVGNLEELIDENHAIVSS  435
             ERLKPQ+E+ EEDRSK                 VDDLRGSP+SVG+LEE+IDENHAIVSS
Sbjct  87    ERLKPQDERNEEDRSKASAARLEQGVAQAHGAAVDDLRGSPLSVGSLEEIIDENHAIVSS  146

Query  436   SVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYA  615
             +VGPEYYV+ILSFVDK QLEPGC++L+HNKV+SVVG+LQD+ DPMVSVMKV+KAP ESYA
Sbjct  147   AVGPEYYVTILSFVDKTQLEPGCSVLLHNKVMSVVGILQDETDPMVSVMKVDKAPTESYA  206

Query  616   DIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSA  795
             D+GGL+ QI EIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSA
Sbjct  207   DVGGLENQITEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSA  266

Query  796   TFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREI  975
             TFLRVVGSELIQKYLGDGPKLVRELFRVADE++PSIVFIDEIDA+GTKRYD+HSGGEREI
Sbjct  267   TFLRVVGSELIQKYLGDGPKLVRELFRVADEMAPSIVFIDEIDAIGTKRYDSHSGGEREI  326

Query  976   QRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIF  1155
             QRTMLELLNQ+DGFD+  +VKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF
Sbjct  327   QRTMLELLNQMDGFDAMSEVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDAKTKRRIF  386

Query  1156  QIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdk  1335
              IHT+RMTL++DVNLEEFVM KDE SGADIKA+CTEAGLLALRERRM+VT ADF+KAK+K
Sbjct  387   SIHTSRMTLSEDVNLEEFVMAKDELSGADIKAVCTEAGLLALRERRMRVTQADFRKAKEK  446

Query  1336  vmfkkkEGVPEGLYM  1380
             V++KKKEGVPEGLYM
Sbjct  447   VLYKKKEGVPEGLYM  461



>gb|KEH42401.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=398

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/374 (94%), Positives = 364/374 (97%), Gaps = 3/374 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrkn--ddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQGTPGG+NRQ  PGDRK    DKK+KKFEPAAPPARVGRKQRKQKG +AA+RLPTVTP
Sbjct  1     MGQGTPGGMNRQGHPGDRKQDGSDKKEKKFEPAAPPARVGRKQRKQKGPDAASRLPTVTP  60

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             ++KCKLRLLKLER+KDYLLMEEEFVA QERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  61    VSKCKLRLLKLERVKDYLLMEEEFVAYQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  120

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  121   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  180

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  181   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  240

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVFIDEIDAVGTKR
Sbjct  241   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVFIDEIDAVGTKR  300

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
             YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFP
Sbjct  301   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFP  360

Query  1123  LPDIKTRRRIFQIH  1164
             LPDIKTRRRIFQ++
Sbjct  361   LPDIKTRRRIFQVN  374



>ref|XP_005847625.1| 26S proteasome AAA-ATPase subunit RPT2a [Chlorella variabilis]
 gb|EFN55523.1| 26S proteasome AAA-ATPase subunit RPT2a [Chlorella variabilis]
Length=443

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/418 (82%), Positives = 381/418 (91%), Gaps = 1/418 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEA-AARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQ  306
             +EP APP RVG+KQR++  + +   +LPT+TP  KCKLRLLKLER+KD+LLMEEEFV NQ
Sbjct  26    YEPPAPPPRVGKKQRRRAAASSLGTKLPTITPTAKCKLRLLKLERVKDWLLMEEEFVQNQ  85

Query  307   ERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKD  486
             ERLKP +E+ EE+R+KVDDLRG+P+SVG LEE+IDENHAIVSS+VGPEYYV+I+SFVDK 
Sbjct  86    ERLKPADERNEEERTKVDDLRGTPLSVGTLEEMIDENHAIVSSAVGPEYYVTIMSFVDKT  145

Query  487   QLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVE  666
             QLEPG  +L+HNK   VVG+L D+ DP VSVMKVE+AP ESYAD+GGLD QIQEIKEAVE
Sbjct  146   QLEPGSTVLLHNKGNQVVGILTDEADPAVSVMKVEQAPSESYADVGGLDQQIQEIKEAVE  205

Query  667   LPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGD  846
             LPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGD
Sbjct  206   LPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGD  265

Query  847   GPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSR  1026
             GPKLVRELFRVADE +PSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD+ 
Sbjct  266   GPKLVRELFRVADEQAPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDAM  325

Query  1027  GDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEE  1206
              DVKVI+ATN+I+SLDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT RMTLADDVN+EE
Sbjct  326   TDVKVIMATNRIDSLDPALIRPGRIDRKIEFPLPDQKTKRRIFQIHTGRMTLADDVNIEE  385

Query  1207  FVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             FVM KDE SGADIKA+CTEAGLLALRERRM V   D KKAK+KV++KKKEGVPEGLYM
Sbjct  386   FVMAKDELSGADIKAMCTEAGLLALRERRMCVKQEDLKKAKEKVLYKKKEGVPEGLYM  443



>gb|EEE67865.1| hypothetical protein OsJ_25676 [Oryza sativa Japonica Group]
Length=367

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/367 (95%), Positives = 364/367 (99%), Gaps = 0/367 (0%)
 Frame = +1

Query  280   MEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYV  459
             MEEEFVA QERL+P E+KTEEDRSKVDDLRG+PMSVG+LEE+IDE+HAIVSSSVGPEYYV
Sbjct  1     MEEEFVAAQERLRPTEDKTEEDRSKVDDLRGTPMSVGSLEEIIDESHAIVSSSVGPEYYV  60

Query  460   SILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQ  639
              ILSFVDKDQLEPGC+ILMHNKVLSVVG+LQD+VDPMVSVMKVEKAPLESYADIGGLDAQ
Sbjct  61    GILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLESYADIGGLDAQ  120

Query  640   IQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS  819
             IQEIKEAVELPLTHPELYEDIGI+PPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS
Sbjct  121   IQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGS  180

Query  820   ELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELL  999
             ELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELL
Sbjct  181   ELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELL  240

Query  1000  NQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMT  1179
             NQLDGFDSRGDVKVILATN+IESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHT++MT
Sbjct  241   NQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMT  300

Query  1180  LADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEG  1359
             LADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAK+KVMFKKKEG
Sbjct  301   LADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMFKKKEG  360

Query  1360  VPEGLYM  1380
             VPEGLYM
Sbjct  361   VPEGLYM  367



>ref|XP_004335995.1| 26S proteasome AAAATPase subunit RPT2a, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR13982.1| 26S proteasome AAAATPase subunit RPT2a, putative [Acanthamoeba 
castellanii str. Neff]
Length=445

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/417 (83%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP  PPA   +K RK  G + A R+P VTP TKC+LRLLKLERIKD+LLMEEEFV NQE
Sbjct  30    FEPYTPPAGSKKKLRKGAG-DLATRIPVVTPHTKCRLRLLKLERIKDWLLMEEEFVQNQE  88

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
              LKPQEEK +E+R+KVD+LRGSPM VG LEE IDENHAIV SSVGPEYYV+I+SFVDKD 
Sbjct  89    VLKPQEEKAQEERTKVDELRGSPMGVGTLEERIDENHAIVGSSVGPEYYVTIMSFVDKDL  148

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+HNK LSVVG+L D+VDP+VSVMKV+KAPLESYADIGGL++QIQEIKEAVEL
Sbjct  149   LEPGCSVLLHNKALSVVGILSDEVDPLVSVMKVDKAPLESYADIGGLESQIQEIKEAVEL  208

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE+IGI PPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG
Sbjct  209   PLTHPELYEEIGINPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  268

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E SPSIVFIDEIDA+GTKRYDA SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  269   PKLVRELFRVAEEHSPSIVFIDEIDAIGTKRYDATSGGEREIQRTMLELLNQLDGFDSRG  328

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+I++LDPAL+RPGRIDRKIEFPLPDIKT+R IF+IHT++MTLA+DVNLEEF
Sbjct  329   DVKVIMATNRIQTLDPALIRPGRIDRKIEFPLPDIKTKRMIFRIHTSKMTLAEDVNLEEF  388

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +  KD+ SGADIKAICTEAGLLALRERRMKVTH DFKKAK+KV+++K EGVPEGLY+
Sbjct  389   IHAKDDLSGADIKAICTEAGLLALRERRMKVTHDDFKKAKEKVLYRKNEGVPEGLYL  445



>ref|XP_001655853.1| AAEL012095-PA [Aedes aegypti]
 gb|ABF18346.1| 26S proteasome regulatory chain 4 [Aedes aegypti]
 gb|EAT35749.1| AAEL012095-PA [Aedes aegypti]
Length=438

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/417 (81%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+RK KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKKKRKNKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHTARMTLADDVNL E 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTARMTLADDVNLSEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  438



>gb|KFB53205.1| hypothetical protein ZHAS_00021511 [Anopheles sinensis]
Length=438

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/417 (82%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+RK KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRGSPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQEEKNEEERSKVDDLRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHTARMTLA+DVNL E 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTARMTLAEDVNLSEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLYM
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYM  438



>ref|XP_005710517.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
 emb|CDF40223.1| 26S proteasome ATP-dependent regulatory subunit [Chondrus crispus]
Length=441

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/417 (82%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP   P RVGRK +K++G E AA+LP +TP  KC+LR+LKLER+KDYLLMEEEFV NQE
Sbjct  26    YEPPPGPTRVGRK-KKRRGPEVAAKLPNITPTAKCRLRMLKLERVKDYLLMEEEFVTNQE  84

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             R KP+EE+TEEDRSKV+D+RG+PM VG LEE+ID++HAIVSS+VGPEYYV I SFVDKDQ
Sbjct  85    RYKPREERTEEDRSKVEDIRGTPMGVGTLEEIIDDDHAIVSSAVGPEYYVYITSFVDKDQ  144

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPG ++L+H KVLSVVG+L DD DPMVSVMKV+KAPLESYADIGGL+ QIQEIKEAVEL
Sbjct  145   LEPGSSVLLHQKVLSVVGMLADDADPMVSVMKVDKAPLESYADIGGLEDQIQEIKEAVEL  204

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYED+GIKPPKGVILYGEPGTGKTLLAKAVANSTSA+FLRVVGSELIQKYLGDG
Sbjct  205   PLTHPELYEDMGIKPPKGVILYGEPGTGKTLLAKAVANSTSASFLRVVGSELIQKYLGDG  264

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA++++PSIVFIDEIDAVGTKRYD  S GEREIQRTMLELLNQLDGFDSRG
Sbjct  265   PKLVRELFRVAEDMAPSIVFIDEIDAVGTKRYDTTSSGEREIQRTMLELLNQLDGFDSRG  324

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV+LATN+IE+LDPALLRPGRIDRKIEFPLPD KT+RRIF IHT RMTLA DV LEEF
Sbjct  325   DVKVLLATNRIETLDPALLRPGRIDRKIEFPLPDEKTKRRIFTIHTGRMTLAQDVKLEEF  384

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTEAGL+ALRERRMKV HADF+KA++ V++KK +GVPEGLY+
Sbjct  385   VMSKDDLSGADIKAICTEAGLMALRERRMKVMHADFRKARENVLYKKNQGVPEGLYL  441



>ref|XP_001861875.1| 26S protease regulatory subunit 4 [Culex quinquefasciatus]
 gb|EDS36214.1| 26S protease regulatory subunit 4 [Culex quinquefasciatus]
Length=438

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/417 (81%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+RK KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKKKRKAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHTARMTLA+DVNL E 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTARMTLAEDVNLSEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  438



>dbj|BAM19425.1| proteasome 26S subunit subunit 4 ATPase, partial [Papilio xuthus]
Length=441

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/417 (82%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+RK KG +AA +LP VTP TKC+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  26    YEPPIP-TRVGKKKRKAKGPDAALKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQE  84

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSF DKDQ
Sbjct  85    RLKPQEEKIEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFEDKDQ  144

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMVSVMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  145   LEPGCSVLLNHKVHAVVGVLGDDTDPMVSVMKLEKAPQETYADIGGLDTQIQEIKESVEL  204

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  205   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  264

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  265   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  324

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLADDVNL E 
Sbjct  325   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLADDVNLSEL  384

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M+KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  385   IMSKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  441



>ref|XP_312923.4| AGAP003215-PA [Anopheles gambiae str. PEST]
 ref|XP_312924.4| AGAP003216-PA [Anopheles gambiae str. PEST]
 gb|EAA08386.4| AGAP003215-PA [Anopheles gambiae str. PEST]
 gb|EAA08387.4| AGAP003216-PA [Anopheles gambiae str. PEST]
Length=438

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/417 (82%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+RK KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRGSPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQEEKIEEERSKVDDLRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHTARMTLA+DVNL E 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTARMTLAEDVNLSEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLYM
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYM  438



>emb|CEF97142.1| 26S proteasome subunit P45 [Ostreococcus tauri]
Length=446

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/416 (81%), Positives = 383/416 (92%), Gaps = 1/416 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP APP RVG+K++K  G E   RLP V P +KCKLR+LKLER+KDYLLMEEEFV NQE
Sbjct  31    YEPPAPPMRVGKKKKKT-GIEGHTRLPEVFPASKCKLRMLKLERVKDYLLMEEEFVGNQE  89

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKP+EE+ E+++SK+D++RG+PMSVG+LEE+ID+ H IVSSS+GPEYYV+I SFVDK Q
Sbjct  90    RLKPREERDEDEQSKIDEMRGAPMSVGSLEEIIDDTHGIVSSSIGPEYYVNIASFVDKSQ  149

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGCA+L+H+K  +VVG L DDVDPMVSVMKV+KAPLESYAD+GGL+ QIQEIKEAVEL
Sbjct  150   LEPGCAVLLHHKNSAVVGTLADDVDPMVSVMKVDKAPLESYADVGGLEEQIQEIKEAVEL  209

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYEDIGIKPPKGVILYG PGTGKTLLAKAVANSTSATFLR+VGSELIQKYLGDG
Sbjct  210   PLTHPELYEDIGIKPPKGVILYGAPGTGKTLLAKAVANSTSATFLRIVGSELIQKYLGDG  269

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVADE+SPSIVF+DEIDAVGTKRYD+ SGGEREIQRTMLELLNQ+DGFDSRG
Sbjct  270   PKLVRELFRVADEMSPSIVFMDEIDAVGTKRYDSQSGGEREIQRTMLELLNQMDGFDSRG  329

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IESLDPALLRPGRIDRKIEFPLPD+KT+R IF IHT RM L+ DV LEEF
Sbjct  330   DVKVIMATNRIESLDPALLRPGRIDRKIEFPLPDVKTKRHIFNIHTGRMNLSADVQLEEF  389

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLY  1377
             VM KDE SGADIKA+CTEAGLLALRERRM+VTHADF KAK+KV++KKKEGVPEG++
Sbjct  390   VMAKDELSGADIKALCTEAGLLALRERRMQVTHADFSKAKEKVLYKKKEGVPEGMF  445



>ref|XP_003062555.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53374.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/417 (81%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             + P APP RVG+K +K KG + A RLP V P +KC LR LKLER+KD+LLMEEEFVANQE
Sbjct  27    WVPPAPPMRVGKKLKK-KGIDGANRLPNVFPASKCLLRKLKLERVKDWLLMEEEFVANQE  85

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             R+KP EE+ EE+RSKV++LRGSPM+VG LEE+ID+NHAIVSSSVGPEYYV+I+SFVDK Q
Sbjct  86    RVKPHEERAEEERSKVEELRGSPMNVGTLEEIIDDNHAIVSSSVGPEYYVNIMSFVDKSQ  145

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGCA+L+HNK LSVVG L DDVDPMVSVMKV+KAPLESYAD+GGL+ QIQEIKEAVEL
Sbjct  146   LEPGCAVLLHNKSLSVVGTLADDVDPMVSVMKVDKAPLESYADVGGLEDQIQEIKEAVEL  205

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSA+FLRVVGSELIQKYLGDG
Sbjct  206   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSASFLRVVGSELIQKYLGDG  265

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+++SPSIVFIDEIDA+GTKRYD++SGGE+EIQRTM+ELL Q+DGF++RG
Sbjct  266   PKLVRELFRVAEDMSPSIVFIDEIDAIGTKRYDSNSGGEKEIQRTMIELLTQMDGFEARG  325

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             +VKVI+ATN+IE+LDPALLRPGRIDRKIEFPLPDIKT+R IF IHT RM LA+DV LEEF
Sbjct  326   EVKVIMATNRIETLDPALLRPGRIDRKIEFPLPDIKTKRHIFGIHTGRMNLAEDVKLEEF  385

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM KDE SGADIKA+CTEAGLLALRERRM+VTH+DF KAK+KV++KKKEGVPEG++M
Sbjct  386   VMAKDELSGADIKALCTEAGLLALRERRMQVTHSDFSKAKEKVLYKKKEGVPEGMFM  442



>emb|CCA21636.1| 26S proteasome AAAATPase subunit RPT2a putative [Albugo laibachii 
Nc14]
Length=442

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 381/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP +    +  K+RK+KG  AA R+PTV P  KCKLRLLKLERIKD+LLME+EF+ NQE
Sbjct  28    FEPRS--GAMTHKRRKKKGPSAAVRIPTVYPTAKCKLRLLKLERIKDFLLMEQEFIQNQE  85

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
              +KP+ EK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVSSSVGPEYYVS++SFV++D 
Sbjct  86    VMKPKHEKDEEERSKVDDLRGNPMSVGTLEEIIDDNHAIVSSSVGPEYYVSVMSFVNQDM  145

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LE GC++L+HNKV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGLDAQIQEIKEAVEL
Sbjct  146   LETGCSVLLHNKVMSVVGILSDDTDPMVSVMKVDKAPLESYADIGGLDAQIQEIKEAVEL  205

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE IGIKPPKGVILYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  206   PLTHPELYEGIGIKPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  265

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRE+FRVA++L+PSIVFIDEIDAVG+KRYD++SGG REIQRTMLELLNQLDGFD RG
Sbjct  266   PKLVREMFRVAEDLAPSIVFIDEIDAVGSKRYDSNSGGTREIQRTMLELLNQLDGFDERG  325

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN I+SLDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT RM+L DDV+LEEF
Sbjct  326   DVKVIMATNSIQSLDPALIRPGRIDRKIEFPLPDTKTKRRIFQIHTGRMSLGDDVDLEEF  385

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M+KDE SGADIKAICTEAGLLALRERRM+VTH DF KAK+K +++KK  +PEGLY+
Sbjct  386   IMSKDELSGADIKAICTEAGLLALRERRMRVTHVDFAKAKEKALYRKKANIPEGLYL  442



>gb|ETN59541.1| 26S protease regulatory subunit 4 [Anopheles darlingi]
 gb|ETN59542.1| 26S protease regulatory subunit 4 [Anopheles darlingi]
Length=438

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/417 (81%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+RK KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQEEKIEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHTARMTLA+DVNL E 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTARMTLAEDVNLAEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLYM
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYM  438



>ref|XP_001416670.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94963.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=443

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/416 (81%), Positives = 383/416 (92%), Gaps = 1/416 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             + P APP RVG+K++K  G E + RLP V P +KCKLR+LKLER+KDYLLMEEEFV NQE
Sbjct  28    YVPPAPPMRVGKKKKKT-GIEGSTRLPNVAPQSKCKLRMLKLERVKDYLLMEEEFVGNQE  86

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKP+EE+ E+++SK+D++RG+PMSVG+LEE+ID+ H IVSSS+GPEYYV+I SFVDK Q
Sbjct  87    RLKPREERDEDEQSKIDEMRGAPMSVGSLEEIIDDTHGIVSSSIGPEYYVNIASFVDKSQ  146

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGCA+L+H+K  +VVG L DDVDPMVSVMKV+KAPLESYAD+GGL+ QIQEIKEAVEL
Sbjct  147   LEPGCAVLLHHKNSAVVGTLADDVDPMVSVMKVDKAPLESYADVGGLEDQIQEIKEAVEL  206

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYEDIGIKPPKGVILYG PGTGKTLLAKAVANSTSATFLR+VGSELIQKYLGDG
Sbjct  207   PLTHPELYEDIGIKPPKGVILYGAPGTGKTLLAKAVANSTSATFLRIVGSELIQKYLGDG  266

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVADE+SPSIVF+DEIDAVGTKRYD+ SGGEREIQRTMLELLNQ+DGFDSRG
Sbjct  267   PKLVRELFRVADEMSPSIVFMDEIDAVGTKRYDSQSGGEREIQRTMLELLNQMDGFDSRG  326

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IESLDPALLRPGRIDRKIEFPLPD+KT+R IF IHT RM L+ DV LEEF
Sbjct  327   DVKVIMATNRIESLDPALLRPGRIDRKIEFPLPDVKTKRHIFNIHTGRMNLSADVQLEEF  386

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLY  1377
             VM KDE SGADIKA+CTEAGLLALRERRM+VTHADF KAK+KV++KKKEGVPEG++
Sbjct  387   VMAKDELSGADIKALCTEAGLLALRERRMQVTHADFSKAKEKVLYKKKEGVPEGMF  442



>dbj|BAN20514.1| proteasome 26S subunit subunit 4 ATPase [Riptortus pedestris]
Length=440

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+++ KG +AA +LP VTP TKC+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKKRTKGPDAATKLPQVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIF IHT+RMTLADDVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFNIHTSRMTLADDVNLSEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKV + DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVNNEDFKKSKESVLYRKKEGTPEGLYL  440



>emb|CCI47533.1| unnamed protein product [Albugo candida]
Length=442

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 381/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP +    +  K+RK+KG  AA R+PTV P  KCKLRLLKLERIKD+LLME+EF+ NQE
Sbjct  28    FEPRS--GVMTHKRRKKKGPSAAVRIPTVYPTAKCKLRLLKLERIKDFLLMEQEFIQNQE  85

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
              +KP+ EK EE+RSKVDDLRG+PM VG LEE+ID+NHAIVSSSVGPEYYVS++SFV++D 
Sbjct  86    VMKPKHEKDEEERSKVDDLRGNPMGVGTLEEIIDDNHAIVSSSVGPEYYVSVMSFVNQDM  145

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LE GC++L+HNKV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGLDAQIQEIKEAVEL
Sbjct  146   LETGCSVLLHNKVMSVVGILSDDTDPMVSVMKVDKAPLESYADIGGLDAQIQEIKEAVEL  205

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE IGIKPPKGVILYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  206   PLTHPELYEGIGIKPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  265

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRE+FRVA++L+PSIVFIDEIDAVG+KRYD++SGG REIQRTMLELLNQLDGFD RG
Sbjct  266   PKLVREMFRVAEDLAPSIVFIDEIDAVGSKRYDSNSGGTREIQRTMLELLNQLDGFDERG  325

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN I+SLDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT RM+L+DDV+LEEF
Sbjct  326   DVKVIMATNAIQSLDPALIRPGRIDRKIEFPLPDTKTKRRIFQIHTGRMSLSDDVDLEEF  385

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M+KDE SGADIKAICTEAGLLALRERRM+VTH DF KAK+K +++KK  +PEGLY+
Sbjct  386   IMSKDELSGADIKAICTEAGLLALRERRMRVTHVDFAKAKEKALYRKKANIPEGLYL  442



>ref|XP_001982075.1| GG12390 [Drosophila erecta]
 ref|XP_002070237.1| GK11948 [Drosophila willistoni]
 ref|XP_002099325.1| GE10845 [Drosophila yakuba]
 gb|EDV53945.1| GG12390 [Drosophila erecta]
 gb|EDW81223.1| GK11948 [Drosophila willistoni]
 gb|EDW99037.1| GE10845 [Drosophila yakuba]
Length=439

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  439



>ref|NP_524469.2| regulatory particle triple-A ATPase 2, isoform A [Drosophila 
melanogaster]
 ref|NP_001287493.1| regulatory particle triple-A ATPase 2, isoform B [Drosophila 
melanogaster]
 ref|XP_002032413.1| GM23527 [Drosophila sechellia]
 ref|XP_002104626.1| GD18337 [Drosophila simulans]
 sp|P48601.2|PRS4_DROME RecName: Full=26S protease regulatory subunit 4; Short=P26s4 
[Drosophila melanogaster]
 gb|AAF56205.1| regulatory particle triple-A ATPase 2, isoform A [Drosophila 
melanogaster]
 gb|AAL13988.1| SD02658p [Drosophila melanogaster]
 gb|EDW43399.1| GM23527 [Drosophila sechellia]
 gb|EDX14129.1| GD18337 [Drosophila simulans]
 gb|ACL90655.1| Pros26.4-PA [synthetic construct]
 gb|AHN57492.1| regulatory particle triple-A ATPase 2, isoform B [Drosophila 
melanogaster]
Length=439

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  439



>ref|NP_001229616.1| proteasome 26S subunit subunit 4 ATPase-like [Strongylocentrotus 
purpuratus]
Length=443

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG + A++LP VTP TKC+LRLLK+ERIKDYLLMEEEF+ NQE
Sbjct  28    YEPPVP-TRVGKKKRRTKGPDTASKLPQVTPHTKCRLRLLKMERIKDYLLMEEEFIRNQE  86

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG+LEE+ID+NHAIVS+SVG EYYVSILSFVDKDQ
Sbjct  87    RLKPQEEKDEEERSKVDDLRGTPMSVGSLEEIIDDNHAIVSASVGSEYYVSILSFVDKDQ  146

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC +L+++KVL++VG+L DD DPMVSVMK+EKAP ESYADIGGLD QIQEIKE+VEL
Sbjct  147   LEPGCTVLLNHKVLAIVGVLGDDTDPMVSVMKLEKAPQESYADIGGLDTQIQEIKESVEL  206

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GI+PPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  207   PLTHPEYYEEMGIRPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  266

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRY+++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  267   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYESNSGGEREIQRTMLELLNQLDGFDSRG  326

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTL++DVNL+E+
Sbjct  327   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLSNDVNLDEY  386

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             + +KD+ SGADIKAICTEAGL+ALRERRMKV + DFKK+K+ V+++K EG PEGLY+
Sbjct  387   ITSKDDLSGADIKAICTEAGLMALRERRMKVNNEDFKKSKENVLYRKTEGTPEGLYL  443



>ref|XP_001993700.1| GH19692 [Drosophila grimshawi]
 gb|EDV94436.1| GH19692 [Drosophila grimshawi]
Length=439

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLNEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  439



>ref|XP_005179926.1| PREDICTED: 26S protease regulatory subunit 4 [Musca domestica]
Length=439

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+++ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKKRSKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAEDVNLSEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  439



>ref|XP_002000888.1| GI22277 [Drosophila mojavensis]
 gb|EDW16349.1| GI22277 [Drosophila mojavensis]
Length=439

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPLVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLNEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  439



>ref|XP_002613460.1| hypothetical protein BRAFLDRAFT_119863 [Branchiostoma floridae]
 gb|EEN69469.1| hypothetical protein BRAFLDRAFT_119863 [Branchiostoma floridae]
Length=441

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/417 (80%), Positives = 389/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG ++A +LP VTP T+C+L+LLKLERIKDY+LMEEEF+ NQE
Sbjct  26    YEPPVP-TRVGKRRKKGKGPDSANKLPAVTPHTRCRLKLLKLERIKDYMLMEEEFIRNQE  84

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+E+ EE+RSKVDDLRGSPMSVG+LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  85    RLKPQDERVEEERSKVDDLRGSPMSVGSLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  144

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++LM++KV ++VG+L DD DPMV+VMK+EKAP ESYADIGGLD QIQEIKE+VEL
Sbjct  145   LEPGCSVLMNHKVHAIVGVLGDDTDPMVTVMKLEKAPKESYADIGGLDQQIQEIKESVEL  204

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  205   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  264

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRY+++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  265   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYESNSGGEREIQRTMLELLNQLDGFDSRG  324

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT+RMTLA+DVNLE+F
Sbjct  325   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTLAEDVNLEDF  384

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++K EG PEGLY+
Sbjct  385   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYRKNEGTPEGLYL  441



>ref|XP_001358781.1| GA18789 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL27924.1| GA18789 [Drosophila pseudoobscura pseudoobscura]
Length=439

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPLVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  439



>ref|XP_001953861.1| GF17023 [Drosophila ananassae]
 gb|EDV42422.1| GF17023 [Drosophila ananassae]
Length=446

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  31    YEPPIP-TRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  89

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  90    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  149

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  150   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  209

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  210   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  269

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  270   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  329

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  330   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSEL  389

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  390   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  446



>ref|XP_002053771.1| GJ24070 [Drosophila virilis]
 gb|EDW67291.1| GJ24070 [Drosophila virilis]
Length=444

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  29    YEPPIP-TRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  87

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  88    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  147

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  148   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  207

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  208   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  267

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  268   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  327

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  328   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLNEL  387

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  388   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  444



>gb|KDR19574.1| 26S protease regulatory subunit 4 [Zootermopsis nevadensis]
Length=440

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKRRRTKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKIEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAQDVNLTEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M+KD+ SGADIKAICTEAGL+ALRERRMKVT+ DF+K+K+ V+++KKEG PEGLY+
Sbjct  384   IMSKDDLSGADIKAICTEAGLMALRERRMKVTNEDFRKSKESVLYRKKEGTPEGLYL  440



>ref|XP_974859.1| PREDICTED: 26S protease regulatory subunit 4 [Tribolium castaneum]
 gb|EFA06741.1| hypothetical protein TcasGA2_TC009675 [Tribolium castaneum]
Length=438

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG + A +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKKKRRTKGPDTALKLPVVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQEEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIF IHT+RMTLA+DVNL+E 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFNIHTSRMTLAEDVNLQEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKV + DFKK+K+ V+++KKEG PEGLY+
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVMNEDFKKSKESVLYRKKEGTPEGLYL  438



>gb|AEE62840.1| unknown [Dendroctonus ponderosae]
 gb|ENN73080.1| hypothetical protein YQE_10284, partial [Dendroctonus ponderosae]
Length=438

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG + A +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKKKRRTKGPDTALKLPAVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQEEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL+E 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAEDVNLQEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKV + DFKK+K+ V+++KKEG PEGLY+
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVMNEDFKKSKESVLYRKKEGTPEGLYL  438



>ref|XP_012150316.1| PREDICTED: 26S protease regulatory subunit 4 [Megachile rotundata]
Length=440

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFITNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>gb|KFH72195.1| 26S protease regulatory subunit 4 [Mortierella verticillata NRRL 
6337]
Length=440

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/417 (81%), Positives = 386/417 (93%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+ + KG +A+++LP V P T+C+L++LK+ERIKDYLLMEEEFV NQE
Sbjct  26    WEPPLP-TRVGKKKVR-KGPDASSKLPAVFPTTRCRLKMLKMERIKDYLLMEEEFVVNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEKT+E+RSKVDDLRG+PMSVG LEE+ID++HAIVS+S GPEYYVSILSFVDKD 
Sbjct  84    RLKPQEEKTQEERSKVDDLRGTPMSVGTLEEIIDDDHAIVSTSNGPEYYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC+IL+H+K +SV+G+L DD DPMVSVMK+EKAP ESYADIGGL+ QIQEIKEAVEL
Sbjct  144   LEPGCSILLHHKTMSVIGVLADDADPMVSVMKLEKAPTESYADIGGLETQIQEIKEAVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYED+G+KPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPELYEDMGVKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRY+++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEENAPSIVFIDEIDAIGTKRYESNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IESLDPAL+RPGRIDRKIEFP+PD+KT+RRIF IHT RM LADDV+LEEF
Sbjct  324   DVKVIMATNQIESLDPALIRPGRIDRKIEFPMPDVKTKRRIFNIHTGRMQLADDVDLEEF  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KDE SGADIKA+CTEAGLLALRERRMKV   DFKKAK+KV+++K EG PEGLY+
Sbjct  384   VMSKDELSGADIKAVCTEAGLLALRERRMKVKADDFKKAKEKVLYRKNEGTPEGLYL  440



>ref|XP_005838339.1| 26S proteasome regulatory complex, ATPase RPT2 [Guillardia theta 
CCMP2712]
 gb|EKX51359.1| 26S proteasome regulatory complex, ATPase RPT2 [Guillardia theta 
CCMP2712]
Length=440

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/409 (82%), Positives = 381/409 (93%), Gaps = 1/409 (0%)
 Frame = +1

Query  154   RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK  333
             R GRK+ K KG ++ ARLP VTP  KC+LRLLKLER+KDYLLMEEEF+ NQERLKPQEEK
Sbjct  33    RTGRKKVK-KGPDSNARLPAVTPNAKCRLRLLKLERVKDYLLMEEEFIQNQERLKPQEEK  91

Query  334   TEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  513
             ++E+R+KVDDLRGSPM VGNLEE+ID+NHAIVSSSVGPEYYV+I+SFVD+D LEPGC++L
Sbjct  92    SQEERAKVDDLRGSPMGVGNLEEMIDDNHAIVSSSVGPEYYVNIMSFVDRDLLEPGCSVL  151

Query  514   MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELY  693
              HNKVLS+VG+L DD DP+VSVMKV+KAPLE+YADIGGL+ QIQEIKEAVELP+THPELY
Sbjct  152   THNKVLSIVGILADDTDPLVSVMKVDKAPLETYADIGGLEPQIQEIKEAVELPMTHPELY  211

Query  694   EDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELF  873
             EDIGIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDGPKLVRE+F
Sbjct  212   EDIGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKLVREMF  271

Query  874   RVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILAT  1053
             R+ADE +PSIVFIDE   VGTKRYD+ SGGEREIQRTMLELLNQLDGFDSRGDVKV+LAT
Sbjct  272   RLADEQAPSIVFIDESMRVGTKRYDSTSGGEREIQRTMLELLNQLDGFDSRGDVKVLLAT  331

Query  1054  NKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFS  1233
             N+IE+LDPALLRPGRIDRKIEFP+PD  T+RRIFQIHT++M+LADDVNL+EFVMTKD+ S
Sbjct  332   NRIETLDPALLRPGRIDRKIEFPMPDFNTKRRIFQIHTSKMSLADDVNLDEFVMTKDDLS  391

Query  1234  GADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             GADIKAICTE+GLLALRERRMK+  ADF+KAK+KVM KKKEGVPEGLY+
Sbjct  392   GADIKAICTESGLLALRERRMKIMQADFRKAKEKVMHKKKEGVPEGLYL  440



>ref|XP_003395819.1| PREDICTED: 26S protease regulatory subunit 4-like [Bombus terrestris]
 ref|XP_003489177.1| PREDICTED: 26S protease regulatory subunit 4-like [Bombus impatiens]
Length=440

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFSIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_004523315.1| PREDICTED: 26S protease regulatory subunit 4-like [Ceratitis 
capitata]
Length=439

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/417 (80%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLNEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG  EGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTVEGLYL  439



>ref|XP_008550534.1| PREDICTED: 26S protease regulatory subunit 4 [Microplitis demolitor]
Length=440

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG + A +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDVAVKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLSEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M+KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMSKDDLSGADIKAICTEAGLMALRERRMKVTNDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_011185945.1| PREDICTED: 26S protease regulatory subunit 4 [Bactrocera cucurbitae]
 ref|XP_011212656.1| PREDICTED: 26S protease regulatory subunit 4 [Bactrocera dorsalis]
Length=439

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/417 (80%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPLVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLNEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG  EGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTVEGLYL  439



>ref|XP_623527.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Apis 
mellifera]
Length=440

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFSIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>gb|AAB34134.1| P26s4 [Drosophila melanogaster]
Length=439

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/417 (80%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+ +L+LLKLERIKDYL+ME+EF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRAKGPDAAMKLPQVTPHTRARLKLLKLERIKDYLMMEDEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQ+EK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV++MK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTMMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNL E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  439



>ref|XP_003696714.1| PREDICTED: 26S protease regulatory subunit 4-like [Apis florea]
 ref|XP_006623398.1| PREDICTED: 26S protease regulatory subunit 4-like [Apis dorsata]
Length=440

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFSIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_011146352.1| PREDICTED: 26S protease regulatory subunit 4 [Harpegnathos saltator]
Length=439

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 383/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  323   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  439



>gb|EFN79932.1| 26S protease regulatory subunit 4 [Harpegnathos saltator]
Length=486

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 383/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  71    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  129

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  130   RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  189

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQEIKE+VEL
Sbjct  190   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQEIKESVEL  249

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  250   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  309

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  310   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  369

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  370   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  429

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  430   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  486



>ref|XP_011260462.1| PREDICTED: 26S protease regulatory subunit 4 [Camponotus floridanus]
 gb|EFN65701.1| 26S protease regulatory subunit 4 [Camponotus floridanus]
Length=440

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 383/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_005773763.1| hypothetical protein EMIHUDRAFT_444500 [Emiliania huxleyi CCMP1516]
 gb|EOD21334.1| hypothetical protein EMIHUDRAFT_444500 [Emiliania huxleyi CCMP1516]
Length=441

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/411 (81%), Positives = 378/411 (92%), Gaps = 0/411 (0%)
 Frame = +1

Query  148   PARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQE  327
             P RVGRK+RK+ G  A++RLPTV P TKCKLRLLKLER+KDYLLMEEEFVA QE++KPQE
Sbjct  31    PTRVGRKKRKKAGPAASSRLPTVVPATKCKLRLLKLERVKDYLLMEEEFVARQEQVKPQE  90

Query  328   EKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCA  507
             E  +++R+KV+D+RG+P+ V  LEE++D+NHAI+SSS+GPEYYV+ILSFVDKDQLEPGC+
Sbjct  91    ESAQQERTKVEDIRGTPLGVATLEEMVDDNHAIISSSIGPEYYVNILSFVDKDQLEPGCS  150

Query  508   ILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPE  687
             +L HNKV S+VGLL D+ DPM SVMKV+KAP+ESYADIGGL+ QIQEIKEAVELPLTHPE
Sbjct  151   LLTHNKVNSIVGLLADEADPMGSVMKVDKAPVESYADIGGLETQIQEIKEAVELPLTHPE  210

Query  688   LYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRE  867
             LYEDIGI+PPKGVILYGEPGTGKTLLAKAVAN TSATFLRV GSELIQKYLGDGPKLVRE
Sbjct  211   LYEDIGIRPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVTGSELIQKYLGDGPKLVRE  270

Query  868   LFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVIL  1047
             LFRVA+E +P+IVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFD+  DVKVI+
Sbjct  271   LFRVAEENAPTIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDAHVDVKVIM  330

Query  1048  ATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDE  1227
             ATNKIESLDPAL+RPGRIDRKIEFP PD KTRR IFQIHT++M+L+DDVNLEEFVM+KDE
Sbjct  331   ATNKIESLDPALIRPGRIDRKIEFPAPDQKTRRHIFQIHTSKMSLSDDVNLEEFVMSKDE  390

Query  1228  FSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
              SGADIKA+CTEAGLLALRERRMKV+ A+FKKAKD V++KK  G PEGLY+
Sbjct  391   LSGADIKAMCTEAGLLALRERRMKVSQAEFKKAKDYVLYKKHTGAPEGLYL  441



>ref|XP_011343804.1| PREDICTED: 26S protease regulatory subunit 4 [Cerapachys biroi]
 gb|EZA51286.1| 26S protease regulatory subunit [Cerapachys biroi]
Length=440

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 383/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_005106466.1| PREDICTED: 26S protease regulatory subunit 4-like [Aplysia californica]
Length=441

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+++++ KG +AA +LP VTP T+C+L++LKL+RIKDYLLMEEEF+ NQE
Sbjct  26    YEPPVP-TRVGKRKKRTKGPDAATKLPQVTPYTRCRLKMLKLDRIKDYLLMEEEFIKNQE  84

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVD+LRGSPMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  85    RLKPQEEKHEEERSKVDELRGSPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  144

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  145   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  204

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  205   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  264

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRY+++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  265   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYESNSGGEREIQRTMLELLNQLDGFDSRG  324

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DV++E++
Sbjct  325   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAHDVSIEDY  384

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTEAGLLALRERRMKV + DFKKAK+ V+++K EG PEGLY+
Sbjct  385   VMSKDDLSGADIKAICTEAGLLALRERRMKVMNEDFKKAKENVLYRKNEGTPEGLYL  441



>ref|XP_011303495.1| PREDICTED: 26S protease regulatory subunit 4 [Fopius arisanus]
Length=440

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/417 (80%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG + A +LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDVALKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFSIHTSRMTLAPDVNLGEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M+KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMSKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_009521651.1| hypothetical protein PHYSODRAFT_354148 [Phytophthora sojae]
 gb|EGZ26363.1| hypothetical protein PHYSODRAFT_354148 [Phytophthora sojae]
Length=445

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/406 (81%), Positives = 377/406 (93%), Gaps = 0/406 (0%)
 Frame = +1

Query  163   RKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEE  342
             RK+RK+KG  AA R+PTV P  KCKLRLLK+ERIKD+LLME+EF+ NQE +KP++EK EE
Sbjct  40    RKRRKKKGPAAAVRIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQEVMKPKQEKDEE  99

Query  343   DRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHN  522
             +RSKVDDLRG+PM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D LEPGC++L+HN
Sbjct  100   ERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDMLEPGCSVLLHN  159

Query  523   KVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDI  702
             KV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL++QIQEIKEAVELPLTHPELYE I
Sbjct  160   KVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLESQIQEIKEAVELPLTHPELYEGI  219

Query  703   GIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVA  882
             GI+PPKGVILYGEPGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDGPKLVRE+FRVA
Sbjct  220   GIRPPKGVILYGEPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKLVREMFRVA  279

Query  883   DELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKI  1062
             D+ +PSIVFIDEIDAVG+KRYD+ SGG REIQRTMLELLNQLDGFD RGDVKVI+ATN I
Sbjct  280   DDHAPSIVFIDEIDAVGSKRYDSSSGGTREIQRTMLELLNQLDGFDERGDVKVIMATNAI  339

Query  1063  ESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGAD  1242
             ESLDPAL+RPGRIDRKIEFPLPDIKT+RRIF IHT RM+LADDV+LEEFVM+KDE SGAD
Sbjct  340   ESLDPALIRPGRIDRKIEFPLPDIKTKRRIFGIHTGRMSLADDVDLEEFVMSKDELSGAD  399

Query  1243  IKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             IKA+CTEAGLLALRERRM+VT +DF+KAK+K ++KKK  +PEGLY+
Sbjct  400   IKAVCTEAGLLALRERRMRVTQSDFRKAKEKALYKKKANIPEGLYL  445



>ref|XP_011051171.1| PREDICTED: 26S protease regulatory subunit 4 [Acromyrmex echinatior]
 ref|XP_011167793.1| PREDICTED: 26S protease regulatory subunit 4 [Solenopsis invicta]
 ref|XP_011686647.1| PREDICTED: 26S protease regulatory subunit 4 [Wasmannia auropunctata]
 ref|XP_011882329.1| PREDICTED: 26S protease regulatory subunit 4 [Vollenhovia emeryi]
Length=440

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/417 (80%), Positives = 383/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_008896011.1| 26S protease regulatory subunit 4 [Phytophthora parasitica INRA-310]
 gb|ETI36337.1| 26S protease regulatory subunit 4 [Phytophthora parasitica P1569]
 gb|ETK76564.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETL30007.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETL83228.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETM36448.1| 26S protease regulatory subunit 4 [Phytophthora parasitica]
 gb|ETN18319.1| 26S protease regulatory subunit 4 [Phytophthora parasitica INRA-310]
 gb|ETO65058.1| 26S protease regulatory subunit 4 [Phytophthora parasitica P1976]
 gb|ETP06177.1| 26S protease regulatory subunit 4 [Phytophthora parasitica CJ01A1]
Length=445

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/406 (81%), Positives = 376/406 (93%), Gaps = 0/406 (0%)
 Frame = +1

Query  163   RKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEE  342
             RK+RK+KG  AA R+PTV P  KCKLRLLK+ERIKD+LLME+EF+ NQE +KP++EK EE
Sbjct  40    RKRRKKKGPSAAVRIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQEVMKPKQEKDEE  99

Query  343   DRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHN  522
             +RSKVDDLRG+PM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D LEPGC++L+HN
Sbjct  100   ERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDMLEPGCSVLLHN  159

Query  523   KVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDI  702
             KV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL+ QIQEIKEAVELPLTHPELYE I
Sbjct  160   KVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLETQIQEIKEAVELPLTHPELYEGI  219

Query  703   GIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVA  882
             GI+PPKGVILYGEPGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDGPKLVRE+FRVA
Sbjct  220   GIRPPKGVILYGEPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKLVREMFRVA  279

Query  883   DELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKI  1062
             D+ +PSIVFIDEIDAVG+KRYD+ SGG REIQRTMLELLNQLDGFD RGDVKVI+ATN I
Sbjct  280   DDHAPSIVFIDEIDAVGSKRYDSSSGGTREIQRTMLELLNQLDGFDERGDVKVIMATNAI  339

Query  1063  ESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGAD  1242
             ESLDPAL+RPGRIDRKIEFPLPDIKT+RRIF IHT RM+LADDV+LEEFVM+KDE SGAD
Sbjct  340   ESLDPALIRPGRIDRKIEFPLPDIKTKRRIFGIHTGRMSLADDVDLEEFVMSKDELSGAD  399

Query  1243  IKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             IKA+CTEAGLLALRERRM+VT +DF+KAK+K ++KKK  +PEGLY+
Sbjct  400   IKAVCTEAGLLALRERRMRVTQSDFRKAKEKALYKKKANIPEGLYL  445



>gb|EGI70823.1| 26S protease regulatory subunit 4, partial [Acromyrmex echinatior]
Length=439

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/417 (80%), Positives = 383/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  323   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  439



>ref|XP_002900803.1| 26S protease regulatory subunit 4 [Phytophthora infestans T30-4]
 gb|EEY59610.1| 26S protease regulatory subunit 4 [Phytophthora infestans T30-4]
Length=445

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/417 (79%), Positives = 380/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP      + RK+RK+KG  AA R+PTV P  KCKLRLLK+ERIKD+LLME+EF+ NQE
Sbjct  31    FEPRG--GAMTRKRRKKKGPSAAVRIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQE  88

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
              +KP++EK EE+RSKVDDLRG+PM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D 
Sbjct  89    VMKPKQEKDEEERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDM  148

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+HNKV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL++QIQEIKEAVEL
Sbjct  149   LEPGCSVLLHNKVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLESQIQEIKEAVEL  208

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE IGI+PPKGVILYGEPGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDG
Sbjct  209   PLTHPELYEGIGIRPPKGVILYGEPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG  268

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRE+FRVAD+ +PSIVFIDEIDAVG+KRYD+ SGG REIQRTMLELLNQLDGFD RG
Sbjct  269   PKLVREMFRVADDHAPSIVFIDEIDAVGSKRYDSSSGGTREIQRTMLELLNQLDGFDERG  328

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN IESLDPAL+RPGRIDRKIEFPLPDIKT+RRIF IHT RM+L DDV+LEEF
Sbjct  329   DVKVIMATNAIESLDPALIRPGRIDRKIEFPLPDIKTKRRIFGIHTGRMSLGDDVDLEEF  388

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KDE SGADIKA+CTEAGLLALRERRM+VT +DF+KAK+K ++KKK  +PEGLY+
Sbjct  389   VMSKDELSGADIKAVCTEAGLLALRERRMRVTQSDFRKAKEKALYKKKANIPEGLYL  445



>ref|XP_002521148.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF41299.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=399

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/446 (85%), Positives = 385/446 (86%), Gaps = 50/446 (11%)
 Frame = +1

Query  52    MGQGTPGGLNRQ-LPGdrknd--dkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTP  222
             MGQG  G  NRQ LPG+R+ D  DKKDKKFEPAAPPARVGRKQRKQKG EAAARLPTVTP
Sbjct  1     MGQGPSG--NRQGLPGERRQDGGDKKDKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTP  58

Query  223   LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEE  402
             LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK EEDRSKVDDLRGSPMSVGNLEE
Sbjct  59    LTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEE  118

Query  403   LIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVM  582
             LIDENHAIVSSSVGPEYYV ILSFVDKDQLEPGCAILMHNKVLSVVGLLQD+VDPMVSVM
Sbjct  119   LIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVM  178

Query  583   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  762
             KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL
Sbjct  179   KVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL  238

Query  763   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKR  942
             LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPSIVFIDEIDAV    
Sbjct  239   LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAV----  294

Query  943   YDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFP  1122
                   GEREIQRTMLELLNQLDGFDSRGDVK                            
Sbjct  295   -RCPLSGEREIQRTMLELLNQLDGFDSRGDVK----------------------------  325

Query  1123  LPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  1302
                         IHT+RMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV
Sbjct  326   ------------IHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKV  373

Query  1303  THadfkkakdkvmfkkkEGVPEGLYM  1380
             THADFKKAK+KVMFKKKEGVPEGLYM
Sbjct  374   THADFKKAKEKVMFKKKEGVPEGLYM  399



>ref|XP_011640062.1| PREDICTED: 26S protease regulatory subunit 4 [Pogonomyrmex barbatus]
Length=440

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/417 (80%), Positives = 383/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKRRIKGPDAALKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+Y DIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYTDIGGLDTQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTLAPDVNLAEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTSDDFKKSKESVLYRKKEGSPEGLYL  440



>ref|XP_009829202.1| 26S protease regulatory subunit 4 [Aphanomyces astaci]
 gb|ETV81344.1| 26S protease regulatory subunit 4 [Aphanomyces astaci]
Length=440

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/443 (77%), Positives = 394/443 (89%), Gaps = 3/443 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQG   GL     GD+K++  K KKFEP      + RK++K+KG  AA R+P V P  K
Sbjct  1     MGQGQ-SGLPGSKKGDKKDEPPKKKKFEPRG--GAITRKRKKKKGPSAATRIPAVFPTAK  57

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             CKLRLLKLERIKD+LLMEEEF+ NQE +KP++EK EE+RSKVDDLRG+PM VG LEE+ID
Sbjct  58    CKLRLLKLERIKDFLLMEEEFIKNQEVMKPKQEKDEEERSKVDDLRGTPMGVGTLEEMID  117

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             +NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV++VVG+L +D DPMVSVMKV+
Sbjct  118   DNHAIVSSSVGPEYYVSVMSFVNQDLLEAGCSVLLHNKVMAVVGILSNDTDPMVSVMKVD  177

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAPLESYADIGGLD QIQEIKEAVELPLTHPELYE IGIKPPKGVILYGEPGTGKTLLAK
Sbjct  178   KAPLESYADIGGLDQQIQEIKEAVELPLTHPELYEGIGIKPPKGVILYGEPGTGKTLLAK  237

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVAN TSATFLRVVGSELIQKYLGDGPKLVRE+FRVAD+ +PSIVFIDEIDAVG+KRYD+
Sbjct  238   AVANQTSATFLRVVGSELIQKYLGDGPKLVREMFRVADDHAPSIVFIDEIDAVGSKRYDS  297

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
              SGG REIQRTMLELLNQLDGFD RGDVKVI+ATN IESLDPAL+RPGRIDRKIEFPLPD
Sbjct  298   SSGGTREIQRTMLELLNQLDGFDERGDVKVIMATNSIESLDPALIRPGRIDRKIEFPLPD  357

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
             +KT+RRIF IHT+RM+LA+DV+LEEF+M+KDE SGADIKA+CTE+GLLALRERRM+VT  
Sbjct  358   VKTKRRIFSIHTSRMSLAEDVDLEEFIMSKDELSGADIKAVCTESGLLALRERRMRVTQT  417

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DF+KAK+K ++KKK  +PEGLY+
Sbjct  418   DFRKAKEKALYKKKANIPEGLYL  440



>gb|ESA02536.1| hypothetical protein GLOINDRAFT_337332 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52664.1| proteasome regulatory particle base subunit RPT2 [Rhizophagus 
irregularis DAOM 197198w]
Length=444

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/417 (80%), Positives = 383/417 (92%), Gaps = 3/417 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+  G +A ++LP V P T+C+L+LLK+ERIKDYLLMEEEFV NQE
Sbjct  31    WEPPLP-TRVGKKKRR--GPDATSKLPAVYPTTRCRLKLLKMERIKDYLLMEEEFVQNQE  87

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             +LKPQEEK +E+R +VDDLRGSPM VG LEE+ID++HAIVSSS GPEYYVSILSFVDKD 
Sbjct  88    QLKPQEEKAQEERIRVDDLRGSPMGVGTLEEIIDDDHAIVSSSTGPEYYVSILSFVDKDL  147

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC+IL+H+K +SVVG+LQDD DPMVSVMK+EKAP ESYADIGGL+ QIQEIKE+VEL
Sbjct  148   LEPGCSILLHHKAMSVVGVLQDDTDPMVSVMKLEKAPTESYADIGGLEQQIQEIKESVEL  207

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  208   PLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  267

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  268   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  327

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IESLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT RMTLA DV+LEEF
Sbjct  328   DVKVIMATNRIESLDPALIRPGRIDRKIEFPLPDVKTKRRIFNIHTGRMTLAGDVDLEEF  387

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTEAGLLALRERRMKV   DF+KA++KV+++K EG PEGLY+
Sbjct  388   VMSKDDLSGADIKAICTEAGLLALRERRMKVIAEDFRKAREKVLYRKTEGTPEGLYL  444



>emb|CDH57868.1| 26s proteasome subunit p45 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=437

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 385/417 (92%), Gaps = 3/417 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP AP   VGR  RK++G + +++LP V P T+C+L+ LK+ERIKDYLL+EEEFV NQE
Sbjct  24    WEPPAP-THVGR--RKKRGPDTSSKLPPVYPNTRCRLKTLKMERIKDYLLLEEEFVQNQE  80

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKP EE+ +E+R++VDDLRGSPM+VG LEE+ID++H IVSSSVGPEYYVS++SFVDKDQ
Sbjct  81    RLKPAEERDQEERTRVDDLRGSPMAVGTLEEIIDDDHVIVSSSVGPEYYVSVMSFVDKDQ  140

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+H+K ++VVG+LQDD DPMVSVMK+EKAP ESYADIGGL+ QIQEIKEAVEL
Sbjct  141   LEPGCSVLLHHKTMAVVGVLQDDTDPMVSVMKLEKAPTESYADIGGLETQIQEIKEAVEL  200

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDG
Sbjct  201   PLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG  260

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +P+IVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  261   PKLVRELFRVAEENAPAIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDSRG  320

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATNKI+SLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT+RMTLADDV+LEEF
Sbjct  321   DVKVIMATNKIDSLDPALIRPGRIDRKIEFPLPDVKTKRRIFNIHTSRMTLADDVDLEEF  380

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTEAGLLALRERRMKV   DF+KA++KV+++K EG PEGLY+
Sbjct  381   VMSKDDLSGADIKAICTEAGLLALRERRMKVVAEDFRKAREKVLYRKSEGTPEGLYL  437



>emb|CDH57869.1| 26s proteasome subunit p45 [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS06375.1| Putative Probable RPT2-26S proteasomeFT regulatory subunit [Absidia 
idahoensis var. thermophila]
Length=439

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 385/417 (92%), Gaps = 3/417 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP AP   VGR  RK++G + +++LP V P T+C+L+ LK+ERIKDYLL+EEEFV NQE
Sbjct  26    WEPPAP-THVGR--RKKRGPDTSSKLPPVYPNTRCRLKTLKMERIKDYLLLEEEFVQNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKP EE+ +E+R++VDDLRGSPM+VG LEE+ID++H IVSSSVGPEYYVS++SFVDKDQ
Sbjct  83    RLKPAEERDQEERTRVDDLRGSPMAVGTLEEIIDDDHVIVSSSVGPEYYVSVMSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+H+K ++VVG+LQDD DPMVSVMK+EKAP ESYADIGGL+ QIQEIKEAVEL
Sbjct  143   LEPGCSVLLHHKTMAVVGVLQDDTDPMVSVMKLEKAPTESYADIGGLETQIQEIKEAVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDG
Sbjct  203   PLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +P+IVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEENAPAIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATNKI+SLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT+RMTLADDV+LEEF
Sbjct  323   DVKVIMATNKIDSLDPALIRPGRIDRKIEFPLPDVKTKRRIFNIHTSRMTLADDVDLEEF  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTEAGLLALRERRMKV   DF+KA++KV+++K EG PEGLY+
Sbjct  383   VMSKDDLSGADIKAICTEAGLLALRERRMKVVAEDFRKAREKVLYRKSEGTPEGLYL  439



>gb|AII16487.1| 26S protease regulatory subunit 4, partial [Paracyclopina nana]
Length=439

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++  KG + A++LP +TP TKC+LRLLK ERIKDYLLMEEEF++NQE
Sbjct  24    YEPPVP-TRVGKKRKAAKGPDTASKLPLITPHTKCRLRLLKQERIKDYLLMEEEFISNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  83    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLSDDTDPMVAVMKLEKAPQETYADIGGLDQQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GI+PPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIRPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+I+SLDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT +MTL+DDVN++E 
Sbjct  323   DVKVIMATNRIDSLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTNKMTLSDDVNIDEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +++KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++K+EG PEGLY+
Sbjct  383   ILSKDDLSGADIKAICTEAGLMALRERRMKVTDEDFKKSKENVLYRKQEGSPEGLYL  439



>ref|XP_002501620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62878.1| predicted protein [Micromonas sp. RCC299]
Length=444

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/409 (81%), Positives = 379/409 (93%), Gaps = 1/409 (0%)
 Frame = +1

Query  154   RVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK  333
             RVG+K +K KG + A RLP V P +KC LR LKLER+KD+LLMEEEFV NQER+KP  E+
Sbjct  37    RVGKKLKK-KGIDGATRLPDVAPASKCLLRKLKLERVKDWLLMEEEFVTNQERIKPHTER  95

Query  334   TEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAIL  513
               +D+SKVD+LRGSPMSVGNLEE+ID+NH IVSSS GPEYYVSI+SFVDK QLEPGC++L
Sbjct  96    AADDQSKVDELRGSPMSVGNLEEIIDDNHCIVSSSSGPEYYVSIMSFVDKSQLEPGCSVL  155

Query  514   MHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELY  693
             +HNK  +VVG+L DDVDPMVSVMKV+KAPLESYAD+GGL+ QIQEIKEAVELPLTHPELY
Sbjct  156   LHNKTNAVVGVLADDVDPMVSVMKVDKAPLESYADVGGLEEQIQEIKEAVELPLTHPELY  215

Query  694   EDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELF  873
             EDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSA+FLRVVGSELIQKYLGDGPKLVRELF
Sbjct  216   EDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSASFLRVVGSELIQKYLGDGPKLVRELF  275

Query  874   RVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILAT  1053
             RVA+++SPSIVFIDEIDA+GTKRYD++SGGE+EIQRTM+ELL Q+DGF++RGDVKVI+AT
Sbjct  276   RVAEDMSPSIVFIDEIDAIGTKRYDSNSGGEKEIQRTMIELLTQMDGFEARGDVKVIMAT  335

Query  1054  NKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFS  1233
             NKIE+LDPALLRPGRIDRKIEFPLPD+KT+R IF IHT+RM L++DVN+EEFVM KDE S
Sbjct  336   NKIETLDPALLRPGRIDRKIEFPLPDVKTKRHIFGIHTSRMNLSEDVNMEEFVMAKDELS  395

Query  1234  GADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             GADIKA+CTEAGLLALRERRM+VTH DF KAK+KV++KKKEGVPEG++M
Sbjct  396   GADIKALCTEAGLLALRERRMQVTHDDFSKAKEKVLYKKKEGVPEGMFM  444



>gb|KDO27797.1| 26S proteasome regulatory subunit 4 A [Saprolegnia parasitica 
CBS 223.65]
Length=440

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/447 (77%), Positives = 392/447 (88%), Gaps = 11/447 (2%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddk----kdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVT  219
             MGQG  G     LPG +K + K    K KKFEP      + RK++K+KG   A R+P V 
Sbjct  1     MGQGQSG-----LPGSKKPEKKDEAPKRKKFEPRG--GAMTRKRKKKKGPSVATRIPAVF  53

Query  220   PLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLE  399
             P  KCKLRLLKLERIKD+LLMEEEF+ NQE +KP++EK EE+RSKVDDLRG+PM VG LE
Sbjct  54    PTAKCKLRLLKLERIKDFLLMEEEFIKNQEVMKPKQEKDEEERSKVDDLRGTPMGVGTLE  113

Query  400   ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  579
             E+ID+NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV++VVG+L +D DPMVSV
Sbjct  114   EMIDDNHAIVSSSVGPEYYVSVMSFVNQDMLEAGCSVLLHNKVMAVVGILSNDTDPMVSV  173

Query  580   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  759
             MKV+KAPLESYADIGGLD QIQEIKEAVELPLTHPELYE IGIKPPKGVILYGEPGTGKT
Sbjct  174   MKVDKAPLESYADIGGLDQQIQEIKEAVELPLTHPELYEGIGIKPPKGVILYGEPGTGKT  233

Query  760   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK  939
             LLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRE+FRVAD+ +PSIVFIDEIDAVG+K
Sbjct  234   LLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVREMFRVADDHAPSIVFIDEIDAVGSK  293

Query  940   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEF  1119
             RYD+ SGG REIQRTMLELLNQLDGFD RGDVKVI+ATN IESLDPAL+RPGRIDRKIEF
Sbjct  294   RYDSSSGGTREIQRTMLELLNQLDGFDERGDVKVIMATNAIESLDPALIRPGRIDRKIEF  353

Query  1120  PLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  1299
             PLPD+KT+RRIF IHT+RM+L+DDV LEEFVM+KDE SGADIKA+CTEAGLLALRERRM+
Sbjct  354   PLPDVKTKRRIFAIHTSRMSLSDDVELEEFVMSKDELSGADIKAVCTEAGLLALRERRMR  413

Query  1300  VTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VT  DF+KAK+K ++KKK  +PEGLY+
Sbjct  414   VTQTDFRKAKEKALYKKKANIPEGLYL  440



>gb|ETP34278.1| 26S protease regulatory subunit 4 [Phytophthora parasitica P10297]
Length=445

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/406 (81%), Positives = 375/406 (92%), Gaps = 0/406 (0%)
 Frame = +1

Query  163   RKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEE  342
             RK+RK+KG  AA  +PTV P  KCKLRLLK+ERIKD+LLME+EF+ NQE +KP++EK EE
Sbjct  40    RKRRKKKGPSAAVHIPTVYPTAKCKLRLLKMERIKDFLLMEQEFIQNQEVMKPKQEKDEE  99

Query  343   DRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHN  522
             +RSKVDDLRG+PM VG LEE+ID+NHAIVSSSVGPEYYV ++SFV++D LEPGC++L+HN
Sbjct  100   ERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVGVMSFVNQDMLEPGCSVLLHN  159

Query  523   KVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDI  702
             KV+SVVG+L DD DPMVSVMKV+KAPLESYADIGGL+ QIQEIKEAVELPLTHPELYE I
Sbjct  160   KVMSVVGILADDTDPMVSVMKVDKAPLESYADIGGLETQIQEIKEAVELPLTHPELYEGI  219

Query  703   GIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVA  882
             GI+PPKGVILYGEPGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDGPKLVRE+FRVA
Sbjct  220   GIRPPKGVILYGEPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKLVREMFRVA  279

Query  883   DELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKI  1062
             D+ +PSIVFIDEIDAVG+KRYD+ SGG REIQRTMLELLNQLDGFD RGDVKVI+ATN I
Sbjct  280   DDHAPSIVFIDEIDAVGSKRYDSSSGGTREIQRTMLELLNQLDGFDERGDVKVIMATNAI  339

Query  1063  ESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGAD  1242
             ESLDPAL+RPGRIDRKIEFPLPDIKT+RRIF IHT RM+LADDV+LEEFVM+KDE SGAD
Sbjct  340   ESLDPALIRPGRIDRKIEFPLPDIKTKRRIFGIHTGRMSLADDVDLEEFVMSKDELSGAD  399

Query  1243  IKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             IKA+CTEAGLLALRERRM+VT +DF+KAK+K ++KKK  +PEGLY+
Sbjct  400   IKAVCTEAGLLALRERRMRVTQSDFRKAKEKALYKKKANIPEGLYL  445



>ref|XP_002431748.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
 gb|EEB19010.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
Length=440

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/443 (77%), Positives = 399/443 (90%), Gaps = 3/443 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQ   GG      GD+K+D +K KK+EP  P  RVG+K+RK KG +AA +LP VTP T+
Sbjct  1     MGQNQSGGTGSG--GDKKDDKEKKKKYEPPIP-TRVGKKKRKTKGPDAALKLPPVTPHTR  57

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             C+L+LLK ERIKDYLLMEEEF+ NQERLKPQEEK EE+RSKVD+LRG+PMSVG LEE+ID
Sbjct  58    CRLKLLKSERIKDYLLMEEEFIRNQERLKPQEEKNEEERSKVDELRGTPMSVGTLEEIID  117

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             +NHAIVS++VG E+YVSI S VDKDQLEPGC++L+++KV +VVG+L DD DP+V+VMK+E
Sbjct  118   DNHAIVSTAVGSEHYVSIFSIVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPLVTVMKLE  177

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAP E+YADIGGLD QIQEIKE+VELPLTHPE YE++GIKPPKGVILYG PGTGKTLLAK
Sbjct  178   KAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAK  237

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD+
Sbjct  238   AVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDS  297

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD
Sbjct  298   NSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPD  357

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
              KT++RIF IHT+RMTLA+DVNL+E +M KD+ SGADIKAICTEAGLLALRERRMKVT+ 
Sbjct  358   EKTKKRIFNIHTSRMTLAEDVNLQELIMAKDDLSGADIKAICTEAGLLALRERRMKVTNE  417

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKK+K+ V+++KKEG PEGLY+
Sbjct  418   DFKKSKESVLYRKKEGTPEGLYL  440



>ref|XP_008605817.1| 26S proteasome regulatory subunit 4 like A [Saprolegnia diclina 
VS20]
 gb|EQC40973.1| 26S proteasome regulatory subunit 4 like A [Saprolegnia diclina 
VS20]
Length=440

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/447 (77%), Positives = 393/447 (88%), Gaps = 11/447 (2%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddk----kdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVT  219
             MGQG  G     LPG++K + K    K KKFEP      + RK++K+KG   A R+P V 
Sbjct  1     MGQGQSG-----LPGNKKPEKKDEAPKRKKFEPRG--GAMTRKRKKKKGPSVATRIPAVF  53

Query  220   PLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLE  399
             P  KCKLRLLKLERIKD+LLMEEEF+ NQE +KP++EK EE+RSKVDDLRG+PM VG LE
Sbjct  54    PTAKCKLRLLKLERIKDFLLMEEEFIKNQEVMKPKQEKDEEERSKVDDLRGTPMGVGTLE  113

Query  400   ELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSV  579
             E+ID+NHAIVSSSVGPEYYVS++SFV++D LE GC++L+HNKV++VVG+L +D DPMVSV
Sbjct  114   EMIDDNHAIVSSSVGPEYYVSVMSFVNQDMLEAGCSVLLHNKVMAVVGILSNDTDPMVSV  173

Query  580   MKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKT  759
             MKV+KAPLESYADIGGLD QIQEIKEAVELPLTHPELYE IGIKPPKGVILYGEPGTGKT
Sbjct  174   MKVDKAPLESYADIGGLDQQIQEIKEAVELPLTHPELYEGIGIKPPKGVILYGEPGTGKT  233

Query  760   LLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTK  939
             LLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRE+FRVAD+ +PSIVFIDEIDAVG+K
Sbjct  234   LLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVREMFRVADDHAPSIVFIDEIDAVGSK  293

Query  940   RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEF  1119
             RYD+ SGG REIQRTMLELLNQLDGFD RGDVKVI+ATN IESLDPAL+RPGRIDRKIEF
Sbjct  294   RYDSSSGGTREIQRTMLELLNQLDGFDERGDVKVIMATNAIESLDPALIRPGRIDRKIEF  353

Query  1120  PLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMK  1299
             PLPD+KT+RRIF IHT+RM+L+DDV LEEFVM+KDE SGADIKA+CTEAGLLALRERRM+
Sbjct  354   PLPDVKTKRRIFAIHTSRMSLSDDVELEEFVMSKDELSGADIKAVCTEAGLLALRERRMR  413

Query  1300  VTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VT  DF+KAK+K ++KKK  +PEGLY+
Sbjct  414   VTQTDFRKAKEKALYKKKANIPEGLYL  440



>ref|XP_002165829.1| PREDICTED: 26S protease regulatory subunit 4-like [Hydra vulgaris]
Length=441

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/418 (80%), Positives = 386/418 (92%), Gaps = 2/418 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRK-QRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQ  306
             +EP  P  RVG+K ++K +G + A +LP VTP   C+L+LLKLERIKD+LLMEEEF+ NQ
Sbjct  25    YEPPIP-TRVGKKAKKKNRGPDTANKLPQVTPHRNCRLKLLKLERIKDFLLMEEEFIQNQ  83

Query  307   ERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKD  486
             ERLKPQEEK EE+RSKVDDLRG+PMSVG+LEE+ID+NHAIVS+SVG E+YV+ILSFVDKD
Sbjct  84    ERLKPQEEKHEEERSKVDDLRGTPMSVGSLEEIIDDNHAIVSTSVGSEHYVNILSFVDKD  143

Query  487   QLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVE  666
              LEPGC++L+++KV +VVG+L +D DPMVSVMK+EKAP E+YADIGGLD QIQEIKE+VE
Sbjct  144   LLEPGCSVLLNHKVHAVVGVLGEDTDPMVSVMKLEKAPTETYADIGGLDTQIQEIKESVE  203

Query  667   LPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGD  846
             LPLTHPELYE++GIKPPKGVILYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGD
Sbjct  204   LPLTHPELYEEMGIKPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGD  263

Query  847   GPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSR  1026
             GPKLVRELFRVA+E SPSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSR
Sbjct  264   GPKLVRELFRVAEEHSPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSR  323

Query  1027  GDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEE  1206
             GDVKVI+ATN+I+SLDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT RMTLADDV+LEE
Sbjct  324   GDVKVIMATNRIDSLDPALIRPGRIDRKIEFPLPDQKTKRRIFNIHTGRMTLADDVDLEE  383

Query  1207  FVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +++ KD+ SGADIKAICTEAGLLALRERRMKVT+ DFKKAK+ V+++K+EG PEGLY+
Sbjct  384   YIVAKDDLSGADIKAICTEAGLLALRERRMKVTNEDFKKAKENVLYRKQEGTPEGLYL  441



>gb|ACO12018.1| 26S protease regulatory subunit 4 [Lepeophtheirus salmonis]
Length=438

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+++ +G +AA +LP VTP TKC+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPVP-TRVGKKRKRARGPDAANKLPLVTPHTKCRLKLLKLERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
              LKPQEEK EE+RSKVDDLRG+PMSVG+LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    VLKPQEEKNEEERSKVDDLRGTPMSVGSLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L++++V +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHRVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDQQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E SPSIVFIDEIDAVGTKRYD++ GGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHSPSIVFIDEIDAVGTKRYDSNCGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IESLDPAL+RPGRIDRKIEFP+PD KT++RIF IHT++MTLA DVN+EE+
Sbjct  322   DVKVIMATNRIESLDPALIRPGRIDRKIEFPIPDEKTKKRIFGIHTSKMTLASDVNVEEY  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT  DFKK+K+ V+++K+EG PEGLY+
Sbjct  382   IMAKDDLSGADIKAICTEAGLMALRERRMKVTDEDFKKSKENVLYRKQEGTPEGLYL  438



>ref|XP_008875734.1| 26S protease regulatory subunit 4 [Aphanomyces invadans]
 gb|ETV95541.1| 26S protease regulatory subunit 4 [Aphanomyces invadans]
Length=440

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 379/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP      + RK++K+KG  AA R+P V P  KCKLRLLKLERIKD+LLMEEEF+ NQE
Sbjct  26    FEPRG--GAITRKRKKKKGPSAATRIPAVFPTAKCKLRLLKLERIKDFLLMEEEFIKNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
              +KP++EK EE+RSKVDDLRG+PM VG LEE+ID+NHAIVSSSVGPEYYVS++SFV++D 
Sbjct  84    VMKPKQEKDEEERSKVDDLRGTPMGVGTLEEMIDDNHAIVSSSVGPEYYVSVMSFVNQDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LE GC++L+HNKV++VVG+L +D DPMVSVMKV+KAPLESYADIGGLD QIQEIKEAVEL
Sbjct  144   LEAGCSVLLHNKVMAVVGILSNDTDPMVSVMKVDKAPLESYADIGGLDQQIQEIKEAVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE IGI+PPKGVILYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPELYEGIGIRPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRE+FRVAD+ +PSIVFIDEIDAVG+KRYD+ SGG REIQRTMLELLNQLDGFD RG
Sbjct  264   PKLVREMFRVADDHAPSIVFIDEIDAVGSKRYDSSSGGTREIQRTMLELLNQLDGFDERG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN IESLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT+RM+LADDV+LEEF
Sbjct  324   DVKVIMATNSIESLDPALIRPGRIDRKIEFPLPDVKTKRRIFAIHTSRMSLADDVDLEEF  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M+KDE SGADIKA+CTE+GLLALRERRM+VT  DF+KAK+K ++KKK  +PEGLY+
Sbjct  384   IMSKDELSGADIKAVCTESGLLALRERRMRVTQTDFRKAKEKALYKKKANIPEGLYL  440



>ref|XP_011504351.1| PREDICTED: 26S protease regulatory subunit 4 [Ceratosolen solmsi 
marchali]
Length=440

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+ KG +AA +LP VTP T+C+L+LLKL+RIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKRRTKGPDAALKLPQVTPHTRCRLKLLKLDRIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  84    RLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGL+ QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLEVQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             P+THPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PMTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIF IHT+RMTLA DVNL E 
Sbjct  324   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFSIHTSRMTLAPDVNLTEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKA+CTEAGL+ALRERRMKVT  DFKK+K+ V+++KKEG PEGLY+
Sbjct  384   IMAKDDLSGADIKAVCTEAGLMALRERRMKVTSEDFKKSKESVLYRKKEGSPEGLYL  440



>emb|CEG65804.1| Putative 26s protease regulatory subunit 4 [Rhizopus microsporus]
Length=438

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/417 (79%), Positives = 384/417 (92%), Gaps = 3/417 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K  K++G +  A+LP V P T+C+L++LK+ERIKDYLL+EEEFV NQE
Sbjct  25    WEPPVP-TRVGKK--KKRGPDTTAKLPQVFPTTRCRLKMLKMERIKDYLLLEEEFVQNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEE+ +E+R++VDDLRGSPM+VG+LEE+ID++H IVSS+ GPEYYVS++SFVDKD 
Sbjct  82    RLKPQEERDQEERTRVDDLRGSPMTVGSLEEIIDDDHVIVSSATGPEYYVSVMSFVDKDL  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+H+K +SVVG+L DD DPMVSVMK+EKAP ESYADIGGL+ QIQEIKEAVEL
Sbjct  142   LEPGCSVLLHHKTMSVVGVLADDTDPMVSVMKLEKAPTESYADIGGLEKQIQEIKEAVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDG
Sbjct  202   PLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEENAPSIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATNKIESLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT+RMTLA+DV+LEEF
Sbjct  322   DVKVIMATNKIESLDPALIRPGRIDRKIEFPLPDVKTKRRIFNIHTSRMTLAEDVDLEEF  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTEAGL+ALRERRMKV   DF+KA++KV+++K EG PEGLY+
Sbjct  382   VMSKDDLSGADIKAICTEAGLMALRERRMKVVAEDFRKAREKVLYRKSEGTPEGLYL  438



>ref|XP_003746341.1| PREDICTED: 26S protease regulatory subunit 4-like [Metaseiulus 
occidentalis]
Length=438

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/417 (80%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+++ KG  AA++LP VTP  +C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPVP-TRVGKKKKRAKGPVAASKLPLVTPHARCRLKLLKLERIKDYLLMEEEFLRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDD RGSPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  82    RLKPQEEKHEEERSKVDDHRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDQQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GI+PPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIRPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHTARMTLA DV ++E 
Sbjct  322   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTARMTLAGDVAVDEL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V+++KKEG+PEGLY+
Sbjct  382   VMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYRKKEGMPEGLYL  438



>dbj|BAD96388.1| proteasome 26S ATPase subunit 1 variant [Homo sapiens]
Length=440

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+++ KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKRTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>emb|CEP14990.1| hypothetical protein [Parasitella parasitica]
Length=447

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/417 (78%), Positives = 384/417 (92%), Gaps = 3/417 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K  K++G +  A+LP V P T+C+L++LK+ERIKDYLL+EEEFV NQE
Sbjct  34    WEPPVP-TRVGKK--KKRGPDTTAKLPQVFPTTRCRLKMLKMERIKDYLLLEEEFVQNQE  90

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEE+ +E+R++VDDLRGSPM+VG+LEE+ID++H IVSS+ GPEYYVS++SFVDKD 
Sbjct  91    RLKPQEERDQEERTRVDDLRGSPMTVGSLEEIIDDDHVIVSSATGPEYYVSVMSFVDKDL  150

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+H+K +SVVG+L DD DPMVSVMK+EKAP ESYADIGGL+ Q+QEIKEAVEL
Sbjct  151   LEPGCSVLLHHKTMSVVGVLGDDTDPMVSVMKLEKAPTESYADIGGLEQQVQEIKEAVEL  210

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDG
Sbjct  211   PLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG  270

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +P+IVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  271   PKLVRELFRVAEENAPAIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDSRG  330

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATNKI+SLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT+RMTLADDV+LEEF
Sbjct  331   DVKVIMATNKIDSLDPALIRPGRIDRKIEFPLPDVKTKRRIFNIHTSRMTLADDVDLEEF  390

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTEAGL+ALRERRMKV   DF+KAK+KV+++K EG PEGLY+
Sbjct  391   VMSKDDLSGADIKAICTEAGLMALRERRMKVVAEDFRKAKEKVLYRKSEGTPEGLYL  447



>ref|XP_010876963.1| PREDICTED: 26S protease regulatory subunit 4 [Esox lucius]
Length=440

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/417 (79%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT+RMT+ADDV L+E 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTVADDVTLDEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>dbj|GAN01086.1| 26S proteasome subunit P45 [Mucor ambiguus]
Length=438

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/417 (78%), Positives = 384/417 (92%), Gaps = 3/417 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K  K++G +  A+LP V P T+C+L++LK+ERIKDYLL+EEEFV NQE
Sbjct  25    WEPPVP-TRVGKK--KKRGPDTTAKLPQVFPTTRCRLKMLKMERIKDYLLLEEEFVQNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEE+ +E+R++VDDLRGSPM+VG+LEE+ID++H IVSS+ GPEYYVS++SFVDKD 
Sbjct  82    RLKPQEERDQEERTRVDDLRGSPMTVGSLEEIIDDDHVIVSSATGPEYYVSVMSFVDKDL  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+H+K +SVVG+L DD DPMVSVMK+EKAP ESYADIGGL+ Q+QEIKEAVEL
Sbjct  142   LEPGCSVLLHHKTMSVVGVLGDDTDPMVSVMKLEKAPTESYADIGGLEQQVQEIKEAVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDG
Sbjct  202   PLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEENAPSIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATNKI+SLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT+RMTLADDV+LEEF
Sbjct  322   DVKVIMATNKIDSLDPALIRPGRIDRKIEFPLPDVKTKRRIFNIHTSRMTLADDVDLEEF  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTE+GL+ALRERRMKV   DF+KAK+KV+++K EG PEGLY+
Sbjct  382   VMSKDDLSGADIKAICTESGLMALRERRMKVVAEDFRKAKEKVLYRKSEGTPEGLYL  438



>gb|EPB87829.1| 26S protease regulatory subunit 4 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=431

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/417 (78%), Positives = 384/417 (92%), Gaps = 3/417 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K  K++G +  A+LP V P T+C+L++LK+ERIKDYLL+EEEFV NQE
Sbjct  18    WEPPVP-TRVGKK--KKRGPDTTAKLPQVFPTTRCRLKMLKMERIKDYLLLEEEFVQNQE  74

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEE+ +E+R++VDDLRGSPM+VG+LEE+ID++H IVSS+ GPEYYVS++SFVDKD 
Sbjct  75    RLKPQEERDQEERTRVDDLRGSPMTVGSLEEIIDDDHVIVSSATGPEYYVSVMSFVDKDL  134

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+H+K +SVVG+L DD DPMVSVMK+EKAP ESYADIGGL+ Q+QEIKEAVEL
Sbjct  135   LEPGCSVLLHHKTMSVVGVLGDDTDPMVSVMKLEKAPTESYADIGGLEQQVQEIKEAVEL  194

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDG
Sbjct  195   PLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG  254

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  255   PKLVRELFRVAEENAPSIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDSRG  314

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATNKI+SLDPAL+RPGRIDRKIEFPLPD+KT+RRIF IHT+RMTLADDV+LEEF
Sbjct  315   DVKVIMATNKIDSLDPALIRPGRIDRKIEFPLPDVKTKRRIFNIHTSRMTLADDVDLEEF  374

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM+KD+ SGADIKAICTE+GL+ALRERRMKV   DF+KAK+KV+++K EG PEGLY+
Sbjct  375   VMSKDDLSGADIKAICTESGLMALRERRMKVVAEDFRKAKEKVLYRKSEGTPEGLYL  431



>ref|XP_009065811.1| hypothetical protein LOTGIDRAFT_197242 [Lottia gigantea]
 gb|ESO83556.1| hypothetical protein LOTGIDRAFT_197242 [Lottia gigantea]
Length=440

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/443 (77%), Positives = 400/443 (90%), Gaps = 3/443 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQ   GG      GD+ +D  K KK+EP  P  RVG+K++K KG +AA +LP VTP T+
Sbjct  1     MGQKQSGGTGGA--GDKSDDKDKKKKYEPPVP-TRVGKKKKKLKGPDAATKLPQVTPYTR  57

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             C+L+LLKLERIKDYLLMEEEF+ NQERLKPQEEK EE+R+KVD+LRGSPMSVGN+EE+ID
Sbjct  58    CRLKLLKLERIKDYLLMEEEFIKNQERLKPQEEKHEEERTKVDELRGSPMSVGNMEEIID  117

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             +NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L+++KV +VVG+L DD DPMV+VMK+E
Sbjct  118   DNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVNVMKLE  177

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAP E+YADIGGLD+QIQEIKE+VELPLTHPE YE++GIKPPKGVILYG PGTGKTLLAK
Sbjct  178   KAPQETYADIGGLDSQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAK  237

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD+
Sbjct  238   AVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDS  297

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDS GDVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD
Sbjct  298   NSGGEREIQRTMLELLNQLDGFDSHGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPD  357

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
              KT+RRI  IHT+RMTLADDVN++++VM+KD+ SGADIKAICTE GLLALRERRMK+T+ 
Sbjct  358   EKTKRRILTIHTSRMTLADDVNIDDYVMSKDDLSGADIKAICTEGGLLALRERRMKITNE  417

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKKAK+ V+++K EG PEGLY+
Sbjct  418   DFKKAKENVLYRKNEGTPEGLYL  440



>ref|XP_010880812.1| PREDICTED: 26S protease regulatory subunit 4-like [Esox lucius]
Length=440

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/417 (78%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+++RK KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKRKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMT+ADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTVADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>gb|ACI68908.1| 26S protease regulatory subunit 4 [Salmo salar]
Length=440

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/417 (78%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRT+LELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTLLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT+RMT+ADDV L+E 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTVADDVTLDEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_007253845.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X1 
[Astyanax mexicanus]
 ref|XP_007253846.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X2 
[Astyanax mexicanus]
Length=440

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/417 (78%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+++ KG +AA++LP VTP T+C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKKKKRTKGPDAASKLPLVTPHTQCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT+RMT+ADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTVADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_011425280.1| PREDICTED: 26S protease regulatory subunit 4 [Crassostrea gigas]
Length=441

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/417 (80%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG + A++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  26    YEPPVP-TRVGKKKKKMKGPDTASKLPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQE  84

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+R+KVD+LRGSPMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKDQ
Sbjct  85    RLKPQEEKHEEERTKVDELRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQ  144

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  145   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDQQIQEIKESVEL  204

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  205   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  264

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  265   PKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  324

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT RMTLA+DVN++++
Sbjct  325   DVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTNRMTLAEDVNIDDY  384

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM KD+ SGADIKAICTEAGLLALRERRMKVT+ DFK AK+ V+++K EG PEGLY+
Sbjct  385   VMAKDDLSGADIKAICTEAGLLALRERRMKVTNEDFKSAKENVLYRKNEGTPEGLYL  441



>gb|ACH85269.1| proteasome (prosome, macropain) 26S subunit, ATPase 1a [Salmo 
salar]
Length=438

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/417 (78%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  23    YEPPIP-TRVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQE  81

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  82    QMKPLEEKQEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  141

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQEIKE+VEL
Sbjct  142   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQEIKESVEL  201

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  202   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  261

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRT+LELLNQLDGFDSRG
Sbjct  262   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTLLELLNQLDGFDSRG  321

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMT+ADDV L++ 
Sbjct  322   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTVADDVTLDDL  381

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  382   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  438



>gb|KDD76237.1| AAA+ ATPase [Helicosporidium sp. ATCC 50920]
Length=445

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/417 (79%), Positives = 380/417 (91%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEA-AARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQ  306
             +EP  PP RVGRKQR+   +    ++LPTVTP  +C+LRLLKLER+KD+LL+EE++V+NQ
Sbjct  28    YEPPVPPPRVGRKQRRASAAAGLGSKLPTVTPTARCRLRLLKLERVKDWLLLEEDYVSNQ  87

Query  307   ERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKD  486
             ERL+P+EE+ EEDR++VDDLRGSP+SVG LEELIDENHAIVSSSVGPEYYV+I+SFVDK 
Sbjct  88    ERLRPREERLEEDRTRVDDLRGSPLSVGTLEELIDENHAIVSSSVGPEYYVAIMSFVDKS  147

Query  487   QLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVE  666
             QLEPGC++L+HNK + +VG+L D+ D  VSVMKV+ AP E+YAD+GGL+ Q+QEIKEAVE
Sbjct  148   QLEPGCSVLLHNKGMHIVGILADEADAAVSVMKVDHAPTETYADVGGLEQQVQEIKEAVE  207

Query  667   LPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGD  846
             LPLTHPELYED+GIKPPKGVILYGEPGTGKTLLAKAVANSTSA+FLRVVGSELIQKYLGD
Sbjct  208   LPLTHPELYEDVGIKPPKGVILYGEPGTGKTLLAKAVANSTSASFLRVVGSELIQKYLGD  267

Query  847   GPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSR  1026
             GPKLVRELFR ADELSPSIVFIDEIDAVGTKRYDA SGGEREIQRTMLELLNQLDGFDS 
Sbjct  268   GPKLVRELFRTADELSPSIVFIDEIDAVGTKRYDAQSGGEREIQRTMLELLNQLDGFDSL  327

Query  1027  GDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEE  1206
              DVKVI+ATN+I+SLDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RM+LA+DV+ +E
Sbjct  328   HDVKVIMATNRIDSLDPALIRPGRIDRKIEFPLPDAKTKRRIFSIHTSRMSLAEDVSADE  387

Query  1207  FVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLY  1377
             FV  KDE SGADIKA+CTEAGLLALRERRM+VTHADF KAK+KV+ KKKE VPEGLY
Sbjct  388   FVTAKDELSGADIKAMCTEAGLLALRERRMRVTHADFVKAKEKVLGKKKESVPEGLY  444



>ref|XP_010780333.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Notothenia 
coriiceps]
 ref|XP_010780334.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Notothenia 
coriiceps]
Length=440

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/417 (78%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA++LP VTP T+C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKKKTKGPDAASKLPLVTPHTQCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLDAQIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDAQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMT+ADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTVADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>gb|ACN10996.1| 26S protease regulatory subunit 4 [Salmo salar]
Length=440

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/417 (78%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRT+LELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTLLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMT+ADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTVADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_004924561.1| PREDICTED: 26S protease regulatory subunit 4-like, partial [Bombyx 
mori]
Length=392

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/392 (83%), Positives = 370/392 (94%), Gaps = 0/392 (0%)
 Frame = +1

Query  205   LPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMS  384
             LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQERLKPQEEK EE+RSKVDDLRG+PMS
Sbjct  1     LPQVTPHTRCRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKIEEERSKVDDLRGTPMS  60

Query  385   VGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVD  564
             VGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L+++KV +VVG+L DD D
Sbjct  61    VGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTD  120

Query  565   PMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEP  744
             PMVSVMK+EKAP E+YADIGGLD QIQEIKE+VELPLTHPE YE++GIKPPKGVILYG P
Sbjct  121   PMVSVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPP  180

Query  745   GTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEID  924
             GTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +PSIVFIDEID
Sbjct  181   GTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEID  240

Query  925   AVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRID  1104
             AVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATN+IE+LDPAL+RPGRID
Sbjct  241   AVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRID  300

Query  1105  RKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALR  1284
             RKIEFPLPD KT+RRIF IHT+RMTLADDVNL E +M+KD+ SGADIKAICTEAGL+ALR
Sbjct  301   RKIEFPLPDEKTKRRIFTIHTSRMTLADDVNLSELIMSKDDLSGADIKAICTEAGLMALR  360

Query  1285  ERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  361   ERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL  392



>gb|ELU12421.1| hypothetical protein CAPTEDRAFT_160726 [Capitella teleta]
Length=439

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/417 (79%), Positives = 387/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPIP-TRVGKRKKKMKGPDAANKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKPQEEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVS+LSFVDKDQ
Sbjct  83    RLKPQEEKEEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSVLSFVDKDQ  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVIL+G PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILHGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDS+G
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSKG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IESLDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DV+LE++
Sbjct  323   DVKVIMATNRIESLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLANDVDLEDY  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTE GLLALRERRMKVT+ DFKKAK+ V+++K EG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEGGLLALRERRMKVTNEDFKKAKENVLYRKNEGTPEGLYL  439



>ref|XP_001604655.1| PREDICTED: 26S protease regulatory subunit 4 [Nasonia vitripennis]
Length=464

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/438 (78%), Positives = 393/438 (90%), Gaps = 5/438 (1%)
 Frame = +1

Query  55    GQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKC  234
              Q  PGG      GD+K+D  K KK+EP  P  RVG+K+R+ KG +AA +LP VTP T+C
Sbjct  4     NQSGPGGAG----GDKKDDKDKKKKYEPPVP-TRVGKKKRRTKGPDAALKLPQVTPHTRC  58

Query  235   KLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDE  414
             +L+LLKLERIKDYLLMEEEF+ NQERLKPQEEK EE+RSKVDDLRG+PMSVG LEE+ID+
Sbjct  59    RLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDD  118

Query  415   NHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEK  594
             NHAIVS+SVG E+YVSILSFVDKDQLEPGC++L+++KV +VVG+L DD DPMV+VMK+EK
Sbjct  119   NHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEK  178

Query  595   APLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKA  774
             AP E+YADIGGLD QIQEIKE+VELP+THPE YE++GIKPPKGVILYG PGTGKTLLAKA
Sbjct  179   APQETYADIGGLDVQIQEIKESVELPMTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKA  238

Query  775   VANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAH  954
             VAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD++
Sbjct  239   VANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSN  298

Query  955   SGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDI  1134
             SGGEREIQRTMLELLNQLDGFDSRGDVKV++ATN+IE+LDPAL+RPGRIDRKIEFPLPD 
Sbjct  299   SGGEREIQRTMLELLNQLDGFDSRGDVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDE  358

Query  1135  KTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHad  1314
             KT++RIF IHT+RMTLA DVNL E +M KD+ SGADIKAICTEAGL+ALRERRMKVT  D
Sbjct  359   KTKKRIFSIHTSRMTLAPDVNLTELIMAKDDLSGADIKAICTEAGLMALRERRMKVTSED  418

Query  1315  fkkakdkvmfkkkEGVPE  1368
             FKK+K+ V+++KKEG PE
Sbjct  419   FKKSKESVLYRKKEGSPE  436



>ref|XP_004083702.1| PREDICTED: 26S protease regulatory subunit 4 [Oryzias latipes]
Length=440

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/417 (78%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA++LP +TP T+C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKKKTKGPDAASKLPLITPHTQCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT+RMT+ADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTVADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>emb|CDJ05993.1| proteasome 26s subunit subunit 4 atpase [Echinococcus multilocularis]
 emb|CDS43275.1| proteasome 26s subunit subunit 4 atpase [Echinococcus multilocularis]
Length=436

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/417 (79%), Positives = 379/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP  P  R+G K ++ KG + A +LP VTP T+CKLRLLKLERIKDYLLMEEEF+ NQE
Sbjct  22    FEPPIP-TRMG-KHKRSKGPDTANKLPQVTPHTRCKLRLLKLERIKDYLLMEEEFIKNQE  79

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLK  EEK EE+RSKVDDLRG+PMSVG LEE+ID+NH IVS+SVG E+YVSILSFVDK  
Sbjct  80    RLKTDEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHVIVSTSVGSEHYVSILSFVDKGM  139

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLDAQIQEIKE+VEL
Sbjct  140   LEPGCSVLLNHKVHAVVGVLTDDTDPMVTVMKLEKAPQETYADIGGLDAQIQEIKESVEL  199

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTH ELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  200   PLTHSELYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  259

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFR+A+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  260   PKLVRELFRLAEENAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  319

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNLE +
Sbjct  320   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLESY  379

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             V +KDE SGADIKA+CTEAGLLALRERRMKVT+ DF+KAK+ V+++K EG PEGLY+
Sbjct  380   VTSKDELSGADIKAMCTEAGLLALRERRMKVTNEDFEKAKENVLYRKSEGTPEGLYL  436



>ref|XP_002141206.1| 26S proteasome subunit 4 [Cryptosporidium muris RN66]
 gb|EEA06857.1| 26S proteasome subunit 4, putative [Cryptosporidium muris RN66]
Length=447

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/413 (78%), Positives = 376/413 (91%), Gaps = 0/413 (0%)
 Frame = +1

Query  142   APPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKP  321
             APP    +++RK K +   +R+PT+ P TKC+LRLLKLER+KDYLLME+EF+   E ++P
Sbjct  35    APPPLEAKRKRKNKNTPHCSRIPTIVPNTKCRLRLLKLERVKDYLLMEQEFITTMESIRP  94

Query  322   QEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPG  501
               E+TEE+ +KVDDLRGSPMS+GNLEE+IDENHAIVSSSVG EYYV+ILSFVDK QL+PG
Sbjct  95    SAERTEEEHTKVDDLRGSPMSIGNLEEIIDENHAIVSSSVGSEYYVNILSFVDKSQLQPG  154

Query  502   CAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTH  681
              ++L+HNKV S+VG++ D+VDP+V+VMKV+KAPLESYADIGGL+ QIQEIKEAVE+PLTH
Sbjct  155   SSVLLHNKVYSIVGIMSDEVDPLVTVMKVDKAPLESYADIGGLEQQIQEIKEAVEIPLTH  214

Query  682   PELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLV  861
             PELY+DIGIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLV
Sbjct  215   PELYDDIGIKPPKGVILYGPPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGDGPKLV  274

Query  862   RELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKV  1041
             RELFRVA+E +PSIVFIDEIDAVGTKR+DAHSGGER+IQRTMLELLNQLDGF+SRGDVKV
Sbjct  275   RELFRVAEENAPSIVFIDEIDAVGTKRHDAHSGGERDIQRTMLELLNQLDGFESRGDVKV  334

Query  1042  ILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTK  1221
             I+ATNKIESLDPAL+RPGRIDRKIE P PD KT+RRIFQIHT +MTLA+DV+LEEFVM K
Sbjct  335   IMATNKIESLDPALIRPGRIDRKIELPNPDTKTKRRIFQIHTNKMTLAEDVDLEEFVMAK  394

Query  1222  DEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             D+ SGADIKAICTEAGLLALRERRMKVT  DF+KAK+K +++KK G+PEGLY+
Sbjct  395   DDISGADIKAICTEAGLLALRERRMKVTQEDFRKAKEKALYRKKGGIPEGLYL  447



>ref|NP_001002091.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1b [Danio 
rerio]
 gb|AAH71538.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1b [Danio 
rerio]
Length=440

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/417 (78%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+++RK KG +AA++LP VTP T+C+L+LLK +RIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKRKSKGPDAASKLPLVTPHTQCRLKLLKQDRIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT+RMT+A+DV+L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTVAEDVSLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>gb|EMD34033.1| hypothetical protein CERSUDRAFT_117543 [Ceriporiopsis subvermispora 
B]
Length=447

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/420 (77%), Positives = 383/420 (91%), Gaps = 4/420 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R +KG  A+++LP + P T+C+LRLLK+ERIKDYLL+EEEF+ NQE
Sbjct  29    WEPPLP-TRVGKKKRTKKGPAASSKLPAIHPTTRCRLRLLKMERIKDYLLLEEEFIVNQE  87

Query  310   RLKPQ---EEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVD  480
             RLKP+   EEK EEDRS+VDDLRGSPM+VG LEE+ID++HAIVS++ GPE+YVSI+SFVD
Sbjct  88    RLKPEATREEKNEEDRSRVDDLRGSPMAVGTLEEIIDDDHAIVSTASGPEFYVSIMSFVD  147

Query  481   KDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEA  660
             KD LEP C +L+H+K  +V+G+LQDD DPMVSVMK++KAP ESYADIGGL+ QIQEIKE+
Sbjct  148   KDLLEPSCQVLLHHKTQAVIGVLQDDTDPMVSVMKLDKAPTESYADIGGLEQQIQEIKES  207

Query  661   VELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYL  840
             VELPLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYL
Sbjct  208   VELPLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRVVGSELIQKYL  267

Query  841   GDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD  1020
             GDGPKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD+ SGGEREIQRTMLELLNQLDGFD
Sbjct  268   GDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSTSGGEREIQRTMLELLNQLDGFD  327

Query  1021  SRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNL  1200
             SRGDVKVI+ATNKIESLDPAL+RPGRIDRKIEFPLPD+KT+R IF++HT+RM+L++DV+L
Sbjct  328   SRGDVKVIMATNKIESLDPALIRPGRIDRKIEFPLPDVKTKRHIFKLHTSRMSLSEDVDL  387

Query  1201  EEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             EEFV TKD+ SGADIKA+CTEAGLLALRERRM+VT ADF  A++KV+++K EG PEGLY+
Sbjct  388   EEFVTTKDDLSGADIKAVCTEAGLLALRERRMRVTKADFTSAREKVLYRKNEGTPEGLYL  447



>gb|ACO10548.1| 26S protease regulatory subunit 4 [Caligus rogercresseyi]
Length=440

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/417 (78%), Positives = 384/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG++++K KG +AA++LP VTP T C+L+LLK ERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPIP-TRVGKRKKKSKGPDAASKLPLVTPHTHCRLKLLKQERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVGNLEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD+QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDSQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLL KAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLTKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRT+LELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTLLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMT+ADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHTSRMTVADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             ++ KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   ILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_007846015.1| putative rpt2-26s proteasome regulatory subunit [Moniliophthora 
roreri MCA 2997]
 gb|ESK94663.1| putative rpt2-26s proteasome regulatory subunit [Moniliophthora 
roreri MCA 2997]
Length=447

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/420 (78%), Positives = 383/420 (91%), Gaps = 6/420 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+R+  G  AA++LP V P T+C+LRL KLERIKDYLL+EEEF+ NQE
Sbjct  31    WEPPLP-TRVGKKKRR--GPSAASKLPAVYPTTRCRLRLYKLERIKDYLLLEEEFIQNQE  87

Query  310   RLKPQ---EEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVD  480
             RLKP+   EEK EEDRSKVDDLRGSPM+VG LEE+ID++HAI+S++ GPE+YV+I+S+VD
Sbjct  88    RLKPESTREEKNEEDRSKVDDLRGSPMAVGTLEEIIDDDHAIISTASGPEFYVTIMSYVD  147

Query  481   KDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEA  660
             KD LEPGC +L+H+K  SVVG+LQDD DPMVSVMK++KAP ESYADIGGLD+QIQEIKE+
Sbjct  148   KDLLEPGCQVLLHHKTQSVVGVLQDDADPMVSVMKLDKAPTESYADIGGLDSQIQEIKES  207

Query  661   VELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYL  840
             VELPLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYL
Sbjct  208   VELPLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRVVGSELIQKYL  267

Query  841   GDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD  1020
             GDGPKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD+ SGGEREIQRTMLELLNQLDGFD
Sbjct  268   GDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSTSGGEREIQRTMLELLNQLDGFD  327

Query  1021  SRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNL  1200
             +RGDVKVI+ATNKIESLDPAL+RPGRIDRKIEFPLPD+KT+R IF++HT+RM L++DV+L
Sbjct  328   TRGDVKVIMATNKIESLDPALIRPGRIDRKIEFPLPDVKTKRHIFKLHTSRMNLSEDVDL  387

Query  1201  EEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             EEFVMTKD+ SGADIKA+CTEAGLLALRERRM+VT ADF  A++KV+++K EG PEGLY+
Sbjct  388   EEFVMTKDDLSGADIKAVCTEAGLLALRERRMRVTKADFTTAREKVLYRKNEGTPEGLYL  447



>ref|XP_005769175.1| hypothetical protein EMIHUDRAFT_355962 [Emiliania huxleyi CCMP1516]
 ref|XP_005772179.1| hypothetical protein EMIHUDRAFT_369395 [Emiliania huxleyi CCMP1516]
 gb|EOD16746.1| hypothetical protein EMIHUDRAFT_355962 [Emiliania huxleyi CCMP1516]
 gb|EOD19750.1| hypothetical protein EMIHUDRAFT_369395 [Emiliania huxleyi CCMP1516]
Length=436

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/411 (80%), Positives = 374/411 (91%), Gaps = 5/411 (1%)
 Frame = +1

Query  148   PARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQE  327
             P RVGRK+RK+ G  A++RLPTV P TKCKLRLLKLER+KDYLLMEEEFVA QE++KPQE
Sbjct  31    PTRVGRKKRKKAGPAASSRLPTVVPATKCKLRLLKLERVKDYLLMEEEFVARQEQVKPQE  90

Query  328   EKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCA  507
             E  +++R+KV+D+RG+P+ V  LEE++D+NHAI+SSS+GPEYYV+ILSFVDKDQLEPGC+
Sbjct  91    ESAQQERTKVEDIRGTPLGVATLEEMVDDNHAIISSSIGPEYYVNILSFVDKDQLEPGCS  150

Query  508   ILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPE  687
             +L HNKV S+VGLL D+ DPMV     +KAP+ESYADIGGL+ QIQEIKEAVELPLTHPE
Sbjct  151   LLTHNKVNSIVGLLADEADPMV-----DKAPVESYADIGGLETQIQEIKEAVELPLTHPE  205

Query  688   LYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRE  867
             LYEDIGI+PPKGVILYGEPGTGKTLLAKAVAN TSATFLRV GSELIQKYLGDGPKLVRE
Sbjct  206   LYEDIGIRPPKGVILYGEPGTGKTLLAKAVANQTSATFLRVTGSELIQKYLGDGPKLVRE  265

Query  868   LFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVIL  1047
             LFRVA+E +P+IVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFD+  DVKVI+
Sbjct  266   LFRVAEENAPTIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDAHVDVKVIM  325

Query  1048  ATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDE  1227
             ATNKIESLDPAL+RPGRIDRKIEFP PD KTRR IFQIHT++M+L+DDVNLEEFVM+KDE
Sbjct  326   ATNKIESLDPALIRPGRIDRKIEFPAPDQKTRRHIFQIHTSKMSLSDDVNLEEFVMSKDE  385

Query  1228  FSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
              SGADIKA+CTEAGLLALRERRMKV+ A+FKKAKD V++KK  G PEGLY+
Sbjct  386   LSGADIKAMCTEAGLLALRERRMKVSQAEFKKAKDYVLYKKHTGAPEGLYL  436



>emb|CDS33761.1| proteasome 26s subunit subunit 4 atpase [Hymenolepis microstoma]
Length=436

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 379/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP  P  R+G K ++ KG + A +LP VTP T+CKLRLLKLERIKDYLLMEEEF+ NQE
Sbjct  22    FEPPIP-TRMG-KHKRSKGPDTANKLPQVTPHTRCKLRLLKLERIKDYLLMEEEFIKNQE  79

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLK  EEK EE+RSKVDDLRG+PMSVG LEE+ID+NH IVS+SVG E+YVSILSFVDK  
Sbjct  80    RLKTDEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHVIVSTSVGSEHYVSILSFVDKGM  139

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLDAQIQEIKE+VEL
Sbjct  140   LEPGCSVLLNHKVHAVVGVLTDDTDPMVTVMKLEKAPQETYADIGGLDAQIQEIKESVEL  199

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTH ELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  200   PLTHSELYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  259

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFR+A+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  260   PKLVRELFRLAEENAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  319

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNLE +
Sbjct  320   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLENY  379

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             V ++DE SGADIKA+CTEAGLLALRERRMKVT+ DF+KAK+ V+++K EG PEGLY+
Sbjct  380   VTSRDELSGADIKAMCTEAGLLALRERRMKVTNEDFEKAKENVLYRKNEGTPEGLYL  436



>ref|XP_003322501.1| 26S protease regulatory subunit 4 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP78082.1| 26S protease regulatory subunit 4 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=439

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/417 (78%), Positives = 381/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG K +K++G  A  +LPTV P ++CKL+LLK+ERIKD+LL+EEEFV NQE
Sbjct  25    WEPPLP-TRVG-KAKKKRGPSAVNKLPTVFPTSRCKLKLLKMERIKDHLLLEEEFVINQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLKP+EEK E +RS+VDDLRGSPM VG LEE+ID++HAIVSS+ GPEYYV+ILSFVDKD 
Sbjct  83    RLKPKEEKAERERSEVDDLRGSPMGVGTLEEIIDDDHAIVSSATGPEYYVNILSFVDKDL  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+H+KV+SVVG+L DD DPMVSVMK++KAP ESYADIGGLD QI EIKE+VEL
Sbjct  143   LEPGCSVLLHHKVMSVVGVLGDDTDPMVSVMKLDKAPTESYADIGGLDQQIMEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPELYE++GIKPPKGVILYG+PGTGKTLLAKAVA+ TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPELYEEMGIKPPKGVILYGQPGTGKTLLAKAVAHQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA++ +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEQHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATNKIE+LDPAL+RPGRIDRKIEFPLPD+KT+R IF++HT RMTLADDV+L+EF
Sbjct  323   DVKVIMATNKIETLDPALIRPGRIDRKIEFPLPDVKTKRHIFKLHTGRMTLADDVDLDEF  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             VM KDE SGADIKA+CTEAGL+ALRERRM+VT  DF+ A++KV+  K+E +PEGLY+
Sbjct  383   VMMKDELSGADIKAVCTEAGLMALRERRMRVTAKDFRSAREKVLHTKQENMPEGLYL  439



>gb|EFX87779.1| hypothetical protein DAPPUDRAFT_306388 [Daphnia pulex]
Length=442

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/397 (81%), Positives = 373/397 (94%), Gaps = 0/397 (0%)
 Frame = +1

Query  190   EAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLR  369
             EAA +LP VTP T+C+L+LLK+ERIKDYLLMEEEF+ NQERLKPQEE+ EE+RSKVDDLR
Sbjct  46    EAATKLPQVTPHTRCRLKLLKMERIKDYLLMEEEFIRNQERLKPQEERNEEERSKVDDLR  105

Query  370   GSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLL  549
             G+PMSVG LEE+ID+ HAIVS+SVG E+YVSILSFVDKDQLEPGC++L+++KV ++VG+L
Sbjct  106   GTPMSVGTLEEIIDDTHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAIVGVL  165

Query  550   QDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVI  729
              DD DPMV+VMK+EKAP E+YADIGGLD QIQEIKE+VELPLTHPE YE++GIKPPKGVI
Sbjct  166   SDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVI  225

Query  730   LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  909
             LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E SPSIVF
Sbjct  226   LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHSPSIVF  285

Query  910   IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLR  1089
             IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKV++ATN+IE+LDPAL+R
Sbjct  286   IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVVMATNRIETLDPALIR  345

Query  1090  PGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAG  1269
             PGRIDRKIEFPLPD KT+RRIFQIHT RMTLA+DVNLE+ +M+KD+ SGADIKAICTEAG
Sbjct  346   PGRIDRKIEFPLPDEKTKRRIFQIHTGRMTLAEDVNLEDLIMSKDDLSGADIKAICTEAG  405

Query  1270  LLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             L+ALRERRMKVT+ DFKK+K+ V+++KKEG PEGLY+
Sbjct  406   LMALRERRMKVTNEDFKKSKENVLYRKKEGTPEGLYL  442



>ref|XP_009951400.1| PREDICTED: 26S protease regulatory subunit 4, partial [Leptosomus 
discolor]
 ref|XP_010172100.1| PREDICTED: 26S protease regulatory subunit 4, partial [Caprimulgus 
carolinensis]
 gb|KFM08568.1| 26S protease regulatory subunit 4, partial [Aptenodytes forsteri]
 gb|KFP53065.1| 26S protease regulatory subunit 4, partial [Cathartes aura]
 gb|KFP99330.1| 26S protease regulatory subunit 4, partial [Leptosomus discolor]
 gb|KFQ01595.1| 26S protease regulatory subunit 4, partial [Haliaeetus albicilla]
 gb|KFU94221.1| 26S protease regulatory subunit 4, partial [Chaetura pelagica]
 gb|KFV74889.1| 26S protease regulatory subunit 4, partial [Struthio camelus 
australis]
 gb|KFZ48252.1| 26S protease regulatory subunit 4, partial [Caprimulgus carolinensis]
Length=439

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  83    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  439



>ref|XP_002117269.1| 26S proteasome regulatory chain 4 [Trichoplax adhaerens]
 gb|EDV20319.1| 26S proteasome regulatory chain 4 [Trichoplax adhaerens]
Length=413

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/412 (78%), Positives = 381/412 (92%), Gaps = 1/412 (0%)
 Frame = +1

Query  148   PARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQE  327
             P R+G+K+RK +G EAA ++P VTP TKC+L+LLKL RI+DYL+ME EF+ NQE+L+PQ+
Sbjct  2     PTRIGKKKRKSRGPEAATKVPLVTPHTKCRLKLLKLNRIRDYLIMESEFIENQEQLRPQD  61

Query  328   EKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQLEPGCA  507
             EK EE+R+++DD+RG+PM+VG LEE+ID+NHAIVS+SVG E+YVSILSFVD+D LEPGC+
Sbjct  62    EKNEEERTRLDDIRGTPMAVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDRDLLEPGCS  121

Query  508   ILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVELPLTHPE  687
             +L+++KV +V+G+LQDD DPMVSVMK+EKAP ESYADIGGL++QIQEIKE+VELPLTHPE
Sbjct  122   VLLNHKVHAVIGVLQDDTDPMVSVMKLEKAPQESYADIGGLESQIQEIKESVELPLTHPE  181

Query  688   LYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRE  867
              YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRE
Sbjct  182   YYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRE  241

Query  868   LFRVADELSPSIVFIDEIDAVGTK-RYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVI  1044
             LFRVA+E +PSI+FIDEIDA+GTK RYD++SGGEREIQRTMLELLNQLDGFDS GDVKVI
Sbjct  242   LFRVAEEHAPSIIFIDEIDAIGTKRRYDSNSGGEREIQRTMLELLNQLDGFDSIGDVKVI  301

Query  1045  LATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEFVMTKD  1224
             +ATN+IESLDPAL+RPGRIDRKIEFPLPD KTRRRIF IHTARMTLA+DVNLEE +M KD
Sbjct  302   MATNRIESLDPALIRPGRIDRKIEFPLPDEKTRRRIFNIHTARMTLAEDVNLEEHIMAKD  361

Query  1225  EFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             + SGAD+KAICTEAGLLALRERRMKVT  DF+K+KD V+++KKEG PEGLY+
Sbjct  362   DLSGADVKAICTEAGLLALRERRMKVTSEDFRKSKDNVLYRKKEGTPEGLYL  413



>ref|XP_011571254.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Aquila 
chrysaetos canadensis]
Length=456

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  41    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  99

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  100   QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  159

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  160   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  219

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  220   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  279

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  280   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  339

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  340   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  399

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  400   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  456



>emb|CDS23259.1| proteasome 26s subunit subunit 4 atpase [Echinococcus granulosus]
Length=475

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/417 (79%), Positives = 379/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP  P  R+G K ++ KG + A +LP VTP T+CKLRLLK ERIKDYLLMEEEF+ NQE
Sbjct  22    FEPPIP-TRMG-KHKRSKGPDTANKLPQVTPHTRCKLRLLKFERIKDYLLMEEEFIKNQE  79

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLK  EEK EE+RSKVDDLRG+PMSVG LEE+ID+NH IVS+SVG E+YVSILSFVDK  
Sbjct  80    RLKTDEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHVIVSTSVGSEHYVSILSFVDKGI  139

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLDAQIQEIKE+VEL
Sbjct  140   LEPGCSVLLNHKVHAVVGVLTDDTDPMVTVMKLEKAPQETYADIGGLDAQIQEIKESVEL  199

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTH ELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  200   PLTHSELYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  259

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFR+A+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  260   PKLVRELFRLAEENAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  319

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNLE +
Sbjct  320   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLENY  379

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             V +KDE SGADIKA+CTEAGLLALRERRMKVT+ADF+KAK+ V+++K EG PEGLY+
Sbjct  380   VTSKDELSGADIKAMCTEAGLLALRERRMKVTNADFEKAKENVLYRKSEGTPEGLYL  436



>ref|XP_009100602.1| PREDICTED: 26S protease regulatory subunit 4 [Serinus canaria]
Length=451

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  36    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  94

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  95    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  154

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  155   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  214

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  215   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  274

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  275   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  334

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  335   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  394

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  395   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  451



>ref|XP_009688138.1| PREDICTED: 26S protease regulatory subunit 4 [Struthio camelus 
australis]
Length=454

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  39    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  97

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  98    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  157

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  158   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  217

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  218   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  277

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  278   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  337

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  338   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  397

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  398   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  454



>ref|XP_010392357.1| PREDICTED: 26S protease regulatory subunit 4 isoform X3 [Corvus 
cornix cornix]
Length=443

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  28    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  86

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  87    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  146

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  147   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  206

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  207   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  266

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  267   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  326

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  327   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  386

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  387   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  443



>ref|XP_005285442.1| PREDICTED: 26S protease regulatory subunit 4 [Chrysemys picta 
bellii]
 ref|XP_006270442.1| PREDICTED: 26S protease regulatory subunit 4 [Alligator mississippiensis]
 ref|XP_007437056.1| PREDICTED: 26S protease regulatory subunit 4 [Python bivittatus]
 ref|XP_011571255.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Aquila 
chrysaetos canadensis]
Length=440

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_005438976.1| PREDICTED: 26S protease regulatory subunit 4, partial [Falco 
cherrug]
Length=439

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  83    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLEL+NQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELMNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  439



>ref|XP_006042318.1| PREDICTED: 26S protease regulatory subunit 4 [Bubalus bubalis]
Length=440

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA+RLP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKTKGPDAASRLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_003987959.1| PREDICTED: 26S protease regulatory subunit 4 [Felis catus]
 ref|XP_007095030.1| PREDICTED: 26S protease regulatory subunit 4 [Panthera tigris 
altaica]
Length=440

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_009279221.1| PREDICTED: 26S protease regulatory subunit 4 [Aptenodytes forsteri]
Length=489

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  74    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  132

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  133   QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  192

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  193   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  252

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  253   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  312

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  313   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  372

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  373   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  432

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  433   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  489



>gb|KIY61485.1| 26S proteasome subunit P45 [Cylindrobasidium torrendii FP15055 
ss-10]
Length=446

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/420 (77%), Positives = 381/420 (91%), Gaps = 6/420 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K  K+KG  AA++LP V P T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  30    WEPPLP-TRVGKK--KKKGPSAASKLPPVYPTTRCRLKLLKLERIKDYLLMEEEFIQNQE  86

Query  310   RLKPQ---EEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVD  480
             RL+P+   EEK EED +KVDDLRGSPM+VG +EE+ID++HAI+S+S GPEYYVSI+SFVD
Sbjct  87    RLRPEAAREEKNEEDHTKVDDLRGSPMAVGTMEEIIDDDHAIISTSSGPEYYVSIMSFVD  146

Query  481   KDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEA  660
             KD LEPGC +L+H+K  S++G+LQDD DP+V+VMK++KAP ESYADIGGLD QIQEIKE+
Sbjct  147   KDLLEPGCQVLLHHKTQSIIGVLQDDTDPLVNVMKLDKAPTESYADIGGLDQQIQEIKES  206

Query  661   VELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYL  840
             VELPLTHPELYE++GI+PPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYL
Sbjct  207   VELPLTHPELYEEMGIRPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYL  266

Query  841   GDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD  1020
             GDGPKLVRELFR A+E +PSIVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFD
Sbjct  267   GDGPKLVRELFRAAEEHAPSIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFD  326

Query  1021  SRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNL  1200
             +RGDVKVI+ATNKIESLDPAL+RPGRIDRKIEFPLPD+KT+R IF++HTARM+L+DDV+L
Sbjct  327   TRGDVKVIMATNKIESLDPALIRPGRIDRKIEFPLPDVKTKRHIFRLHTARMSLSDDVDL  386

Query  1201  EEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             EEFVMTKD+ SGADIKA+CTEAGLLALRERRM+VT  DF  A++KV+++K EG PEGLY+
Sbjct  387   EEFVMTKDDLSGADIKAVCTEAGLLALRERRMRVTKVDFTSAREKVLYRKNEGTPEGLYL  446



>gb|EHB02601.1| 26S protease regulatory subunit 4, partial [Heterocephalus glaber]
Length=440

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_007180940.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=442

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  27    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  85

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  86    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  145

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  146   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  205

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  206   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  265

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  266   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  325

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  326   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  385

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  386   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  442



>gb|EUB61439.1| 26S protease regulatory subunit 4 [Echinococcus granulosus]
Length=476

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/417 (79%), Positives = 379/417 (91%), Gaps = 2/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             FEP  P  R+G K ++ KG + A +LP VTP T+CKLRLLK ERIKDYLLMEEEF+ NQE
Sbjct  62    FEPPIP-TRMG-KHKRSKGPDTANKLPQVTPHTRCKLRLLKFERIKDYLLMEEEFIKNQE  119

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             RLK  EEK EE+RSKVDDLRG+PMSVG LEE+ID+NH IVS+SVG E+YVSILSFVDK  
Sbjct  120   RLKTDEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNHVIVSTSVGSEHYVSILSFVDKGI  179

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +VVG+L DD DPMV+VMK+EKAP E+YADIGGLDAQIQEIKE+VEL
Sbjct  180   LEPGCSVLLNHKVHAVVGVLTDDTDPMVTVMKLEKAPQETYADIGGLDAQIQEIKESVEL  239

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTH ELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  240   PLTHSELYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  299

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFR+A+E +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  300   PKLVRELFRLAEENAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  359

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHT+RMTLA+DVNLE +
Sbjct  360   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLENY  419

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             V +KDE SGADIKA+CTEAGLLALRERRMKVT+ADF+KAK+ V+++K EG PEGLY+
Sbjct  420   VTSKDELSGADIKAMCTEAGLLALRERRMKVTNADFEKAKENVLYRKSEGTPEGLYL  476



>ref|XP_005149701.1| PREDICTED: 26S protease regulatory subunit 4 [Melopsittacus undulatus]
Length=495

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  80    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  138

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  139   QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  198

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  199   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  258

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  259   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  318

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  319   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  378

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  379   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  438

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  439   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  495



>ref|XP_003027303.1| hypothetical protein SCHCODRAFT_238082 [Schizophyllum commune 
H4-8]
 gb|EFI92400.1| hypothetical protein SCHCODRAFT_238082 [Schizophyllum commune 
H4-8]
Length=446

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/419 (78%), Positives = 382/419 (91%), Gaps = 5/419 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K+RK  G   A++LP V P T+C+L+LLK+ERIKDYLLMEEEF+ NQE
Sbjct  31    WEPPLP-TRVGKKKRK--GPATASKLPPVYPTTRCRLKLLKMERIKDYLLMEEEFIQNQE  87

Query  310   RLKPQ--EEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDK  483
             RLKP+  EEK EEDRSKVDDLRGSPM+VG +EE++D++HAI+S+S GPE+YVSI+S+VDK
Sbjct  88    RLKPETREEKNEEDRSKVDDLRGSPMAVGTMEEIVDDDHAIISTSSGPEFYVSIMSYVDK  147

Query  484   DQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAV  663
             D LEPGC +L+H+K  S+VG+LQDD DPMVSVMK++KAP ESYADIGGL+ QIQEIKE+V
Sbjct  148   DLLEPGCQVLLHHKTQSIVGVLQDDADPMVSVMKLDKAPTESYADIGGLEQQIQEIKESV  207

Query  664   ELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLG  843
             ELPLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLG
Sbjct  208   ELPLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLG  267

Query  844   DGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDS  1023
             DGPKLVRELFRVA+E +PSIVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFD+
Sbjct  268   DGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGFDT  327

Query  1024  RGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLE  1203
             RGDVKVI+ATNKIESLDPAL+RPGRIDRKIEFPLPD+KT+R IF++HT+RM L++DV+LE
Sbjct  328   RGDVKVIMATNKIESLDPALIRPGRIDRKIEFPLPDVKTKRHIFRLHTSRMNLSEDVDLE  387

Query  1204  EFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             EFVMTKD+ SGADIKA+CTEAGLLALRERRM+VT ADF  A++KV+++K EG PEGLY+
Sbjct  388   EFVMTKDDLSGADIKAVCTEAGLLALRERRMRVTKADFTSAREKVLYRKNEGTPEGLYL  446



>ref|XP_006028418.1| PREDICTED: 26S protease regulatory subunit 4 [Alligator sinensis]
Length=454

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  39    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  97

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  98    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  157

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  158   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  217

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  218   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  277

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  278   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  337

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  338   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  397

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  398   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  454



>gb|EPQ10744.1| 26S protease regulatory subunit 4 [Myotis brandtii]
Length=456

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  41    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  99

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  100   QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  159

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  160   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  219

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  220   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  279

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  280   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  339

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  340   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  399

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  400   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  456



>ref|XP_003214402.1| PREDICTED: 26S protease regulatory subunit 4 [Anolis carolinensis]
 ref|XP_005483210.1| PREDICTED: 26S protease regulatory subunit 4 [Zonotrichia albicollis]
 ref|XP_005520253.1| PREDICTED: 26S protease regulatory subunit 4 [Pseudopodoces humilis]
Length=440

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/443 (77%), Positives = 399/443 (90%), Gaps = 3/443 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGdrknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTK  231
             MGQ   GG      G +K+D  K KK+EP  P  RVG+K++K KG +AA++LP VTP T+
Sbjct  1     MGQSQSGGHGPG--GSKKDDKDKKKKYEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQ  57

Query  232   CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELID  411
             C+L+LLKLERIKDYLLMEEEF+ NQE++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID
Sbjct  58    CRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIID  117

Query  412   ENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVE  591
             +NHAIVS+SVG E+YVSILSFVDKD LEPGC++L+++KV +V+G+L DD DP+V+VMKVE
Sbjct  118   DNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVE  177

Query  592   KAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK  771
             KAP E+YADIGGLD QIQEIKE+VELPLTHPE YE++GIKPPKGVILYG PGTGKTLLAK
Sbjct  178   KAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAK  237

Query  772   AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDA  951
             AVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD+
Sbjct  238   AVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDS  297

Query  952   HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPD  1131
             +SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD
Sbjct  298   NSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPD  357

Query  1132  IKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHa  1311
              KT++RIFQIHT+RMTLADDV L+E +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ 
Sbjct  358   EKTKKRIFQIHTSRMTLADDVTLDELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNE  417

Query  1312  dfkkakdkvmfkkkEGVPEGLYM  1380
             DFKK+K+ V++KK+EG PEGLY+
Sbjct  418   DFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_006122416.1| PREDICTED: 26S protease regulatory subunit 4 [Pelodiscus sinensis]
Length=485

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  70    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  128

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  129   QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  188

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  189   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  248

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  249   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  308

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  309   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  368

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  369   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  428

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  429   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  485



>ref|XP_010002048.1| PREDICTED: 26S protease regulatory subunit 4 [Chaetura pelagica]
Length=510

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  95    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  153

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  154   QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  213

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  214   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  273

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  274   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  333

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  334   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  393

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  394   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  453

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  454   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  510



>ref|XP_006158084.1| PREDICTED: 26S protease regulatory subunit 4 [Tupaia chinensis]
Length=458

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  43    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  101

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  102   QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  161

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  162   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  221

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  222   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  281

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  282   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  341

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  342   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  401

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  402   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  458



>ref|XP_008049593.1| PREDICTED: 26S protease regulatory subunit 4 [Tarsius syrichta]
Length=440

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/444 (77%), Positives = 400/444 (90%), Gaps = 5/444 (1%)
 Frame = +1

Query  52    MGQGTPGGLNRQLPGd-rknddkkdkkFEPAAPPARVGRKQRKQKGSEAAARLPTVTPLT  228
             MGQ   GG     PG  +K+D  K KK+EP  P  RVG+K++K KG +AA++LP VTP T
Sbjct  1     MGQSQSGGHG---PGSGKKDDKDKKKKYEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHT  56

Query  229   KCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELI  408
             +C+L+LLKLERIKDYLLMEEEF+ NQE++KP EEK EE+RSKVDDLRG+PMSVG LEE+I
Sbjct  57    QCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEII  116

Query  409   DENHAIVSSSVGPEYYVSILSFVDKDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKV  588
             D+NHAIVS+SVG E+YVSILSFVDKD LEPGC++L+++KV +V+G+L DD DP+V+VMKV
Sbjct  117   DDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKV  176

Query  589   EKAPLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLA  768
             EKAP E+YADIGGLD QIQEIKE+VELPLTHPE YE++GIKPPKGVILYG PGTGKTLLA
Sbjct  177   EKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLA  236

Query  769   KAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYD  948
             KAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD
Sbjct  237   KAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYD  296

Query  949   AHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLP  1128
             ++SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLP
Sbjct  297   SNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLP  356

Query  1129  DIKTRRRIFQIHTARMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH  1308
             D KT++RIFQIHT+RMTLADDV L++ +M KD+ SGADIKAICTEAGL+ALRERRMKVT+
Sbjct  357   DEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTN  416

Query  1309  adfkkakdkvmfkkkEGVPEGLYM  1380
              DFKK+K+ V++KK+EG PEGLY+
Sbjct  417   EDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_007318478.1| hypothetical protein SERLADRAFT_348772 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN91920.1| hypothetical protein SERLA73DRAFT_80029 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO24459.1| hypothetical protein SERLADRAFT_348772 [Serpula lacrymans var. 
lacrymans S7.9]
Length=442

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/420 (77%), Positives = 383/420 (91%), Gaps = 6/420 (1%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K  K++G + A++LP V P T+C+LRLLK+ERIKDYLLMEEEFV NQE
Sbjct  26    WEPPLP-TRVGKK--KKRGPDTASKLPAVFPATRCRLRLLKMERIKDYLLMEEEFVQNQE  82

Query  310   RLKPQ---EEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVD  480
             R+KP+   EEK EEDR+KVDDLRGSPM+VG LEE+ID++HAIVS++ GPEYYVSI+SFVD
Sbjct  83    RMKPETTREEKNEEDRTKVDDLRGSPMAVGTLEEIIDDDHAIVSTASGPEYYVSIMSFVD  142

Query  481   KDQLEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEA  660
             KD++EPGC +L+H+K  +VVG+LQDD DPMVSVMK++KAP ESYADIGGL+ QIQEIKE+
Sbjct  143   KDRIEPGCQVLLHHKTQAVVGVLQDDADPMVSVMKLDKAPTESYADIGGLENQIQEIKES  202

Query  661   VELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYL  840
             VELPLTHPELYE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYL
Sbjct  203   VELPLTHPELYEEMGIKPPKGVILYGVPGTGKTLLAKAVANQTSATFLRVVGSELIQKYL  262

Query  841   GDGPKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFD  1020
             GDGPKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD+ SGGEREIQRTMLELLNQLDGFD
Sbjct  263   GDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSTSGGEREIQRTMLELLNQLDGFD  322

Query  1021  SRGDVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNL  1200
             +RGDVKVI+ATN+IESLDPAL+RPGRIDRKIEFPLPD+KT+R IF++HT+RM+L +DV+L
Sbjct  323   TRGDVKVIMATNRIESLDPALIRPGRIDRKIEFPLPDVKTKRHIFRLHTSRMSLNEDVDL  382

Query  1201  EEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             EEFVM KD+ SGADIKA+CTEAGLLALRERRM+VT ADF  A++KV+++K EG PEGLY+
Sbjct  383   EEFVMAKDDLSGADIKAVCTEAGLLALRERRMRVTKADFTSAREKVLYRKNEGTPEGLYL  442



>gb|AAA35484.1| 26S protease (S4) regulatory subunit [Homo sapiens]
Length=440

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_007526891.1| PREDICTED: 26S protease regulatory subunit 4 [Erinaceus europaeus]
Length=440

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKAKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|NP_032973.1| 26S protease regulatory subunit 4 [Mus musculus]
 ref|NP_476464.1| 26S protease regulatory subunit 4 [Rattus norvegicus]
 ref|NP_002793.2| 26S protease regulatory subunit 4 [Homo sapiens]
 ref|NP_001039154.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Xenopus 
(Silurana) tropicalis]
 ref|NP_001231080.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Sus scrofa]
 ref|NP_001238880.1| 26S protease regulatory subunit 4 [Canis lupus familiaris]
 ref|NP_001253262.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Macaca 
mulatta]
 ref|XP_510114.2| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Pan 
troglodytes]
 ref|XP_001494140.2| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Equus 
caballus]
 ref|XP_002754239.1| PREDICTED: 26S protease regulatory subunit 4 [Callithrix jacchus]
 ref|XP_003260920.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Nomascus 
leucogenys]
 ref|XP_001371702.2| PREDICTED: 26S protease regulatory subunit 4-like isoform X1 
[Monodelphis domestica]
 ref|XP_003501438.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_004262379.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Orcinus 
orca]
 ref|XP_004394523.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004434253.1| PREDICTED: 26S protease regulatory subunit 4 isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004476117.1| PREDICTED: 26S protease regulatory subunit 4 [Dasypus novemcinctus]
 ref|XP_004584401.1| PREDICTED: 26S protease regulatory subunit 4 [Ochotona princeps]
 ref|XP_004610310.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Sorex 
araneus]
 ref|XP_004681686.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Condylura 
cristata]
 ref|XP_004739122.1| PREDICTED: 26S protease regulatory subunit 4 [Mustela putorius 
furo]
 ref|XP_004797160.1| PREDICTED: 26S protease regulatory subunit 4 [Mustela putorius 
furo]
 ref|XP_004884175.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004884176.1| PREDICTED: 26S protease regulatory subunit 4 isoform X3 [Heterocephalus 
glaber]
 ref|XP_004884177.1| PREDICTED: 26S protease regulatory subunit 4 isoform X4 [Heterocephalus 
glaber]
 ref|XP_003472392.2| PREDICTED: 26S protease regulatory subunit 4 [Cavia porcellus]
 ref|XP_005343505.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Microtus 
ochrogaster]
 ref|XP_005321372.1| PREDICTED: 26S protease regulatory subunit 4 [Ictidomys tridecemlineatus]
 ref|XP_005390338.1| PREDICTED: 26S protease regulatory subunit 4 [Chinchilla lanigera]
 ref|XP_005562068.1| PREDICTED: 26S protease regulatory subunit 4 [Macaca fascicularis]
 ref|XP_005871251.1| PREDICTED: 26S protease regulatory subunit 4 [Myotis brandtii]
 ref|XP_006101737.1| PREDICTED: 26S protease regulatory subunit 4 [Myotis lucifugus]
 ref|XP_006208252.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Vicugna 
pacos]
 ref|XP_006754784.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Myotis 
davidii]
 ref|XP_006748118.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X1 
[Leptonychotes weddellii]
 ref|XP_006879185.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Elephantulus 
edwardii]
 ref|XP_006839641.1| PREDICTED: 26S protease regulatory subunit 4 [Chrysochloris asiatica]
 ref|XP_006925586.1| PREDICTED: 26S protease regulatory subunit 4 [Pteropus alecto]
 ref|XP_006991870.1| PREDICTED: 26S protease regulatory subunit 4 [Peromyscus maniculatus 
bairdii]
 ref|XP_007102739.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Physeter 
catodon]
 ref|XP_007180941.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007471952.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007472663.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X2 
[Monodelphis domestica]
 ref|XP_007985761.1| PREDICTED: 26S protease regulatory subunit 4 [Chlorocebus sabaeus]
 ref|XP_008270148.1| PREDICTED: 26S protease regulatory subunit 4 [Oryctolagus cuniculus]
 ref|XP_008516748.1| PREDICTED: 26S protease regulatory subunit 4 [Equus przewalskii]
 ref|XP_008819971.1| PREDICTED: 26S protease regulatory subunit 4 [Nannospalax galili]
 ref|XP_008956433.1| PREDICTED: 26S protease regulatory subunit 4 [Pan paniscus]
 ref|XP_009210390.1| PREDICTED: 26S protease regulatory subunit 4 [Papio anubis]
 ref|XP_009234479.1| PREDICTED: 26S protease regulatory subunit 4 [Pongo abelii]
 ref|XP_010361221.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010372145.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010387196.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010357338.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010614594.1| PREDICTED: 26S protease regulatory subunit 4 [Fukomys damarensis]
 ref|XP_010587104.1| PREDICTED: 26S protease regulatory subunit 4 [Loxodonta africana]
 ref|XP_010843484.1| PREDICTED: 26S protease regulatory subunit 4 [Bison bison bison]
 ref|XP_010966985.1| PREDICTED: 26S protease regulatory subunit 4 [Camelus bactrianus]
 ref|XP_010986547.1| PREDICTED: 26S protease regulatory subunit 4 [Camelus dromedarius]
 ref|XP_011225243.1| PREDICTED: 26S protease regulatory subunit 4 [Ailuropoda melanoleuca]
 ref|XP_011355437.1| PREDICTED: 26S protease regulatory subunit 4 [Pteropus vampyrus]
 ref|XP_011829704.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Mandrillus 
leucophaeus]
 ref|XP_011939061.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Cercocebus 
atys]
 ref|XP_011715556.1| PREDICTED: 26S protease regulatory subunit 4 [Macaca nemestrina]
 ref|XP_011990713.1| PREDICTED: 26S protease regulatory subunit 4 isoform X3 [Ovis 
aries musimon]
 sp|P62193.1|PRS4_RAT RecName: Full=26S protease regulatory subunit 4; Short=P26s4; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2; AltName: 
Full=Proteasome 26S subunit ATPase 1 [Rattus norvegicus]
 sp|P62191.1|PRS4_HUMAN RecName: Full=26S protease regulatory subunit 4; Short=P26s4; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2; AltName: 
Full=Proteasome 26S subunit ATPase 1 [Homo sapiens]
 sp|P62192.1|PRS4_MOUSE RecName: Full=26S protease regulatory subunit 4; Short=P26s4; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2; AltName: 
Full=Proteasome 26S subunit ATPase 1 [Mus musculus]
 gb|AAB34137.1| P26s4 [Mus musculus]
 dbj|BAA09341.1| proteasomal ATPase (S4) [Rattus norvegicus]
 gb|AAH00512.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AAH03860.1| Protease (prosome, macropain) 26S subunit, ATPase 1 [Mus musculus]
 dbj|BAC40339.1| unnamed protein product [Mus musculus]
 gb|AAP88828.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AAH63157.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Rattus 
norvegicus]
 emb|CAG33325.1| PSMC1 [Homo sapiens]
 gb|AAH73818.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AAX41701.1| proteasome 26S subunit 1 [synthetic construct]
 gb|AAX41702.1| proteasome 26S subunit 1 [synthetic construct]
 gb|AAX41703.1| proteasome 26S subunit 1 [synthetic construct]
 dbj|BAE40812.1| unnamed protein product [Mus musculus]
 dbj|BAE39016.1| unnamed protein product [Mus musculus]
 dbj|BAE36506.1| unnamed protein product [Mus musculus]
 dbj|BAE28695.1| unnamed protein product [Mus musculus]
 dbj|BAE21929.1| unnamed protein product [Mus musculus]
 emb|CAJ83548.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Xenopus 
(Silurana) tropicalis]
 gb|EAW81419.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1, isoform 
CRA_a [Homo sapiens]
 gb|ABM82629.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [synthetic 
construct]
 gb|ABM85807.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [synthetic 
construct]
 gb|AAI23488.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Bos taurus]
 gb|EDL18904.1| mCG122657 [Mus musculus]
 gb|EDL81712.1| peptidase (prosome, macropain) 26S subunit, ATPase 1 [Rattus 
norvegicus]
 dbj|BAG36130.1| unnamed protein product [Homo sapiens]
 dbj|BAG70125.1| proteasome 26S ATPase subunit 1 [Homo sapiens]
 dbj|BAG70255.1| proteasome 26S ATPase subunit 1 [Homo sapiens]
 dbj|BAG72708.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [synthetic 
construct]
 tpg|DAA25005.1| TPA: proteasome 26S ATPase subunit 1 [Bos taurus]
 gb|AIC54978.1| PSMC1, partial [synthetic construct]
Length=440

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



>ref|XP_010307096.1| PREDICTED: 26S protease regulatory subunit 4, partial [Balearica 
regulorum gibbericeps]
 gb|KFO14020.1| 26S protease regulatory subunit 4, partial [Balearica regulorum 
gibbericeps]
 gb|KFO95687.1| 26S protease regulatory subunit 4, partial [Calypte anna]
Length=439

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  83    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELL+QLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLHQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  439



>ref|XP_010151155.1| PREDICTED: 26S protease regulatory subunit 4, partial [Eurypyga 
helias]
 gb|KFW06434.1| 26S protease regulatory subunit 4, partial [Eurypyga helias]
Length=439

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  83    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLE LNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLERLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  439



>ref|XP_012037609.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Ovis 
aries]
Length=448

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  33    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  91

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  92    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  151

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  152   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  211

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  212   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  271

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  272   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  331

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  332   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  391

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  392   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  448



>ref|XP_009584690.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
4, partial [Fulmarus glacialis]
Length=439

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/417 (79%), Positives = 385/417 (92%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  24    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  82

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+YVSILSFVDKD 
Sbjct  83    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDL  142

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  143   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  202

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  203   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  262

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLE LNQLDGFDSRG
Sbjct  263   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLEXLNQLDGFDSRG  322

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L+E 
Sbjct  323   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDEL  382

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  383   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  439



>ref|XP_001103312.1| PREDICTED: 26S protease regulatory subunit 4-like [Macaca mulatta]
Length=440

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/417 (79%), Positives = 386/417 (93%), Gaps = 1/417 (0%)
 Frame = +1

Query  130   FEPAAPPARVGRKQRKQKGSEAAARLPTVTPLTKCKLRLLKLERIKDYLLMEEEFVANQE  309
             +EP  P  RVG+K++K KG +AA++LP VTP T+C+L+LLKLERIKDYLLMEEEF+ NQE
Sbjct  25    YEPPVP-TRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQE  83

Query  310   RLKPQEEKTEEDRSKVDDLRGSPMSVGNLEELIDENHAIVSSSVGPEYYVSILSFVDKDQ  489
             ++KP EEK EE+RSKVDDLRG+PMSVG LEE+ID+NHAIVS+SVG E+Y+SILSFVDKD 
Sbjct  84    QMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYISILSFVDKDL  143

Query  490   LEPGCAILMHNKVLSVVGLLQDDVDPMVSVMKVEKAPLESYADIGGLDAQIQEIKEAVEL  669
             LEPGC++L+++KV +V+G+L DD DP+V+VMKVEKAP E+YADIGGLD QIQEIKE+VEL
Sbjct  144   LEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVEL  203

Query  670   PLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDG  849
             PLTHPE YE++GIKPPKGVILYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDG
Sbjct  204   PLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG  263

Query  850   PKLVRELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRG  1029
             PKLVRELFRVA+E +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRG
Sbjct  264   PKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG  323

Query  1030  DVKVILATNKIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTARMTLADDVNLEEF  1209
             DVKVI+ATN+IE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHT+RMTLADDV L++ 
Sbjct  324   DVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDL  383

Query  1210  VMTKDEFSGADIKAICTEAGLLALRERRMKVTHadfkkakdkvmfkkkEGVPEGLYM  1380
             +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DFKK+K+ V++KK+EG PEGLY+
Sbjct  384   IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL  440



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5323048449436