BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10920

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587203.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     292   7e-93   Nicotiana tomentosiformis
ref|XP_009770088.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     290   4e-92   Nicotiana sylvestris
gb|ADZ24701.1|  4-hydroxyphenylpyruvate dioxygenase 2                   275   2e-86   Solanum pennellii
ref|XP_004240171.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    272   4e-85   Solanum lycopersicum
ref|XP_006354418.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    272   5e-85   Solanum tuberosum [potatoes]
ref|XP_006357690.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    266   8e-83   Solanum tuberosum [potatoes]
ref|XP_011100559.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    259   5e-80   
ref|XP_011100558.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    259   1e-79   Sesamum indicum [beniseed]
gb|EYU42802.1|  hypothetical protein MIMGU_mgv1a005210mg                259   2e-79   Erythranthe guttata [common monkey flower]
gb|ACN78586.1|  4-hydroxyphenylpyruvate dioxygenase                     254   5e-78   Lactuca sativa [cultivated lettuce]
sp|O23920.1|HPPD_DAUCA  RecName: Full=4-hydroxyphenylpyruvate dio...    248   7e-76   Daucus carota [carrots]
gb|AGO59892.1|  hydroxyphenylpyruvate dioxygenase                       248   1e-75   Perilla frutescens [beefsteak-mint]
ref|XP_002520369.1|  4-hydroxyphenylpyruvate dioxygenase, putative      246   6e-75   Ricinus communis
ref|XP_004491317.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    241   2e-73   Cicer arietinum [garbanzo]
ref|XP_010688905.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    241   3e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|AGG10562.1|  4-hydroxyphenylpyruvate dioxygenase                     236   2e-71   Amaranthus tuberculatus
gb|KDO51876.1|  hypothetical protein CISIN_1g013898mg                   235   3e-71   Citrus sinensis [apfelsine]
ref|XP_009119049.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     236   3e-71   Brassica rapa
dbj|BAH10638.1|  4-hydroxyphenylpyruvate dioxygenase                    236   3e-71   Hevea brasiliensis [jebe]
gb|ADZ24700.1|  4-hydroxyphenylpyruvate dioxygenase 1                   235   5e-71   Solanum pennellii
ref|XP_006437130.1|  hypothetical protein CICLE_v10031587mg             235   6e-71   Citrus clementina [clementine]
ref|XP_010087866.1|  4-hydroxyphenylpyruvate dioxygenase                234   1e-70   Morus notabilis
ref|XP_012082570.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     234   2e-70   Jatropha curcas
ref|NP_001154311.1|  4-hydroxyphenylpyruvate dioxygenase                233   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300867.2|  4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family p...    234   2e-70   
emb|CDY06652.1|  BnaA10g04310D                                          234   2e-70   
ref|XP_011026229.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    234   2e-70   Populus euphratica
ref|XP_004243609.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     234   2e-70   Solanum lycopersicum
gb|AAM96960.1|  4-hydroxyphenylpyruvate dioxygenase HPD                 234   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172144.2|  4-hydroxyphenylpyruvate dioxygenase                   234   3e-70   
pdb|1SQD|A  Chain A, Structural Basis For Inhibitor Selectivity R...    233   4e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AID81984.1|  hydroxyphenylpyruvate dioxygenase                       233   4e-70   Capsella bursa-pastoris
gb|AAC62457.1|  p-hydroxyphenylpyruvate dioxygenase                     233   4e-70   Arabidopsis thaliana [mouse-ear cress]
sp|P93836.2|HPPD_ARATH  RecName: Full=4-hydroxyphenylpyruvate dio...    233   5e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AFB74208.1|  4-hydroxyphenylpyruvate dioxygenase                     233   6e-70   Brassica napus [oilseed rape]
ref|XP_006307507.1|  hypothetical protein CARUB_v10009131mg             233   7e-70   Capsella rubella
ref|XP_002892349.1|  4-hydroxyphenylpyruvate dioxygenase                232   1e-69   Arabidopsis lyrata subsp. lyrata
emb|CDY09969.1|  BnaC08g44820D                                          231   2e-69   Brassica napus [oilseed rape]
gb|AFB74207.1|  4-hydroxyphenylpyruvate dioxygenase                     231   3e-69   Brassica napus [oilseed rape]
gb|KFK42972.1|  hypothetical protein AALP_AA1G063200                    231   4e-69   Arabis alpina [alpine rockcress]
gb|AFB74218.1|  4-hydroxyphenylpyruvate dioxygenase                     230   5e-69   Brassica napus [oilseed rape]
ref|XP_007048963.1|  Phytoene desaturation 1 isoform 3                  228   8e-69   
ref|XP_007048964.1|  Phytoene desaturation 1 isoform 4                  228   1e-68   
ref|XP_010486350.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     229   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_007048961.1|  Phytoene desaturation 1 isoform 1                  229   1e-68   
ref|XP_007048962.1|  Phytoene desaturation 1 isoform 2                  229   2e-68   
ref|XP_003617391.1|  4-hydroxyphenylpyruvate dioxygenase                228   3e-68   
ref|XP_009118533.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     228   3e-68   Brassica rapa
emb|CDY10210.1|  BnaC05g04530D                                          228   3e-68   Brassica napus [oilseed rape]
ref|XP_008466793.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     228   4e-68   Cucumis melo [Oriental melon]
ref|XP_006417901.1|  hypothetical protein EUTSA_v10007634mg             227   8e-68   Eutrema salsugineum [saltwater cress]
sp|Q9ARF9.1|HPPD_PLESU  RecName: Full=4-hydroxyphenylpyruvate dio...    227   8e-68   Plectranthus scutellarioides
gb|ADO62712.1|  p-hydroxyphenylpyruvate dioxygenase                     227   1e-67   Mangifera indica
ref|NP_001235148.1|  4-hydroxyphenylpyruvate dioxygenase                226   2e-67   
gb|AIN39549.1|  4-hydroxyphenylpyruvate dioxygenase short isoform       226   2e-67   Glycine max [soybeans]
ref|XP_009351285.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    226   3e-67   
ref|XP_009377128.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    226   3e-67   
ref|XP_010457787.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    226   3e-67   Camelina sativa [gold-of-pleasure]
gb|AIN39550.1|  chloroplast 4-hydroxyphenylpyruvate dioxygenase l...    227   4e-67   Glycine max [soybeans]
ref|XP_008353631.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    226   5e-67   
ref|XP_004144629.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     225   6e-67   Cucumis sativus [cucumbers]
ref|XP_010542713.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     224   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_004303888.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     223   2e-66   Fragaria vesca subsp. vesca
ref|XP_010053920.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    223   3e-66   Eucalyptus grandis [rose gum]
ref|XP_010274102.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     224   6e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010053900.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    223   6e-66   Eucalyptus grandis [rose gum]
gb|KJB08583.1|  hypothetical protein B456_001G092000                    221   9e-66   Gossypium raimondii
gb|KJB08582.1|  hypothetical protein B456_001G092000                    221   1e-65   Gossypium raimondii
ref|XP_008380188.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    221   2e-65   
gb|KJB08581.1|  hypothetical protein B456_001G092000                    221   2e-65   Gossypium raimondii
emb|CAN71143.1|  hypothetical protein VITISV_033518                     217   6e-64   Vitis vinifera
dbj|BAF74636.1|  hydroxyphenylpyruvate dioxygenase                      216   8e-64   Coptis japonica var. dissecta
ref|XP_007141424.1|  hypothetical protein PHAVU_008G194300g             217   1e-63   Phaseolus vulgaris [French bean]
gb|EPS60251.1|  hydroxyphenylpyruvate dioxygenase                       214   2e-63   Genlisea aurea
gb|ABO69440.1|  hydroxyphenylpyruvate dioxygenase                       216   4e-63   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002283275.2|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     216   6e-63   Vitis vinifera
ref|XP_003617384.1|  4-hydroxyphenylpyruvate dioxygenase                213   1e-62   Medicago truncatula
gb|KEH40154.1|  4-hydroxyphenylpyruvate dioxygenase                     210   2e-61   Medicago truncatula
ref|XP_010688906.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    207   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010053910.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    207   4e-60   Eucalyptus grandis [rose gum]
ref|XP_008229571.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    207   1e-59   Prunus mume [ume]
ref|XP_007215393.1|  hypothetical protein PRUPE_ppa005851mg             205   2e-59   
ref|XP_007048965.1|  Phytoene desaturation 1                            203   5e-59   
ref|XP_002453359.1|  hypothetical protein SORBIDRAFT_04g004560          187   1e-52   Sorghum bicolor [broomcorn]
ref|XP_004951787.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    186   5e-52   Setaria italica
dbj|BAD26248.1|  putative 4-hydroxyphenylpyruvate dioxygenase           180   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006853410.2|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    172   6e-47   Amborella trichopoda
ref|XP_009419542.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     172   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001694723.1|  4-hydroxyphenylpyruvate dioxygenase                170   4e-46   Chlamydomonas reinhardtii
emb|CAR47957.1|  p-hydroxyphenylpyruvate dioxygenase                    170   4e-46   Chlamydomonas reinhardtii
gb|AAZ67144.1|  4-hydroxyphenylpyruvate dioxygenase                     168   3e-45   Triticum aestivum [Canadian hard winter wheat]
sp|O48604.1|HPPD_HORVU  RecName: Full=4-hydroxyphenylpyruvate dio...    167   6e-45   Hordeum vulgare [barley]
ref|XP_001756086.1|  predicted protein                                  167   6e-45   
ref|XP_003570001.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     166   1e-44   Brachypodium distachyon [annual false brome]
dbj|BAJ86732.1|  predicted protein                                      166   2e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAJ29893.1|  4-hydroxyphenylpyruvate dioxygenase                    164   2e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008620054.1|  4-hydroxyphenylpyruvate dioxygenase                166   2e-44   Saprolegnia diclina VS20
dbj|BAK02084.1|  predicted protein                                      165   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001757940.1|  predicted protein                                  164   7e-44   
ref|XP_008811120.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase     163   1e-43   Phoenix dactylifera
dbj|BAJ95714.1|  predicted protein                                      163   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|1SP8|A  Chain A, 4-hydroxyphenylpyruvate Dioxygenase                162   3e-43   Zea mays [maize]
ref|XP_002952694.1|  4-hydroxyphenylpyruvate dioxygenase                162   4e-43   Volvox carteri f. nagariensis
ref|XP_008863477.1|  4-hydroxyphenylpyruvate dioxygenase                162   4e-43   Aphanomyces invadans
ref|XP_010480369.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    162   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010480368.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    162   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009825673.1|  4-hydroxyphenylpyruvate dioxygenase                160   1e-42   Aphanomyces astaci
gb|AFW70252.1|  4-hydroxyphenylpyruvate dioxygenase 1                   159   4e-42   
ref|NP_001105782.1|  4-hydroxyphenylpyruvate dioxygenase 1              158   1e-41   
ref|XP_005650422.1|  p-hydroxyphenylpyruvate dioxigenase                157   1e-41   Coccomyxa subellipsoidea C-169
gb|KDO16411.1|  4-hydroxyphenylpyruvate dioxygenase                     157   2e-41   Saprolegnia parasitica CBS 223.65
ref|XP_008863478.1|  4-hydroxyphenylpyruvate dioxygenase                156   4e-41   Aphanomyces invadans
ref|XP_003617383.1|  4-hydroxyphenylpyruvate dioxygenase                155   7e-41   
ref|XP_009825674.1|  4-hydroxyphenylpyruvate dioxygenase                155   8e-41   Aphanomyces astaci
ref|XP_002461829.1|  hypothetical protein SORBIDRAFT_02g008850          157   9e-41   Sorghum bicolor [broomcorn]
ref|XP_002461838.1|  hypothetical protein SORBIDRAFT_02g008990          154   7e-40   
gb|ETM53414.1|  4-hydroxyphenylpyruvate dioxygenase                     148   7e-40   Phytophthora parasitica
gb|ETM00249.1|  4-hydroxyphenylpyruvate dioxygenase                     147   1e-39   Phytophthora parasitica
ref|XP_002974762.1|  hypothetical protein SELMODRAFT_174278             154   1e-39   
ref|XP_002963674.1|  hypothetical protein SELMODRAFT_165961             153   2e-39   
gb|KDO32258.1|  hypothetical protein SPRG_02737                         152   2e-39   Saprolegnia parasitica CBS 223.65
ref|XP_002901240.1|  4-hydroxyphenylpyruvate dioxygenase                151   4e-39   Phytophthora infestans T30-4
gb|AAN28922.1|  4-hydroxyphenylpyruvate dioxygenase                     150   4e-39   Abutilon theophrasti [butterprint]
ref|XP_008653702.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    151   5e-39   Zea mays [maize]
ref|XP_003055822.1|  predicted protein                                  150   1e-38   Micromonas pusilla CCMP1545
ref|XP_008900422.1|  4-hydroxyphenylpyruvate dioxygenase                149   3e-38   Phytophthora parasitica INRA-310
ref|XP_008881551.1|  4-hydroxyphenylpyruvate dioxygenase                145   3e-38   Aphanomyces invadans
gb|EWM23898.1|  4-hydroxyphenylpyruvate dioxygenase                     149   6e-38   Nannochloropsis gaditana
gb|ETI53876.1|  4-hydroxyphenylpyruvate dioxygenase                     147   7e-38   Phytophthora parasitica P1569
ref|XP_008900424.1|  4-hydroxyphenylpyruvate dioxygenase                147   1e-37   Phytophthora parasitica INRA-310
ref|XP_005854172.1|  4-hydroxyphenylpyruvate dioxygenase                147   3e-37   Nannochloropsis gaditana CCMP526
ref|XP_002499380.1|  predicted protein                                  145   6e-37   Micromonas commoda
ref|XP_009520219.1|  hypothetical protein PHYSODRAFT_539872             144   1e-36   Phytophthora sojae
ref|XP_002968708.1|  hypothetical protein SELMODRAFT_91092              144   2e-36   Selaginella moellendorffii
ref|XP_010475412.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    138   3e-36   
gb|ETL47152.1|  hypothetical protein L916_03076                         137   1e-35   Phytophthora parasitica
ref|XP_011402112.1|  4-hydroxyphenylpyruvate dioxygenase                145   1e-35   Auxenochlorella protothecoides
ref|XP_004368015.1|  4hydroxyphenylpyruvate dioxygenase                 140   3e-35   Acanthamoeba castellanii str. Neff
ref|XP_003078281.1|  p-hydroxyphenylpyruvate dioxigenase (ISS)          139   1e-34   Ostreococcus tauri
ref|XP_001416712.1|  predicted protein                                  139   1e-34   Ostreococcus lucimarinus CCE9901
ref|XP_009825872.1|  4-hydroxyphenylpyruvate dioxygenase                138   3e-34   Aphanomyces astaci
gb|ACN36372.1|  unknown                                                 135   2e-33   Zea mays [maize]
ref|XP_005850767.1|  hypothetical protein CHLNCDRAFT_20078              134   6e-33   Chlorella variabilis
ref|XP_002902379.1|  4-hydroxyphenylpyruvate dioxygenase                130   4e-32   Phytophthora infestans T30-4
gb|EAZ21880.1|  hypothetical protein OsJ_05532                          132   5e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EWM22210.1|  4-hydroxyphenylpyruvate dioxygenase                     132   6e-32   Nannochloropsis gaditana
gb|EWM22209.1|  4-hydroxyphenylpyruvate dioxygenase                     131   7e-32   Nannochloropsis gaditana
ref|XP_002990594.1|  hypothetical protein SELMODRAFT_161008             130   1e-31   
gb|KDD74142.1|  hypothetical protein H632_c1538p1                       129   3e-31   Helicosporidium sp. ATCC 50920
ref|XP_002307562.2|  hypothetical protein POPTR_0005s22680g             122   1e-29   
ref|XP_003575746.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    125   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_007048969.1|  Phytoene desaturation 1, putative                  122   1e-28   
gb|ETK93728.1|  hypothetical protein L915_03107                         114   9e-28   Phytophthora parasitica
ref|XP_008881550.1|  hypothetical protein H310_15345                    115   3e-27   Aphanomyces invadans
ref|XP_007511204.1|  4-hydroxyphenylpyruvate dioxygenase                116   2e-26   Bathycoccus prasinos
gb|ERN14876.1|  hypothetical protein AMTR_s00032p00156270               107   4e-25   Amborella trichopoda
gb|AET00342.2|  4-hydroxyphenylpyruvate dioxygenase                     108   2e-24   Medicago truncatula
gb|EEC72567.1|  hypothetical protein OsI_06005                          108   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_002287272.1|  4-hydroxyphenylpyruvate dioxygenase                105   6e-23   Thalassiosira pseudonana CCMP1335
emb|CBJ28697.1|  4-hydroxyphenylpyruvate dioxygenase, plastid pre...    106   7e-23   Ectocarpus siliculosus
ref|XP_008360256.1|  PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphe...    105   8e-23   
ref|XP_002895668.1|  4-hydroxyphenylpyruvate dioxygenase, putative      100   4e-22   Phytophthora infestans T30-4
ref|XP_008390582.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...    100   4e-21   
dbj|BAJ93624.1|  predicted protein                                    92.4    9e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ETP51665.1|  hypothetical protein F442_03207                       90.5    1e-19   Phytophthora parasitica P10297
ref|XP_005852430.1|  4-hydroxyphenylpyruvate dioxygenase              92.0    5e-19   Nannochloropsis gaditana CCMP526
gb|EJK75816.1|  hypothetical protein THAOC_02448                      92.8    6e-18   Thalassiosira oceanica
gb|EDL65287.1|  4-hydroxyphenylpyruvate dioxygenase                   86.3    3e-16   Bacillus sp. SG-1
ref|WP_044022537.1|  4-hydroxyphenylpyruvate dioxygenase              86.3    3e-16   Bacillus sp. SG-1
gb|ETM53453.1|  hypothetical protein L914_03077                       80.1    6e-16   Phytophthora parasitica
ref|XP_001694722.1|  4-hydroxyphenylpyruvate dioxygenase              83.2    4e-15   Chlamydomonas reinhardtii
ref|WP_020060738.1|  4-hydroxyphenylpyruvate dioxygenase              80.1    4e-14   Bacillus sp. 123MFChir2
gb|AIF24945.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       79.7    5e-14   uncultured marine group II/III euryarchaeote SAT1000_41_C12
ref|WP_035350816.1|  4-hydroxyphenylpyruvate dioxygenase              79.3    9e-14   Edaphobacter aggregans
ref|WP_027987430.1|  4-hydroxyphenylpyruvate dioxygenase              79.3    9e-14   
gb|EMT08063.1|  4-hydroxyphenylpyruvate dioxygenase                   78.6    1e-13   
gb|AJD92913.1|  4-hydroxyphenylpyruvate dioxygenase                   79.0    1e-13   Jeotgalibacillus malaysiensis
ref|WP_039814073.1|  4-hydroxyphenylpyruvate dioxygenase              78.6    2e-13   
ref|WP_035432465.1|  4-hydroxyphenylpyruvate dioxygenase              78.6    2e-13   Bacillus
ref|WP_026951577.1|  4-hydroxyphenylpyruvate dioxygenase              78.2    2e-13   Algoriphagus mannitolivorans
gb|KIZ04447.1|  4-hydroxyphenylpyruvate dioxygenase                   77.8    2e-13   Monoraphidium neglectum
ref|WP_019037466.1|  4-hydroxyphenylpyruvate dioxygenase              77.8    3e-13   Psychroflexus tropicus
ref|WP_041057061.1|  4-hydroxyphenylpyruvate dioxygenase              77.4    4e-13   Jeotgalibacillus campisalis
ref|WP_012793017.1|  4-hydroxyphenylpyruvate dioxygenase              77.4    4e-13   Chitinophaga pinensis
ref|WP_009334741.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  77.4    4e-13   Bacillus
ref|WP_012930763.1|  4-hydroxyphenylpyruvate dioxygenase              76.6    8e-13   
ref|WP_018620037.1|  4-hydroxyphenylpyruvate dioxygenase              76.3    1e-12   Spirosoma luteum
ref|WP_026581629.1|  4-hydroxyphenylpyruvate dioxygenase              76.3    1e-12   Bacillus sp. J33
ref|WP_002115481.1|  4-hydroxyphenylpyruvate dioxygenase              75.9    1e-12   Bacillus cereus
ref|WP_028785141.1|  4-hydroxyphenylpyruvate dioxygenase              75.9    1e-12   Thalassobacillus devorans
ref|WP_020602511.1|  4-hydroxyphenylpyruvate dioxygenase              75.9    1e-12   Spirosoma spitsbergense
gb|ABI53728.2|  4-hydroxyphenylpyruvate dioxygenase                   75.9    2e-12   uncultured bacterium
ref|WP_033694710.1|  4-hydroxyphenylpyruvate dioxygenase              75.9    2e-12   
ref|WP_000810915.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  75.9    2e-12   Bacillus
ref|WP_034756925.1|  4-hydroxyphenylpyruvate dioxygenase              75.5    2e-12   Chryseobacterium sp. OV259
ref|WP_000810916.1|  4-hydroxyphenylpyruvate dioxygenase              75.5    2e-12   Bacillus
gb|EEK86219.1|  4-hydroxyphenylpyruvate dioxygenase                   75.5    2e-12   Bacillus cereus ATCC 4342
gb|EEK69629.1|  4-hydroxyphenylpyruvate dioxygenase                   75.5    2e-12   Bacillus wiedmannii
ref|WP_001975475.1|  4-hydroxyphenylpyruvate dioxygenase              75.5    2e-12   Bacillus
gb|AHM63488.1|  4-hydroxyphenylpyruvate dioxygenase                   75.5    2e-12   Flammeovirgaceae bacterium 311
gb|KIW05916.1|  4-hydroxyphenylpyruvate dioxygenase                   75.9    2e-12   Verruconis gallopava
ref|WP_016089597.1|  4-hydroxyphenylpyruvate dioxygenase              75.5    2e-12   Bacillus
ref|WP_009054081.1|  4-hydroxyphenylpyruvate dioxygenase              75.1    2e-12   Nitritalea halalkaliphila
ref|WP_019122205.1|  4-hydroxyphenylpyruvate dioxygenase              75.1    2e-12   Brevibacillus massiliensis
dbj|BAH39165.1|  4-hydroxyphenylpyruvate dioxygenase                  75.1    3e-12   Gemmatimonas aurantiaca T-27
ref|WP_011522806.1|  4-hydroxyphenylpyruvate dioxygenase              74.7    3e-12   Candidatus Koribacter versatilis
ref|WP_018479076.1|  4-hydroxyphenylpyruvate dioxygenase              74.7    3e-12   Pontibacter roseus
ref|WP_007921180.1|  4-hydroxyphenylpyruvate dioxygenase              74.7    3e-12   Ktedonobacter racemifer
ref|WP_043930760.1|  4-hydroxyphenylpyruvate dioxygenase              74.7    4e-12   Bacillus sp. EB01
ref|WP_041266432.1|  4-hydroxyphenylpyruvate dioxygenase              74.7    4e-12   
ref|WP_034761020.1|  4-hydroxyphenylpyruvate dioxygenase              74.7    4e-12   Bacillus vietnamensis
ref|WP_038414892.1|  4-hydroxyphenylpyruvate dioxygenase              74.3    4e-12   
ref|WP_000810913.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  74.3    5e-12   Bacillus
ref|WP_000810914.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  74.3    5e-12   Bacillus cereus group
ref|WP_045688974.1|  4-hydroxyphenylpyruvate dioxygenase              74.3    5e-12   
ref|WP_044339125.1|  4-hydroxyphenylpyruvate dioxygenase              74.3    5e-12   Bacillus aquimaris
gb|EEL19135.1|  4-hydroxyphenylpyruvate dioxygenase                   74.3    5e-12   Bacillus cereus 95/8201
gb|EEK46877.1|  4-hydroxyphenylpyruvate dioxygenase                   74.3    5e-12   Bacillus cereus m1293
ref|WP_029288834.1|  4-hydroxyphenylpyruvate dioxygenase              74.3    5e-12   Pedobacter sp. R20-19
gb|AFH81613.1|  4-hydroxyphenylpyruvate dioxygenase                   74.3    5e-12   Bacillus anthracis str. H9401
ref|WP_044202951.1|  4-hydroxyphenylpyruvate dioxygenase              74.3    5e-12   Flammeovirga sp. OC4
gb|AIM04210.1|  4-hydroxyphenylpyruvate dioxygenase                   74.3    5e-12   Bacillus anthracis [anthrax]
gb|EDM38745.1|  4-hydroxyphenylpyruvate dioxygenase                   74.3    5e-12   Pedobacter sp. BAL39
ref|WP_025606603.1|  4-hydroxyphenylpyruvate dioxygenase              73.9    6e-12   Pontibacter actiniarum
ref|WP_010602368.1|  4-hydroxyphenylpyruvate dioxygenase              74.3    6e-12   Pedobacter agri
gb|ABK83632.1|  4-hydroxyphenylpyruvate dioxygenase                   74.3    6e-12   Bacillus thuringiensis str. Al Hakam
ref|WP_035404066.1|  4-hydroxyphenylpyruvate dioxygenase              73.9    6e-12   
ref|WP_026963420.1|  4-hydroxyphenylpyruvate dioxygenase              73.9    6e-12   Alicyclobacillus pomorum
ref|WP_040930444.1|  hypothetical protein                             74.3    7e-12   
gb|KER09254.1|  4-hydroxyphenylpyruvate dioxygenase                   73.9    7e-12   Candidatus Thermochlorobacteriaceae bacterium GBChlB
ref|WP_039865967.1|  4-hydroxyphenylpyruvate dioxygenase              73.9    7e-12   Pedobacter sp. BAL39
ref|WP_000810921.1|  hypothetical protein                             72.4    7e-12   Bacillus cereus
ref|WP_037328791.1|  4-hydroxyphenylpyruvate dioxygenase              73.9    8e-12   
ref|WP_041488236.1|  4-hydroxyphenylpyruvate dioxygenase              73.6    9e-12   Bacillus pseudomycoides
ref|WP_025151089.1|  4-hydroxyphenylpyruvate dioxygenase              73.6    9e-12   Bacillus
ref|WP_002113414.1|  4-hydroxyphenylpyruvate dioxygenase              73.6    1e-11   Bacillus cereus group
ref|WP_000810925.1|  4-hydroxyphenylpyruvate dioxygenase              73.6    1e-11   Bacillus thuringiensis
ref|WP_003205593.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  73.6    1e-11   Bacillus
ref|WP_016117024.1|  4-hydroxyphenylpyruvate dioxygenase              73.6    1e-11   Bacillus cereus group
gb|EEM61947.1|  4-hydroxyphenylpyruvate dioxygenase                   73.6    1e-11   Bacillus thuringiensis serovar monterrey BGSC 4AJ1
ref|WP_044219112.1|  4-hydroxyphenylpyruvate dioxygenase              73.2    1e-11   Flammeovirga pacifica
ref|WP_002091386.1|  4-hydroxyphenylpyruvate dioxygenase              73.2    1e-11   Bacillus cereus
ref|WP_000810917.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  73.2    1e-11   Bacillus
ref|WP_029566295.1|  4-hydroxyphenylpyruvate dioxygenase              73.2    1e-11   Bacillus indicus
ref|WP_015024438.1|  4-hydroxyphenylpyruvate dioxygenase              73.2    1e-11   Psychroflexus torquis
ref|WP_002151375.1|  4-hydroxyphenylpyruvate dioxygenase              73.2    1e-11   Bacillus cereus
ref|WP_002140158.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  73.2    1e-11   Bacillus
ref|WP_002124802.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  72.8    1e-11   Bacillus
ref|WP_000810912.1|  4-hydroxyphenylpyruvate dioxygenase              72.8    2e-11   Bacillus cereus
ref|WP_000810911.1|  4-hydroxyphenylpyruvate dioxygenase              72.8    2e-11   Bacillus cereus
ref|WP_011983355.1|  4-hydroxyphenylpyruvate dioxygenase              72.8    2e-11   Bacillus cytotoxicus
gb|EEK80866.1|  4-hydroxyphenylpyruvate dioxygenase                   72.8    2e-11   Bacillus cereus R309803
gb|EEL89883.1|  4-hydroxyphenylpyruvate dioxygenase                   72.8    2e-11   Bacillus cereus AH1272
gb|EEL08156.1|  4-hydroxyphenylpyruvate dioxygenase                   72.8    2e-11   Bacillus cereus BDRD-ST196
ref|WP_025742459.1|  4-hydroxyphenylpyruvate dioxygenase              72.8    2e-11   Aquimarina pacifica
gb|EEM01328.1|  4-hydroxyphenylpyruvate dioxygenase                   72.8    2e-11   Bacillus mycoides DSM 2048
ref|WP_029286431.1|  4-hydroxyphenylpyruvate dioxygenase              72.8    2e-11   Bacillus indicus
ref|WP_000810910.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  72.8    2e-11   Bacillus
ref|WP_000810922.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  72.4    2e-11   Bacillus
ref|WP_000810919.1|  4-hydroxyphenylpyruvate dioxygenase              72.4    2e-11   Bacillus thuringiensis
ref|WP_035332546.1|  4-hydroxyphenylpyruvate dioxygenase              72.4    2e-11   Bacillus firmus
ref|WP_014798570.1|  4-hydroxyphenylpyruvate dioxygenase              72.4    2e-11   Bernardetia litoralis
ref|WP_000810923.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  72.4    2e-11   Bacillus
ref|WP_002175349.1|  4-hydroxyphenylpyruvate dioxygenase              72.4    2e-11   Bacillus cereus
ref|WP_000810920.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  72.4    2e-11   Bacillus
gb|EEL36476.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    2e-11   Bacillus cereus Rock3-28
gb|AHA08869.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    2e-11   Bacillus toyonensis BCT-7112
gb|EEL24963.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    2e-11   Bacillus cereus Rock1-3
ref|WP_026849707.1|  4-hydroxyphenylpyruvate dioxygenase              72.4    2e-11   
gb|EEM85743.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    2e-11   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
gb|EEK52737.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    2e-11   Bacillus cereus ATCC 10876
ref|WP_008991906.1|  4-hydroxyphenylpyruvate dioxygenase              72.4    2e-11   Galbibacter marinus
gb|KEZ79714.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    2e-11   Bacillus mycoides
emb|CDN39245.1|  unnamed protein product                              72.4    3e-11   Bacillus thuringiensis DB27
gb|EAO55509.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    3e-11   Bacillus thuringiensis serovar israelensis ATCC 35646
gb|EEM98379.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    3e-11   Bacillus thuringiensis IBL 200
gb|EEM30895.1|  4-hydroxyphenylpyruvate dioxygenase                   72.4    3e-11   Bacillus thuringiensis Bt407
ref|WP_026953937.1|  4-hydroxyphenylpyruvate dioxygenase              72.0    3e-11   Algoriphagus vanfongensis
ref|WP_004428063.1|  4-hydroxyphenylpyruvate dioxygenase              72.0    3e-11   Bacillus alcalophilus
ref|WP_010180748.1|  4-hydroxyphenylpyruvate dioxygenase              72.0    3e-11   
ref|WP_026576504.1|  4-hydroxyphenylpyruvate dioxygenase              72.0    4e-11   
ref|WP_000810924.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    4e-11   
ref|WP_032085540.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    4e-11   
ref|XP_004039245.1|  hypothetical protein IMG5_030220                 72.0    4e-11   
ref|WP_027388528.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    4e-11   
gb|AIM09594.1|  4-hydroxyphenylpyruvate dioxygenase                   68.9    4e-11   
ref|WP_002694277.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    4e-11   
ref|WP_027379233.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    4e-11   
ref|WP_017154241.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    5e-11   
ref|WP_026754189.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    5e-11   
ref|WP_042981475.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    5e-11   
ref|WP_016103358.1|  4-hydroxyphenylpyruvate dioxygenase              71.6    5e-11   
ref|WP_039476607.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    5e-11   
ref|WP_009194781.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    5e-11   
gb|KIZ01637.1|  4-hydroxyphenylpyruvate dioxygenase                   70.9    5e-11   
ref|WP_027318784.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    5e-11   
ref|WP_026445133.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    5e-11   
ref|WP_002657552.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    6e-11   
ref|WP_002139868.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    6e-11   
ref|WP_018676561.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    6e-11   
ref|WP_039793533.1|  4-hydroxyphenylpyruvate dioxygenase              71.2    6e-11   
ref|WP_027319537.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    7e-11   
ref|WP_020722836.1|  hypothetical protein                             70.9    7e-11   
ref|WP_015691557.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    7e-11   
ref|WP_027000962.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    7e-11   
ref|WP_007657880.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    8e-11   
ref|WP_033715568.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    8e-11   
ref|WP_024028907.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    8e-11   
ref|WP_034703907.1|  4-hydroxyphenylpyruvate dioxygenase              70.9    9e-11   
gb|EEK75276.1|  4-hydroxyphenylpyruvate dioxygenase                   70.5    1e-10   
ref|WP_037994498.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    1e-10   
ref|WP_003443627.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    1e-10   
ref|WP_044516999.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    1e-10   
ref|WP_000810926.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    1e-10   
ref|WP_034681211.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    1e-10   
ref|WP_015155318.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    1e-10   
ref|WP_034641974.1|  4-hydroxyphenylpyruvate dioxygenase              70.5    1e-10   
ref|XP_010909672.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygenase   70.1    1e-10   
ref|WP_036714699.1|  4-hydroxyphenylpyruvate dioxygenase              70.1    1e-10   
ref|WP_000810918.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  70.1    1e-10   
ref|WP_043323634.1|  4-hydroxyphenylpyruvate dioxygenase              70.1    1e-10   
gb|AIF09510.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       70.1    1e-10   
gb|AIF03427.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       70.1    2e-10   
ref|WP_034710537.1|  4-hydroxyphenylpyruvate dioxygenase              70.1    2e-10   
ref|WP_017733680.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
gb|EEM49828.1|  4-hydroxyphenylpyruvate dioxygenase                   70.1    2e-10   
gb|AIE95284.1|  4-hydroxyphenylpyruvate dioxygenase (HPD, hppD)       69.7    2e-10   
ref|WP_045872434.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
gb|KIY94741.1|  hypothetical protein MNEG_13223                       64.7    2e-10   
ref|WP_036689884.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
ref|WP_008626937.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
ref|WP_043968892.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
ref|WP_021624803.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
gb|EKE99981.1|  4-hydroxyphenylpyruvate dioxygenase                   69.7    2e-10   
ref|WP_034741798.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
ref|WP_043066209.1|  4-hydroxyphenylpyruvate dioxygenase              69.7    2e-10   
ref|WP_024983858.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    2e-10   
ref|WP_003389034.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    2e-10   
ref|WP_016200324.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    2e-10   
ref|WP_035306290.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    2e-10   
ref|WP_042242230.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    2e-10   
ref|WP_042722980.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    3e-10   
ref|XP_007783461.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    3e-10   
ref|WP_039717180.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    3e-10   
ref|WP_026592762.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    3e-10   
ref|WP_028524791.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    3e-10   
emb|CEG27351.1|  4-hydroxyphenylpyruvate dioxygenase                  68.9    3e-10   
ref|WP_034728580.1|  4-hydroxyphenylpyruvate dioxygenase              69.3    3e-10   
ref|WP_007086689.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    3e-10   
ref|WP_045493744.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    3e-10   
ref|WP_030504441.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    3e-10   
gb|ETZ23271.1|  4-hydroxyphenylpyruvate dioxygenase                   68.9    3e-10   
ref|WP_027373845.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    4e-10   
ref|WP_034697426.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    4e-10   
ref|WP_002663260.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    4e-10   
ref|WP_033677573.1|  4-hydroxyphenylpyruvate dioxygenase              68.9    4e-10   
ref|WP_025143212.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    4e-10   
ref|WP_034737515.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    5e-10   
ref|WP_034673352.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    5e-10   
ref|WP_013767878.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    5e-10   
ref|WP_015244644.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    5e-10   
ref|WP_039751226.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    6e-10   
ref|WP_039364671.1|  4-hydroxyphenylpyruvate dioxygenase              68.6    6e-10   
ref|WP_007841123.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  68.2    6e-10   
gb|AEV98905.1|  4-hydroxyphenylpyruvate dioxygenase                   68.2    6e-10   
ref|WP_041346698.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    6e-10   
ref|WP_020538265.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    6e-10   
ref|WP_013992807.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    6e-10   
ref|WP_029298941.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    6e-10   
ref|WP_034976657.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    7e-10   
ref|WP_034719571.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    7e-10   
ref|WP_020081285.1|  4-hydroxyphenylpyruvate dioxygenase              68.2    8e-10   
ref|WP_034970195.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    8e-10   
ref|WP_041252425.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    8e-10   
ref|XP_006648349.1|  PREDICTED: 4-hydroxyphenylpyruvate dioxygena...  67.8    8e-10   
ref|WP_018784091.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    8e-10   
ref|XP_004990068.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    9e-10   
ref|WP_002984319.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    9e-10   
ref|WP_026565302.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    9e-10   
ref|WP_030268682.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    9e-10   
ref|WP_013286633.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    9e-10   
ref|WP_036782447.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    1e-09   
ref|WP_009778508.1|  4-hydroxyphenylpyruvate dioxygenase              67.8    1e-09   
ref|WP_021346495.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  67.8    1e-09   
ref|WP_013476571.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_004918456.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_026443267.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_034871028.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  67.4    1e-09   
gb|EMD87247.1|  hypothetical protein COCHEDRAFT_1184059               67.4    1e-09   
ref|WP_038030064.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_044400665.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_015030461.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_026808648.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|XP_008023962.1|  hypothetical protein SETTUDRAFT_149259           67.4    1e-09   
ref|WP_040996642.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_024482632.1|  4-hydroxyphenylpyruvate dioxygenase              67.4    1e-09   
ref|WP_029275420.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    1e-09   
ref|WP_040626239.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    1e-09   
ref|WP_014678732.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|WP_014773381.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|WP_026166657.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|WP_026715284.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|XP_007689338.1|  hypothetical protein COCMIDRAFT_98981            67.0    2e-09   
ref|WP_045851174.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|WP_004987506.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  67.0    2e-09   
ref|WP_029450555.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|XP_007709357.1|  hypothetical protein COCCADRAFT_2606             67.0    2e-09   
ref|WP_019385947.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|WP_035299765.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
ref|WP_029098599.1|  4-hydroxyphenylpyruvate dioxygenase              67.0    2e-09   
gb|EHQ28394.1|  4-hydroxyphenylpyruvate dioxygenase                   67.0    2e-09   
ref|WP_038267139.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_020600511.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_028291610.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  66.6    2e-09   
ref|WP_016743081.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_015142185.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_026357374.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_027001905.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_020714812.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_028401266.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_044017090.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_026811950.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_038335703.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_009085370.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    2e-09   
ref|WP_044004859.1|  4-hydroxyphenylpyruvate dioxygenase              66.6    3e-09   
ref|WP_044897247.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_025025477.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_030954355.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
gb|AHJ98466.1|  4-hydroxyphenylpyruvate dioxygenase                   66.2    3e-09   
ref|WP_013452919.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_026769855.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_031426681.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|XP_007875856.1|  hypothetical protein PFL1_00168                  66.2    3e-09   
ref|WP_028376924.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_034042033.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_026774795.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_044642395.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_024740330.1|  4-hydroxyphenylpyruvate dioxygenase              66.2    3e-09   
ref|WP_032132046.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    3e-09   
ref|WP_007722926.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_044046500.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_023573098.1|  hppD protein                                     65.9    4e-09   
gb|AHF14960.1|  4-hydroxyphenylpyruvate dioxygenase                   65.9    4e-09   
ref|WP_026989882.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
dbj|GAA84011.1|  4-hydroxyphenylpyruvate dioxygenase                  65.9    4e-09   
ref|WP_002997254.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_003008303.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_026880529.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_015361530.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_014263863.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_028891719.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    4e-09   
ref|WP_004569589.1|  4-hydroxyphenylpyruvate dioxygenase              65.9    5e-09   
ref|WP_024282366.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    5e-09   
ref|WP_006509601.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    5e-09   
ref|WP_033563346.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    5e-09   
ref|WP_016873294.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    5e-09   
dbj|GAL62162.1|  4-hydroxyphenylpyruvate dioxygenase                  65.5    5e-09   
ref|WP_039139230.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    6e-09   
ref|WP_028786248.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    6e-09   
ref|WP_022827729.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    6e-09   
ref|XP_002775900.1|  4-hydroxyphenylpyruvate dioxygenase, putative    65.5    6e-09   
ref|WP_023578784.1|  hppD protein                                     65.5    6e-09   
ref|XP_007704185.1|  hypothetical protein COCSADRAFT_246536           65.5    6e-09   
ref|WP_034260207.1|  4-hydroxyphenylpyruvate dioxygenase              65.5    6e-09   
ref|WP_028121834.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    6e-09   
ref|WP_039132574.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_015809084.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
gb|ADP36956.1|  hypothetical protein                                  62.4    7e-09   
ref|WP_026582853.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_013869441.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_023571103.1|  hppD protein                                     65.1    7e-09   
ref|WP_010194005.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_039351458.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_002699324.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_013597323.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_027384241.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_015892585.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_045969995.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_020529489.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    7e-09   
ref|WP_017250633.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    8e-09   
ref|WP_038330954.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    8e-09   
ref|WP_026716679.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    8e-09   
ref|WP_038985894.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    8e-09   
ref|WP_020895669.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    8e-09   
ref|WP_011404122.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    8e-09   
ref|WP_026978936.1|  4-hydroxyphenylpyruvate dioxygenase              65.1    8e-09   
gb|AFZ13031.1|  4-hydroxyphenylpyruvate dioxygenase                   64.7    1e-08   
ref|WP_026945711.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    1e-08   
ref|WP_026575026.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    1e-08   
ref|WP_030696453.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    1e-08   
ref|WP_020213884.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    1e-08   
ref|WP_034097377.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    1e-08   
ref|WP_011962402.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    1e-08   
ref|WP_010171291.1|  4-hydroxyphenylpyruvate dioxygenase              64.7    1e-08   
gb|KGE89495.1|  4-hydroxyphenylpyruvate dioxygenase                   64.3    1e-08   
gb|AIJ36747.1|  4-hydroxyphenylpyruvate dioxygenase                   64.7    1e-08   
ref|WP_009790882.1|  MULTISPECIES: 4-hydroxyphenylpyruvate dioxyg...  64.3    1e-08   
ref|WP_044216202.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    1e-08   
gb|EAP87609.1|  4-hydroxyphenylpyruvate dioxygenase                   64.3    1e-08   
ref|WP_034088495.1|  4-hydroxyphenylpyruvate dioxygenase              64.3    1e-08   



>ref|XP_009587203.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nicotiana tomentosiformis]
Length=447

 Score =   292 bits (748),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 176/202 (87%), Gaps = 1/202 (0%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGFK+F+R+NP+SD FSVKRFHH+EFWCGDATNT RRFSW+LGMPIAAKSDLSTGNS
Sbjct  25   FKLVGFKNFIRINPRSDFFSVKRFHHIEFWCGDATNTVRRFSWSLGMPIAAKSDLSTGNS  84

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
             HASYLLR   G LQFLFTAPY+ SIS P+SAAIPSFS S HRSF ATHGLGVRAVAL V
Sbjct  85   VHASYLLRPVSGSLQFLFTAPYSPSISTPSSAAIPSFSTSVHRSFTATHGLGVRAVALEV  144

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
            E+   AFSASVSRGAKP+ EPVT++ +V +AEVHLYGDVVLRF+SYL D  ++  FLPGF
Sbjct  145  ENAYTAFSASVSRGAKPMFEPVTIDERVAVAEVHLYGDVVLRFVSYLKDADSL-VFLPGF  203

Query  670  EPMDGTASYQDLDYGIRRLDHA  735
            E MD TASY++LDYGIRRLDHA
Sbjct  204  EAMDETASYKELDYGIRRLDHA  225



>ref|XP_009770088.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nicotiana sylvestris]
Length=447

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGFK+F+R NP+SD FSVKRFHH+EFWCGDATNTARRFSW+LGMPIAAKSDLSTGNS
Sbjct  25   FKLVGFKNFIRTNPRSDFFSVKRFHHIEFWCGDATNTARRFSWSLGMPIAAKSDLSTGNS  84

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
             HASYLLR   G LQFLFTA Y+ SIS P+SAAIPSFS S HRSF  THGLGVRAVAL V
Sbjct  85   VHASYLLRPVSGSLQFLFTATYSPSISTPSSAAIPSFSTSTHRSFTTTHGLGVRAVALEV  144

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
            E+   AFSAS+SRGAKP+ EPVT++ +V +AEVHLYGDVVLRF+SYL D  ++  FLPGF
Sbjct  145  ENAYTAFSASISRGAKPMFEPVTIDERVAVAEVHLYGDVVLRFVSYLKDADSL-VFLPGF  203

Query  670  EPMDGTASYQDLDYGIRRLDHA  735
            E M+ TASY++LDYGIRRLDHA
Sbjct  204  EAMEETASYKELDYGIRRLDHA  225



>gb|ADZ24701.1| 4-hydroxyphenylpyruvate dioxygenase 2 [Solanum pennellii]
Length=441

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 177/221 (80%), Gaps = 5/221 (2%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET S+ +         FKLVGF +F+R NP+SD FSVKRFHH+EFWCGDATNT+RRF
Sbjct  3    MGKETLSTTD----TTGATFKLVGFNNFIRANPRSDFFSVKRFHHIEFWCGDATNTSRRF  58

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            SW+LGMPI AKSDLSTGNS HASYLLR+  GELQF+FTAPY+ SIS P++A IPSFS   
Sbjct  59   SWSLGMPITAKSDLSTGNSVHASYLLRSVSGELQFVFTAPYSPSISVPSTAGIPSFSTPT  118

Query  433  HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVL  612
            HR F A HGLGVRAVAL VE+   AFSASV+RGAKP  EPVT++  V +AEVHLYGDVVL
Sbjct  119  HRDFTAKHGLGVRAVALEVENAYLAFSASVARGAKPRFEPVTIDEHVAVAEVHLYGDVVL  178

Query  613  RFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            RF+S + D  ++  FLPGFE M+ T+S+++LDYGIRRLDHA
Sbjct  179  RFVSLVKDADSL-IFLPGFEAMNETSSFKELDYGIRRLDHA  218



>ref|XP_004240171.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
lycopersicum]
Length=441

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 175/221 (79%), Gaps = 5/221 (2%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET S+ +         FKLVGF +F+R NP+SD FSVKRFHH+EFWCGDATNT+RRF
Sbjct  3    MGKETLSTTD----TTGATFKLVGFNNFIRANPRSDFFSVKRFHHIEFWCGDATNTSRRF  58

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            SW+LGMPI AKSDLSTGNS HASYLLR+  GELQF+FTAPY+ SIS P++A IPSFS   
Sbjct  59   SWSLGMPITAKSDLSTGNSVHASYLLRSVSGELQFVFTAPYSPSISVPSTAGIPSFSTPT  118

Query  433  HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVL  612
            +R F A HGLGVRAVAL VE+   AFSASV+RGAKP  EPVT++  V +AEVHLYGDVVL
Sbjct  119  YRDFTAKHGLGVRAVALEVENAYLAFSASVARGAKPRFEPVTIDEHVAVAEVHLYGDVVL  178

Query  613  RFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            RF+S + D   +  FLPGFE MD T+S+++LDYGI RLDHA
Sbjct  179  RFVSLVKDADTL-IFLPGFEAMDETSSFKELDYGIHRLDHA  218



>ref|XP_006354418.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
tuberosum]
Length=442

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 168/202 (83%), Gaps = 1/202 (0%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGF +F+R NP+SD FSVKRFHH+EFWCGDATNT+RRFSW+LGMPI AKSDLSTGNS
Sbjct  20   FKLVGFNNFIRANPRSDFFSVKRFHHIEFWCGDATNTSRRFSWSLGMPITAKSDLSTGNS  79

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
             HASYLLR+  GELQF+FTAPY+ SIS P++A IPSFS S HR F A HGLGV AVAL V
Sbjct  80   VHASYLLRSVSGELQFVFTAPYSPSISVPSTAGIPSFSTSTHRDFTAKHGLGVCAVALEV  139

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
            E+   AFSASVSRGAKP  EPVT++  V +AEVHLYGDVVLRF+S++ D   +  FLPGF
Sbjct  140  ENAYLAFSASVSRGAKPRFEPVTIDEHVAVAEVHLYGDVVLRFVSFVKDADCL-IFLPGF  198

Query  670  EPMDGTASYQDLDYGIRRLDHA  735
            E MD T+S+ +LDYGIRRLDHA
Sbjct  199  EAMDETSSFTELDYGIRRLDHA  220



>ref|XP_006357690.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Solanum 
tuberosum]
Length=447

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 171/202 (85%), Gaps = 5/202 (2%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            +KLVGF +FVR NP+SD F+VKRFHH+EFWCGDATNTARRFSW LG+PIAAKSDLSTGNS
Sbjct  29   YKLVGFNNFVRTNPRSDLFNVKRFHHIEFWCGDATNTARRFSWGLGLPIAAKSDLSTGNS  88

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
             HASYLLR+S  +LQFLFTAPY+ +IS P+S++IP+FS S+HRSF  THGLGVRA+AL V
Sbjct  89   VHASYLLRSSSSQLQFLFTAPYSPAISTPSSSSIPTFSVSSHRSFTETHGLGVRAIALEV  148

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
            E+++ AFS  VS GAKPVSEPV LN++VV++EVHLYGDVVLRF+S+L D S    FLPGF
Sbjct  149  ENSRLAFSTCVSHGAKPVSEPVILNDEVVISEVHLYGDVVLRFVSFLKD-SNRFVFLPGF  207

Query  670  EPMDGTASYQDLDYGIRRLDHA  735
            E ++G      LDYGIRRLDHA
Sbjct  208  ELVEGA----QLDYGIRRLDHA  225



>ref|XP_011100559.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X2 [Sesamum 
indicum]
Length=442

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 175/238 (74%), Gaps = 17/238 (7%)
 Frame = +1

Query  58   KLTEVMGKETSSSVNHHSTPENGG-----------FKLVGFKDFVRVNPKSDHFSVKRFH  204
            K    MGKE  ++    S+P               FKLVGFK+F+R NPKSDHF V RFH
Sbjct  42   KTKATMGKEPITTTATASSPAGAAAESESAAAHAEFKLVGFKNFIRTNPKSDHFPVHRFH  101

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            HVEFWCGDA NTA+RFSW LGMP+ AKSDLSTGNSAHASYLLR+  G+L F+FTAPY+ S
Sbjct  102  HVEFWCGDAINTAKRFSWGLGMPLVAKSDLSTGNSAHASYLLRS--GQLNFVFTAPYSPS  159

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL-  561
            IS  +SAAIPSFS   HRSF ++HGL VRAVA+ VE   +A+SASVSRGAKP+S P+ L 
Sbjct  160  ISISSSAAIPSFSFPVHRSFTSSHGLAVRAVAIQVESAFSAYSASVSRGAKPISPPILLS  219

Query  562  NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +N+  +AEVHLYGD VLRF+S   D    T FLPGFEP+D   SYQ+LDYGIRRLDHA
Sbjct  220  DNKTAIAEVHLYGDSVLRFVSCGDDG---TGFLPGFEPVDNEMSYQELDYGIRRLDHA  274



>ref|XP_011100558.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase isoform X1 [Sesamum 
indicum]
Length=496

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 175/238 (74%), Gaps = 17/238 (7%)
 Frame = +1

Query  58   KLTEVMGKETSSSVNHHSTPENGG-----------FKLVGFKDFVRVNPKSDHFSVKRFH  204
            K    MGKE  ++    S+P               FKLVGFK+F+R NPKSDHF V RFH
Sbjct  42   KTKATMGKEPITTTATASSPAGAAAESESAAAHAEFKLVGFKNFIRTNPKSDHFPVHRFH  101

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            HVEFWCGDA NTA+RFSW LGMP+ AKSDLSTGNSAHASYLLR+  G+L F+FTAPY+ S
Sbjct  102  HVEFWCGDAINTAKRFSWGLGMPLVAKSDLSTGNSAHASYLLRS--GQLNFVFTAPYSPS  159

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL-  561
            IS  +SAAIPSFS   HRSF ++HGL VRAVA+ VE   +A+SASVSRGAKP+S P+ L 
Sbjct  160  ISISSSAAIPSFSFPVHRSFTSSHGLAVRAVAIQVESAFSAYSASVSRGAKPISPPILLS  219

Query  562  NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +N+  +AEVHLYGD VLRF+S   D    T FLPGFEP+D   SYQ+LDYGIRRLDHA
Sbjct  220  DNKTAIAEVHLYGDSVLRFVSCGDDG---TGFLPGFEPVDNEMSYQELDYGIRRLDHA  274



>gb|EYU42802.1| hypothetical protein MIMGU_mgv1a005210mg [Erythranthe guttata]
Length=493

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 168/204 (82%), Gaps = 4/204 (2%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGFK+FVR NP+SDHF V RFHH+EFWCGDATNTARRFSW LGMP+ AKSDLSTGNS
Sbjct  74   FKLVGFKNFVRANPRSDHFPVHRFHHIEFWCGDATNTARRFSWGLGMPLVAKSDLSTGNS  133

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
            AHASYLLR+  G+L FLFTA Y+ SIS+P+SA+IPSFS SAHRSF ++HGL VRAVA+ V
Sbjct  134  AHASYLLRS--GQLNFLFTAAYSPSISSPSSASIPSFSLSAHRSFTSSHGLAVRAVAIQV  191

Query  490  EDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYGDVVLRFISYLSDPSAVTT-FLP  663
            E   +A+SA+VSRGA P+S PV L +N+  +AEVHLYGD VLRF+SY    SA    FLP
Sbjct  192  ESAFSAYSAAVSRGAVPISPPVLLSDNKTSIAEVHLYGDAVLRFVSYNDIESASNGFFLP  251

Query  664  GFEPMDGTASYQDLDYGIRRLDHA  735
             FEP+D   SYQDLDYGIR+LDHA
Sbjct  252  DFEPLDNAISYQDLDYGIRKLDHA  275



>gb|ACN78586.1| 4-hydroxyphenylpyruvate dioxygenase [Lactuca sativa]
Length=446

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 168/227 (74%), Gaps = 10/227 (4%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MG E   S N         FKLVGF +F+R NP SD FSVKRFHH+ FWC DATNTARRF
Sbjct  1    MGTEAKPS-NVAGEQTGSAFKLVGFNNFIRTNPMSDKFSVKRFHHIGFWCSDATNTARRF  59

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            SW LGMPI  KSDLSTGN+ HASYLLR+  G+L FLFTAPY+ SIS+  ++   S  + +
Sbjct  60   SWGLGMPIVQKSDLSTGNATHASYLLRS--GQLNFLFTAPYSPSISSAVTSTTASIPSFS  117

Query  433  H---RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYG  600
            H   R+F A+HGL VR+VA+ VED + AFS SVS GAKP S P+TL NN VVL+EV LYG
Sbjct  118  HTDCRNFTASHGLAVRSVAIEVEDAEIAFSVSVSHGAKPSSSPITLGNNDVVLSEVKLYG  177

Query  601  DVVLRFISYLSDPS--AVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            DVVLR+ISY  +P+   ++ FLPGFEP++ T+S+ DLDYGIRRLDHA
Sbjct  178  DVVLRYISY-KNPNFDGISNFLPGFEPVEKTSSFPDLDYGIRRLDHA  223



>sp|O23920.1|HPPD_DAUCA RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Daucus carota]
 gb|AAC49815.1| 4-hydroxyphenylpyruvate dioxygenase [Daucus carota]
Length=442

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 169/227 (74%), Gaps = 13/227 (6%)
 Frame = +1

Query  73   MGKETS-----SSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATN  237
            MGK+ S     SS + +++P    FKLVGF +FVR NPKSDHF+VKRFHH+EFWCGDATN
Sbjct  1    MGKKQSEAEILSSNSSNTSPAT--FKLVGFNNFVRANPKSDHFAVKRFHHIEFWCGDATN  58

Query  238  TARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaips  417
            T+RRFSW LGMP+ AKSDLSTGNS HASYL+R++   L F+FTAPY+ S +  + +A   
Sbjct  59   TSRRFSWGLGMPLVAKSDLSTGNSVHASYLVRSAN--LSFVFTAPYSPSTTTSSGSAAIP  116

Query  418  f-sasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
              SAS   SF A HGL VRA+AL V D  AAF ASV+RGA+P S PV L++Q  LAEV L
Sbjct  117  SFSASGFHSFAAKHGLAVRAIALEVADVAAAFEASVARGARPASAPVELDDQAWLAEVEL  176

Query  595  YGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLRF+S+  +      FLPGFE ++GTAS+ DLDYGIRRLDHA
Sbjct  177  YGDVVLRFVSFGREEG---LFLPGFEAVEGTASFPDLDYGIRRLDHA  220



>gb|AGO59892.1| hydroxyphenylpyruvate dioxygenase [Perilla frutescens]
Length=477

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 174/225 (77%), Gaps = 12/225 (5%)
 Frame = +1

Query  64   TEVMGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTA  243
            T+ MG+E++     ++ P +G FKLVG+K+FVR NP SD F V RFHHVEFWCGDATNTA
Sbjct  42   TQTMGQEST-----NAAPAHGEFKLVGYKNFVRANPNSDRFPVHRFHHVEFWCGDATNTA  96

Query  244  RRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfs  423
            RRFSW LGMP+ AKSDLSTGNSAHASYLLR+  GEL FLFTAPY  S+S+P+SAAIP+FS
Sbjct  97   RRFSWGLGMPLVAKSDLSTGNSAHASYLLRS--GELSFLFTAPYPPSLSDPSSAAIPTFS  154

Query  424  asaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-QVVLAEVHLYG  600
             SAHR+F ++HGL VRAVA+ VE   +A SASVSRGAKPVS PV L++ +  +AEVHLYG
Sbjct  155  FSAHRAFTSSHGLAVRAVAIQVESAFSAHSASVSRGAKPVSPPVLLSDGKTAIAEVHLYG  214

Query  601  DVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            D VLR++S   D      FLP FE +D     Q+LDYGIRRLDHA
Sbjct  215  DAVLRYVSCGDD----GWFLPEFEAVDSGIYCQELDYGIRRLDHA  255



>ref|XP_002520369.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis]
 gb|EEF41985.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Ricinus communis]
Length=441

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 163/227 (72%), Gaps = 14/227 (6%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKE        STPE G FKLVGF +FVR NPKSD F VKRFHHVEFWC DATNTARRF
Sbjct  1    MGKENDVV---SSTPEQG-FKLVGFSNFVRANPKSDRFKVKRFHHVEFWCTDATNTARRF  56

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMPI AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI+   + +  + ++  
Sbjct  57   SWGLGMPIVAKSDLSTGNVTHASYLLRS--GDLNFLFTAPYSPSIAAMENLSHTATASIP  114

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                   R F+A HGL VRA+A+ VED + AF  S S GAKP +EP+ L+N+ V+AEVHL
Sbjct  115  TFSHETCRYFSAKHGLAVRAIAIEVEDAEIAFRTSASHGAKPSAEPILLDNRAVIAEVHL  174

Query  595  YGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR+ISY ++ S    FLP FEP+D   S+  +DYGIRRLDHA
Sbjct  175  YGDVVLRYISYKNEGSNF-EFLPRFEPVDEATSFP-VDYGIRRLDHA  219



>ref|XP_004491317.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Cicer arietinum]
Length=434

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 164/211 (78%), Gaps = 10/211 (5%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF +FVR NPKSD F VKRFHHVEFWC DATNTARRFSW LGMPI AKSDLSTGN
Sbjct  9    GFKLVGFNNFVRTNPKSDRFKVKRFHHVEFWCPDATNTARRFSWGLGMPIVAKSDLSTGN  68

Query  307  SAHASYLLRASGGELQFLFTapyassisnpa---saaipsfsasaHRSFNATHGLGVRAV  477
              HASYLLR+  G+L FLFTA Y+ SIS  A   +A+IPSFSA    +F+A+HGLGVRAV
Sbjct  69   QTHASYLLRS--GDLNFLFTAAYSPSISLSAPHPTASIPSFSAPTSFAFSASHGLGVRAV  126

Query  478  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----LSDPS  642
            A+ V+D + A++ SV+ GA P S PV L+N+V LAEV LYGDVVLR++SY      S+P+
Sbjct  127  AIEVDDAEFAYTTSVNHGAIPSSPPVVLDNRVKLAEVQLYGDVVLRYVSYNDPIETSNPN  186

Query  643  AVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                FLPGFEP++ T+S Q +D+GI+RLDHA
Sbjct  187  PNHWFLPGFEPVEETSSNQSIDFGIQRLDHA  217



>ref|XP_010688905.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Beta vulgaris 
subsp. vulgaris]
Length=434

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 162/202 (80%), Gaps = 4/202 (2%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVG+ +F+RVNP SD F VKRFHHVEFWCGDATN +RRFSW LGMPI AKSDLSTGNS
Sbjct  15   FKLVGYSNFIRVNPLSDLFPVKRFHHVEFWCGDATNVSRRFSWGLGMPIVAKSDLSTGNS  74

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
             HASYLLR+  GEL FLFT+PY+ S+S+P+SA IP+FS S   SF  +HGL VRAVA+ V
Sbjct  75   VHASYLLRS--GELHFLFTSPYSPSLSSPSSATIPTFSFSLFTSFLTSHGLAVRAVAVEV  132

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
            +D +AAF  SVS GA PVS P+ L++ VVL+EVHLYGDVVLR++S  S    +  FLPGF
Sbjct  133  QDAEAAFHISVSNGASPVSPPIRLHDGVVLSEVHLYGDVVLRYVSTSSVVDGI--FLPGF  190

Query  670  EPMDGTASYQDLDYGIRRLDHA  735
            E M G +S+Q+LD+G+RRLDHA
Sbjct  191  EEMLGESSFQELDFGLRRLDHA  212



>gb|AGG10562.1| 4-hydroxyphenylpyruvate dioxygenase [Amaranthus tuberculatus]
Length=434

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 162/210 (77%), Gaps = 6/210 (3%)
 Frame = +1

Query  115  PEN---GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAK  285
            PEN     FKLVG+ +FVRVNPKSD F+VKRFHH+EFWCGDATN +RRFSW LGMP  AK
Sbjct  6    PENQPDSEFKLVGYSNFVRVNPKSDRFNVKRFHHIEFWCGDATNVSRRFSWGLGMPTVAK  65

Query  286  SDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLG  465
            SDLSTGNS HAS+LL  S G+L FLFT+PY+ ++S P+SAAIPSF  +    F  +HGLG
Sbjct  66   SDLSTGNSVHASFLL--SSGDLSFLFTSPYSPTMSIPSSAAIPSFDFNHFTKFLTSHGLG  123

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSA  645
            VRAVA+ VED +AAF+ SVS GA P   P+ L N VVL+EVHLYGDVVLR++SY ++   
Sbjct  124  VRAVAVEVEDAEAAFNISVSNGAIPCVSPIHLENGVVLSEVHLYGDVVLRYVSYGNECGD  183

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            V  FLPGFE M   +S++ LD+G+RRLDHA
Sbjct  184  V-FFLPGFEEMPEESSFRGLDFGLRRLDHA  212



>gb|KDO51876.1| hypothetical protein CISIN_1g013898mg [Citrus sinensis]
Length=389

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 162/226 (72%), Gaps = 19/226 (8%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET+  +           KLVGFK+FVR NPKSD F V RFHHVEFWC DATNTARRF
Sbjct  1    MGKETAELL----------VKLVGFKNFVRQNPKSDRFRVNRFHHVEFWCTDATNTARRF  50

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMPI AKSDLSTGN+ HASYLLR+  G+L+F+FTAPY+ SIS+ A A   S S   
Sbjct  51   SWGLGMPIVAKSDLSTGNTVHASYLLRS--GDLRFVFTAPYSPSISDAADAGNSSASLPT  108

Query  427  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  597
               +A RSF A+HGL  R++A+ VED   AF+ SV+ GAKP S PV L+N  V+AEV LY
Sbjct  109  FDHAACRSFAASHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVILDNLAVIAEVQLY  168

Query  598  GDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            GDVVLR++SY  D +    FLPGFEP D  +S+  LDYGIRRLDHA
Sbjct  169  GDVVLRYVSY-KDKANHLDFLPGFEPTDEISSFP-LDYGIRRLDHA  212



>ref|XP_009119049.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa]
 gb|ABI63586.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa subsp. pekinensis]
Length=443

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 163/232 (70%), Gaps = 18/232 (8%)
 Frame = +1

Query  73   MGKETSS-SVNHH-----STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDAT  234
            MG E ++ S N H     +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDAT
Sbjct  1    MGHENAAVSENQHHDDAATTSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDAT  60

Query  235  NTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaip  414
            N ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    
Sbjct  61   NVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGENPPTT  118

Query  415  sfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVL  579
            + S        +RSF ++HGLGVRAVA+ VED +AAFS SVS GA P S P+ LN+ V +
Sbjct  119  TASIPSFDHVTYRSFFSSHGLGVRAVAVEVEDAEAAFSISVSNGAVPSSPPIVLNDAVTI  178

Query  580  AEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            AEV LYGDVVLR++SY       T FLP FE +D T+S+  LDYGIRRLDHA
Sbjct  179  AEVKLYGDVVLRYVSY----KVATVFLPRFETVDDTSSFP-LDYGIRRLDHA  225



>dbj|BAH10638.1| 4-hydroxyphenylpyruvate dioxygenase [Hevea brasiliensis]
Length=445

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 169/233 (73%), Gaps = 20/233 (9%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKE  S  +  S P   GFKL+GF +FVR NP+SD F VKRFHHVEFWC DATNTA RF
Sbjct  1    MGKENDSVPS--SAP---GFKLLGFSNFVRTNPRSDLFKVKRFHHVEFWCTDATNTACRF  55

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMP  AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ +I++  + +  + ++  
Sbjct  56   SWGLGMPFVAKSDLSTGNVTHASYLLRS--GDLSFLFTAPYSPTIASMENFSHTATASIP  113

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                 A R+F+A HGLGVRA+A+ VED + A++ SV+RGA P+  P+TL+N+ V+AEVHL
Sbjct  114  TFSHEACRNFSAKHGLGVRAIAIEVEDAEIAYNTSVARGALPMGGPITLDNRAVVAEVHL  173

Query  595  YGDVVLRFISY------LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR+ISY      L+D S  + FLP FE +D  +S+  LDYGIRRLDHA
Sbjct  174  YGDVVLRYISYKNSNPNLNDSSPDSWFLPKFESVDEASSFP-LDYGIRRLDHA  225



>gb|ADZ24700.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Solanum pennellii]
Length=420

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 167/203 (82%), Gaps = 6/203 (3%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGF +FVR NP+SD F+VKRFHH+EFWCGDATNTARRFSW LG+PIAA SDLSTGNS
Sbjct  22   FKLVGFNNFVRTNPRSDFFTVKRFHHIEFWCGDATNTARRFSWGLGLPIAAISDLSTGNS  81

Query  310  AHA-SYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALV  486
             HA   L  +S  +LQFLFTAPY+ +IS P+S++IP+FS S+HRSF ATHGLGVRA+AL 
Sbjct  82   VHASYLLRSSSSSQLQFLFTAPYSPAISTPSSSSIPTFSVSSHRSFTATHGLGVRAIALE  141

Query  487  VEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPG  666
            VE+++ AFS  VS GAKPVSEPV LN++VV+AEVHLYGDVVLRF+S+L D S    FLPG
Sbjct  142  VENSRLAFSTCVSHGAKPVSEPVILNDEVVIAEVHLYGDVVLRFVSFLKD-SNCFVFLPG  200

Query  667  FEPMDGTASYQDLDYGIRRLDHA  735
            FE ++G      LDYGIRRLDHA
Sbjct  201  FESVEGA----HLDYGIRRLDHA  219



>ref|XP_006437130.1| hypothetical protein CICLE_v10031587mg [Citrus clementina]
 ref|XP_006484905.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Citrus sinensis]
 gb|ESR50370.1| hypothetical protein CICLE_v10031587mg [Citrus clementina]
 gb|KDO51875.1| hypothetical protein CISIN_1g013898mg [Citrus sinensis]
Length=434

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 162/226 (72%), Gaps = 19/226 (8%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET+  +           KLVGFK+FVR NPKSD F V RFHHVEFWC DATNTARRF
Sbjct  1    MGKETAELL----------VKLVGFKNFVRQNPKSDRFRVNRFHHVEFWCTDATNTARRF  50

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMPI AKSDLSTGN+ HASYLLR+  G+L+F+FTAPY+ SIS+ A A   S S   
Sbjct  51   SWGLGMPIVAKSDLSTGNTVHASYLLRS--GDLRFVFTAPYSPSISDAADAGNSSASLPT  108

Query  427  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  597
               +A RSF A+HGL  R++A+ VED   AF+ SV+ GAKP S PV L+N  V+AEV LY
Sbjct  109  FDHAACRSFAASHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVILDNLAVIAEVQLY  168

Query  598  GDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            GDVVLR++SY  D +    FLPGFEP D  +S+  LDYGIRRLDHA
Sbjct  169  GDVVLRYVSY-KDKANHLDFLPGFEPTDEISSFP-LDYGIRRLDHA  212



>ref|XP_010087866.1| 4-hydroxyphenylpyruvate dioxygenase [Morus notabilis]
 gb|EXB30302.1| 4-hydroxyphenylpyruvate dioxygenase [Morus notabilis]
Length=437

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 162/229 (71%), Gaps = 24/229 (10%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKE           + G FKLVGF +FVR NPKSD F V+RFHHVEFWCGDATNTARRF
Sbjct  3    MGKEN----------DGGDFKLVGFSNFVRTNPKSDRFGVRRFHHVEFWCGDATNTARRF  52

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMP+ AKS+LSTGN  HASYLLR+  G+LQFLFTAPY+ SI+  A+      S+  
Sbjct  53   SWGLGMPLIAKSNLSTGNLIHASYLLRS--GDLQFLFTAPYSPSIAAAAANQTTDCSSAA  110

Query  427  ------saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEV  588
                  +A  SF+ +HGL VRA+A+ VED + AF  SV+ GAKP S P+ L+N+VV+AEV
Sbjct  111  IPTFDRAAFLSFSTSHGLAVRAIAVEVEDAELAFVTSVAHGAKPSSRPIFLDNRVVIAEV  170

Query  589  HLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             LYGDVVLR++SY S P+    FLPGFEP+   A    LD+GIRRLDHA
Sbjct  171  RLYGDVVLRYVSYKS-PAVSDEFLPGFEPV---AESFPLDFGIRRLDHA  215



>ref|XP_012082570.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Jatropha curcas]
 gb|KDP45435.1| hypothetical protein JCGZ_09684 [Jatropha curcas]
Length=442

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 157/211 (74%), Gaps = 11/211 (5%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GF+LVGF +FVR NP+SD F VKRFHHVEFWC DATNTARRFSW LGMPI  KSD+STGN
Sbjct  15   GFQLVGFSNFVRTNPRSDRFKVKRFHHVEFWCTDATNTARRFSWGLGMPIVVKSDISTGN  74

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saHRSFNATHGLGV  468
              HASYLLR+  G+L FLFTAPY+ SI+   + +  + ++         R+F A HGL V
Sbjct  75   VTHASYLLRS--GDLNFLFTAPYSPSIAAMENLSNTATASIPTFNHEDCRNFTAKHGLAV  132

Query  469  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL-SDPSA  645
            RA+AL VED   AF+ SV+ GA+P +EP+ L+N+ V+AEVHLYGDVVLR+ISY  S+P+ 
Sbjct  133  RAIALEVEDAVIAFNTSVAHGAQPSAEPIALDNRAVVAEVHLYGDVVLRYISYYNSNPND  192

Query  646  VTT-FLPGFEPMDGTASYQDLDYGIRRLDHA  735
                FLP FE MD ++S+  LDYGIRRLDHA
Sbjct  193  DHDWFLPKFEAMDESSSFS-LDYGIRRLDHA  222



>ref|NP_001154311.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AEE28007.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=418

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 168/236 (71%), Gaps = 14/236 (6%)
 Frame = +1

Query  58   KLTEVMGKETSSSVNHHSTPENG-----GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWC  222
            +L + MG + +++V+ +   ++G     GFKLVGF  FVR NPKSD F VKRFHH+EFWC
Sbjct  24   ELVKSMGHQ-NAAVSENQNHDDGAASSPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWC  82

Query  223  GDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpas  402
            GDATN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S    
Sbjct  83   GDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGEI  140

Query  403  aaipsfsasaH-----RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN  567
                + S  +      RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P+ LN 
Sbjct  141  KPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNE  200

Query  568  QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             V +AEV LYGDVVLR++SY ++ +  + FLPGFE ++  +S+  LDYGIRRLDHA
Sbjct  201  AVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFP-LDYGIRRLDHA  255



>ref|XP_002300867.2| 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family protein [Populus trichocarpa]
 gb|EEE80140.2| 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE family protein [Populus trichocarpa]
Length=444

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 165/233 (71%), Gaps = 23/233 (10%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKE  +S     TP  GGFKL GF  FVR NP+SD F V RFHH+EFWC DATNTARRF
Sbjct  1    MGKENETS----ETP--GGFKLGGFSSFVRANPRSDRFKVNRFHHIEFWCTDATNTARRF  54

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMPI AKSDLSTGN+ HASYLLR+  G+L FLFTAPY+ SI++  + +  + ++  
Sbjct  55   SWGLGMPIVAKSDLSTGNATHASYLLRS--GDLNFLFTAPYSPSIASMDNLSHTATASIP  112

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                   R F+A HGL VRA+A+ V+D + AF+ SV+ GAKP + PV L+N+ V+AEVHL
Sbjct  113  TFNHETSRGFSAKHGLAVRAIAIEVDDAELAFTTSVAHGAKPSASPVLLDNRAVVAEVHL  172

Query  595  YGDVVLRFISY------LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR++SY       SDP   + FLP FE ++  +S+  LDYGIRRLDHA
Sbjct  173  YGDVVLRYVSYGNSESDDSDPG--SWFLPKFEAVEAASSFP-LDYGIRRLDHA  222



>emb|CDY06652.1| BnaA10g04310D [Brassica napus]
Length=445

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 163/234 (70%), Gaps = 20/234 (9%)
 Frame = +1

Query  73   MGKETSS-SVNHH-------STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGD  228
            MG E ++ S N H       +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGD
Sbjct  1    MGHENAAVSENQHHDDDEAAATSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGD  60

Query  229  ATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaa  408
            ATN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +  
Sbjct  61   ATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGENPP  118

Query  409  ipsfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV  573
              + S        +RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P+ LN+ V
Sbjct  119  TTTASIPSFDHVTYRSFFSSHGLGVRAVAVEVEDAESAFSISVSNGAVPSSPPIVLNDAV  178

Query  574  VLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             +AEV LYGDVVLR++SY       T FLP FE +D T+S+  LDYGIRRLDHA
Sbjct  179  TIAEVKLYGDVVLRYVSY----KVATVFLPRFETVDDTSSFP-LDYGIRRLDHA  227



>ref|XP_011026229.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Populus 
euphratica]
Length=444

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 166/234 (71%), Gaps = 25/234 (11%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPEN-GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR  249
            MGK+       + TPE  GGF+LVGF  FVR NP+SD F V RFHH+EFWC DATNTARR
Sbjct  1    MGKQ-------NETPETPGGFRLVGFSSFVRANPRSDRFKVNRFHHIEFWCPDATNTARR  53

Query  250  FSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-  426
            FSW LGMPI AKSDLSTGN+ HASYLLR+  G+L FLFTAPY+ SI++  + +  + ++ 
Sbjct  54   FSWGLGMPIVAKSDLSTGNATHASYLLRS--GDLNFLFTAPYSPSIASMDNLSHTATASI  111

Query  427  -----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVH  591
                    R F+A HGL VRAVA+ V+D + AF+ SV+ GAKP + PV L+N+ V+AEVH
Sbjct  112  PTFNHETSRGFSAKHGLAVRAVAIEVDDAELAFTTSVAHGAKPSASPVLLDNRAVVAEVH  171

Query  592  LYGDVVLRFISY------LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LYGDVVLR++SY       SDP   + FLP FE ++  +S+  LDYGIRRLDHA
Sbjct  172  LYGDVVLRYVSYGNSERDESDPG--SWFLPKFEAVEAASSFP-LDYGIRRLDHA  222



>ref|XP_004243609.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Solanum lycopersicum]
Length=441

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 166/203 (82%), Gaps = 6/203 (3%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGF  FVR NP+SD F+VKRFHH+EFWCGDATNTARRFSW LG+PIAA SDLSTGNS
Sbjct  22   FKLVGFNHFVRTNPRSDFFTVKRFHHIEFWCGDATNTARRFSWGLGLPIAAISDLSTGNS  81

Query  310  AHA-SYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALV  486
             HA   L  +S  +LQFLFTAPY+S+IS  +SA+IP+FS S+HRSF ATHGLGVRA+AL 
Sbjct  82   VHASYLLRSSSSSQLQFLFTAPYSSAISTSSSASIPTFSVSSHRSFTATHGLGVRAIALE  141

Query  487  VEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPG  666
            VE+++ AFS  V+ GAKPVSEPV LN++VV+AEVHLYGDVVLRF+S+L D S    FLPG
Sbjct  142  VENSRLAFSTCVAHGAKPVSEPVILNDEVVIAEVHLYGDVVLRFVSFLKD-SNCFVFLPG  200

Query  667  FEPMDGTASYQDLDYGIRRLDHA  735
            FE ++G      LDYGIRRLDHA
Sbjct  201  FESVEGA----QLDYGIRRLDHA  219



>gb|AAM96960.1| 4-hydroxyphenylpyruvate dioxygenase HPD [Arabidopsis thaliana]
Length=473

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 168/236 (71%), Gaps = 14/236 (6%)
 Frame = +1

Query  58   KLTEVMGKETSSSVNHHSTPENG-----GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWC  222
            +L + MG + +++V+ +   ++G     GFKLVGF  FVR NPKSD F VKRFHH+EFWC
Sbjct  24   ELVKSMGHQ-NAAVSENQNHDDGAASSPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWC  82

Query  223  GDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpas  402
            GDATN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S    
Sbjct  83   GDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGEI  140

Query  403  aaipsfsasaH-----RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN  567
                + S  +      RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P+ LN 
Sbjct  141  KPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNE  200

Query  568  QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             V +AEV LYGDVVLR++SY ++ +  + FLPGFE ++  +S+  LDYGIRRLDHA
Sbjct  201  AVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFP-LDYGIRRLDHA  255



>ref|NP_172144.2| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAF24813.1|AC007592_6 F12K11.9 [Arabidopsis thaliana]
 gb|AEE28006.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=473

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 168/236 (71%), Gaps = 14/236 (6%)
 Frame = +1

Query  58   KLTEVMGKETSSSVNHHSTPENG-----GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWC  222
            +L + MG + +++V+ +   ++G     GFKLVGF  FVR NPKSD F VKRFHH+EFWC
Sbjct  24   ELVKSMGHQ-NAAVSENQNHDDGAASSPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWC  82

Query  223  GDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpas  402
            GDATN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S    
Sbjct  83   GDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGEI  140

Query  403  aaipsfsasaH-----RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN  567
                + S  +      RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P+ LN 
Sbjct  141  KPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNE  200

Query  568  QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             V +AEV LYGDVVLR++SY ++ +  + FLPGFE ++  +S+  LDYGIRRLDHA
Sbjct  201  AVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFP-LDYGIRRLDHA  255



>pdb|1SQD|A Chain A, Structural Basis For Inhibitor Selectivity Revealed 
By Crystal Structures Of Plant And Mammalian 4- Hydroxyphenylpyruvate 
Dioxygenases
 pdb|1TFZ|A Chain A, Structural Basis For Herbicidal Inhibitor Selectivity 
Revealed By Comparison Of Crystal Structures Of Plant And 
Mammalian 4- Hydroxyphenylpyruvate Dioxygenases
 pdb|1TG5|A Chain A, Crystal Structures Of Plant 4-Hydroxyphenylpyruvate 
Dioxygenases Complexed With Das645
Length=424

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 153/208 (74%), Gaps = 8/208 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  2    GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  61

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  471
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  62   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  119

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  120  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  179

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFE ++  +S+  LDYGIRRLDHA
Sbjct  180  EFLPGFERVEDASSFP-LDYGIRRLDHA  206



>gb|AID81984.1| hydroxyphenylpyruvate dioxygenase [Capsella bursa-pastoris]
Length=446

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 152/208 (73%), Gaps = 8/208 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM   AKSDLSTGN
Sbjct  24   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFTAKSDLSTGN  83

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  471
              HASYLL  + G+L+FLFTAPY+ S+S        + S       + RSF ++HGLGVR
Sbjct  84   MVHASYLL--TPGDLRFLFTAPYSPSLSAGEIKLTATASIPSFDHVSSRSFFSSHGLGVR  141

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            AVA+ V+D ++AFS SV+ GA P S P+ L+  V +AEV LYGDVVLR++SY    +   
Sbjct  142  AVAIEVDDAESAFSISVANGAIPSSPPIVLDESVTIAEVKLYGDVVLRYVSYKGGDTGQP  201

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFEP++ T+S+  LDYGIRRLDHA
Sbjct  202  QFLPGFEPVEDTSSFP-LDYGIRRLDHA  228



>gb|AAC62457.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
Length=419

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 153/208 (74%), Gaps = 8/208 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  23   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  82

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  471
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  83   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  140

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  141  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  200

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFE ++  +S+  LDYGIRRLDHA
Sbjct  201  EFLPGFERVEDASSFP-LDYGIRRLDHA  227



>sp|P93836.2|HPPD_ARATH RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Arabidopsis thaliana]
 pdb|1SP9|A Chain A, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP9|B Chain B, 4-hydroxyphenylpyruvate Dioxygenase
 gb|AAL16215.1|AF428446_1 At1g06570/F12K11_12 [Arabidopsis thaliana]
 gb|AAB58404.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAB70025.1| p-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAC15697.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis thaliana]
 gb|AAL61936.1| 4-hydroxyphenylpyruvate dioxygenase (HPD) [Arabidopsis thaliana]
 gb|AAM91145.1| 4-hydroxyphenylpyruvate dioxygenase (HPD) [Arabidopsis thaliana]
Length=445

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 153/208 (74%), Gaps = 8/208 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  23   GFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  82

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGLGVR  471
              HASYLL  + G+L+FLFTAPY+ S+S        + S  +      RSF ++HGLGVR
Sbjct  83   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVR  140

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            AVA+ VED ++AFS SV+ GA P S P+ LN  V +AEV LYGDVVLR++SY ++ +  +
Sbjct  141  AVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKS  200

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFE ++  +S+  LDYGIRRLDHA
Sbjct  201  EFLPGFERVEDASSFP-LDYGIRRLDHA  227



>gb|AFB74208.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
Length=445

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 162/234 (69%), Gaps = 20/234 (9%)
 Frame = +1

Query  73   MGKETSS-SVNHH-------STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGD  228
            MG E ++ S N H       +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGD
Sbjct  1    MGHENAAVSENQHHDDDEAAATSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGD  60

Query  229  ATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaa  408
            ATN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +  
Sbjct  61   ATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGENPP  118

Query  409  ipsfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV  573
              + S        +RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P+ LN+ V
Sbjct  119  TTTASIPSFDHVTYRSFFSSHGLGVRAVAVEVEDAESAFSISVSNGAVPSSPPIVLNDAV  178

Query  574  VLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             +AEV LYGDV LR++SY       T FLP FE +D T+S+  LDYGIRRLDHA
Sbjct  179  TIAEVKLYGDVALRYVSY----KVATVFLPRFETVDDTSSFP-LDYGIRRLDHA  227



>ref|XP_006307507.1| hypothetical protein CARUB_v10009131mg [Capsella rubella]
 gb|EOA40405.1| hypothetical protein CARUB_v10009131mg [Capsella rubella]
Length=446

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 151/208 (73%), Gaps = 8/208 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM   AKSDLSTGN
Sbjct  24   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFTAKSDLSTGN  83

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  471
              HASYLL  + G+L+FLFTAPY+ S+S        + S       + RSF ++HGLGVR
Sbjct  84   MVHASYLL--TSGDLRFLFTAPYSPSLSAGEIKLTATASIPSFDHVSSRSFFSSHGLGVR  141

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            AVA+ V+D  +AFS SV+ GA P S P+ L+  V +AEV LYGDVVLR++SY    +   
Sbjct  142  AVAIEVDDADSAFSISVANGAIPSSPPIVLDESVTIAEVKLYGDVVLRYVSYKGGDTGQP  201

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFEP++ T+S+  LDYGIRRLDHA
Sbjct  202  QFLPGFEPVEDTSSFP-LDYGIRRLDHA  228



>ref|XP_002892349.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68608.1| 4-hydroxyphenylpyruvate dioxygenase [Arabidopsis lyrata subsp. 
lyrata]
Length=445

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 162/233 (70%), Gaps = 18/233 (8%)
 Frame = +1

Query  73   MGKETSS-SVNHH------STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDA  231
            MG E ++ S N H      S+P   GFKLVGF  FVR NPKSD F VK FHH+EFWCGDA
Sbjct  1    MGHENAAVSENQHHDDGAASSP---GFKLVGFSKFVRKNPKSDKFKVKCFHHIEFWCGDA  57

Query  232  TNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaai  411
            TN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S S       
Sbjct  58   TNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSFSAGEIKPT  115

Query  412  psfsasaH-----RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV  576
             + S  +      RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P+ L+  V 
Sbjct  116  MTASIPSFDHVSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLDESVT  175

Query  577  LAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +AEV LYGDVVLR++SY    +  + FLPGFEP++ T+S+  LDYGIRRLDHA
Sbjct  176  IAEVKLYGDVVLRYVSYKGGNTDKSEFLPGFEPVEDTSSFP-LDYGIRRLDHA  227



>emb|CDY09969.1| BnaC08g44820D [Brassica napus]
Length=440

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 160/228 (70%), Gaps = 13/228 (6%)
 Frame = +1

Query  73   MGKETSS--SVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTAR  246
            MG E ++      H    + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN +R
Sbjct  1    MGHENAAVCETQQHDDAASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVSR  60

Query  247  RFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa  426
            RFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    + S 
Sbjct  61   RFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGEAQPSATASI  118

Query  427  -----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVH  591
                 ++ RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P  LN  V +AEV 
Sbjct  119  PSFDHASCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAVPSSPPNVLNGAVTIAEVK  178

Query  592  LYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LYGDVVLR++SY    +   +FLPGFE +D T+S+  LDYGIRRLDHA
Sbjct  179  LYGDVVLRYVSYY---NGTVSFLPGFESVDDTSSFP-LDYGIRRLDHA  222



>gb|AFB74207.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
Length=440

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 160/228 (70%), Gaps = 13/228 (6%)
 Frame = +1

Query  73   MGKETSSSV--NHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTAR  246
            MG E ++      H    + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN +R
Sbjct  1    MGHENAAVCEPQQHDDAASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVSR  60

Query  247  RFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa  426
            RFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    + S 
Sbjct  61   RFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGEAQPSATASI  118

Query  427  -----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVH  591
                 ++ RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P  LN  V +AEV 
Sbjct  119  PSFDHASCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAVPSSPPNVLNGAVTIAEVK  178

Query  592  LYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LYGDVVLR++SY    +   +FLPGFE +D T+S+  LDYGIRRLDHA
Sbjct  179  LYGDVVLRYVSYY---NGTVSFLPGFESVDDTSSFP-LDYGIRRLDHA  222



>gb|KFK42972.1| hypothetical protein AALP_AA1G063200 [Arabis alpina]
Length=439

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 156/218 (72%), Gaps = 8/218 (4%)
 Frame = +1

Query  91   SSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGM  270
            S  + H    +  FKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM
Sbjct  9    SETHQHDGSTSPEFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGM  68

Query  271  PIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---RS  441
              +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S        S  +  H   RS
Sbjct  69   RFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSATGPIDTASIPSFDHVTSRS  126

Query  442  FNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFI  621
            F ++HGLGVRAVA+ VED + AFS SV+ GA P S P+ L+  V ++EV LYGDVVLR++
Sbjct  127  FFSSHGLGVRAVAIEVEDAELAFSISVANGAIPSSPPIILDESVTISEVKLYGDVVLRYV  186

Query  622  SYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            SY  + +  T FLPGFE ++ T+S+  LDYGIRRLDHA
Sbjct  187  SYKGEVN--TNFLPGFEAVEDTSSFP-LDYGIRRLDHA  221



>gb|AFB74218.1| 4-hydroxyphenylpyruvate dioxygenase [Brassica napus]
 emb|CDY06216.1| BnaA09g49870D [Brassica napus]
Length=440

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 161/228 (71%), Gaps = 13/228 (6%)
 Frame = +1

Query  73   MGKETS--SSVNHH---STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATN  237
            MG E +  S   HH   ++  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN
Sbjct  1    MGHENAAVSESQHHDDAASAASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATN  60

Query  238  TARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaips  417
             ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   ++    
Sbjct  61   VARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLSAGETSTASI  118

Query  418  fsa--saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVH  591
             S    + RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P  LN  V +AEV 
Sbjct  119  PSFDHVSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAVPSSPPNVLNGAVTIAEVK  178

Query  592  LYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LYGDVVLR++SY    +    FLPGFE +D T+S+  LDYGIRRLDHA
Sbjct  179  LYGDVVLRYVSY---HNGAVNFLPGFESVDDTSSFP-LDYGIRRLDHA  222



>ref|XP_007048963.1| Phytoene desaturation 1 isoform 3 [Theobroma cacao]
 gb|EOX93120.1| Phytoene desaturation 1 isoform 3 [Theobroma cacao]
Length=389

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 161/227 (71%), Gaps = 16/227 (7%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRF
Sbjct  1    MGKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRF  53

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++  
Sbjct  54   SWGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIP  111

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV L
Sbjct  112  TFDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKL  171

Query  595  YGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR+IS+  +      FLPGFE ++   SY  LDYGIRRLDHA
Sbjct  172  YGDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSYP-LDYGIRRLDHA  217



>ref|XP_007048964.1| Phytoene desaturation 1 isoform 4, partial [Theobroma cacao]
 gb|EOX93121.1| Phytoene desaturation 1 isoform 4, partial [Theobroma cacao]
Length=396

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 161/227 (71%), Gaps = 16/227 (7%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRF
Sbjct  1    MGKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRF  53

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++  
Sbjct  54   SWGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIP  111

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV L
Sbjct  112  TFDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKL  171

Query  595  YGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR+IS+  +      FLPGFE ++   SY  LDYGIRRLDHA
Sbjct  172  YGDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSYP-LDYGIRRLDHA  217



>ref|XP_010486350.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Camelina sativa]
Length=450

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 154/209 (74%), Gaps = 9/209 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  27   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  86

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  471
              HASYLL  + G+L+FLFTAPY+ S++   +    + S       + RSF ++HGLGVR
Sbjct  87   MVHASYLL--TSGDLRFLFTAPYSPSLTAGETKPTATASIPSFDHVSSRSFFSSHGLGVR  144

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAV  648
            AVA+ VED ++AFS SVS GA P S P+ L+   V +AEV LYGDVVLR++SY    +  
Sbjct  145  AVAIEVEDAESAFSVSVSNGAIPSSPPMVLDGGAVTIAEVKLYGDVVLRYVSYKEGDTDK  204

Query  649  TTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            + FLPGFEP+  T+S+  LDYGIRRLDHA
Sbjct  205  SEFLPGFEPVVDTSSFP-LDYGIRRLDHA  232



>ref|XP_007048961.1| Phytoene desaturation 1 isoform 1 [Theobroma cacao]
 gb|EOX93118.1| Phytoene desaturation 1 isoform 1 [Theobroma cacao]
Length=439

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 161/227 (71%), Gaps = 16/227 (7%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRF
Sbjct  1    MGKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRF  53

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++  
Sbjct  54   SWGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIP  111

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV L
Sbjct  112  TFDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKL  171

Query  595  YGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR+IS+  +      FLPGFE ++   SY  LDYGIRRLDHA
Sbjct  172  YGDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSYP-LDYGIRRLDHA  217



>ref|XP_007048962.1| Phytoene desaturation 1 isoform 2 [Theobroma cacao]
 gb|EOX93119.1| Phytoene desaturation 1 isoform 2 [Theobroma cacao]
Length=445

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 161/227 (71%), Gaps = 16/227 (7%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKET S+ +         FKLVGF  FVR NPKSD F+VKRFHH+EFWC DATNTARRF
Sbjct  1    MGKETLSNSSQE-------FKLVGFSKFVRTNPKSDRFNVKRFHHIEFWCSDATNTARRF  53

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGM + AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI++  S +  S ++  
Sbjct  54   SWGLGMQLLAKSDLSTGNLTHASYLLRS--GDLHFLFTAPYSPSIAHSQSLSPLSTASIP  111

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                SA RSF+++HGL VRA+A+ VED + AF+ SVS GA P S PV L + V L+EV L
Sbjct  112  TFDHSACRSFSSSHGLAVRAIAIEVEDAETAFTTSVSHGALPSSPPVVLGDNVTLSEVKL  171

Query  595  YGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR+IS+  +      FLPGFE ++   SY  LDYGIRRLDHA
Sbjct  172  YGDVVLRYISHNKNNDHDFFFLPGFEKIEDNLSYP-LDYGIRRLDHA  217



>ref|XP_003617391.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AAX59006.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AET00350.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=437

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 153/209 (73%), Gaps = 8/209 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGFK+FVR NPKSD F+VKRFHHVEFWC DATNTARRFS  LGMPI AKSDLSTGN
Sbjct  14   GFKLVGFKNFVRANPKSDRFNVKRFHHVEFWCTDATNTARRFSHGLGMPIVAKSDLSTGN  73

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR---SFNATHGLGVRAV  477
              HASYLLR+  G+L FLF+A Y+ SIS  + ++  +    +     SF+A+HGL VRAV
Sbjct  74   LTHASYLLRS--GDLNFLFSAAYSPSISLSSPSSTAAIPTFSASTCFSFSASHGLAVRAV  131

Query  478  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS-DPSAVTT  654
            A+ VED + AF+ SV+ GA P S PV L N V LAEVHLYGDVVLR++SY   +P+    
Sbjct  132  AVEVEDAEVAFTTSVNLGAIPSSPPVILENNVKLAEVHLYGDVVLRYVSYNDLNPNQNPN  191

Query  655  --FLPGFEPMDGTASYQDLDYGIRRLDHA  735
              FLPGFE +   +S   LD+GIRRLDHA
Sbjct  192  LFFLPGFERVSDESSNSSLDFGIRRLDHA  220



>ref|XP_009118533.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brassica rapa]
Length=443

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 160/231 (69%), Gaps = 16/231 (7%)
 Frame = +1

Query  73   MGKETSSSVNHH-----STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATN  237
            MG E ++    H     ++  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN
Sbjct  1    MGHENAAVSESHQHDDAASAASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATN  60

Query  238  TARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaips  417
             ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+S   +    +
Sbjct  61   VARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TPGDLRFLFTAPYSPSLSAGETRTSAT  118

Query  418  fsasaH-----RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLA  582
             S  +      RSF ++HGLGVRAVA+ VED ++AFS SV+ GA P S P  LN  V +A
Sbjct  119  ASIPSFDHVSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAVPSSPPNVLNGAVTIA  178

Query  583  EVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            EV LYGDVVLR++SY    +    FLPGFE +D T+S+  LDYGIRRLDHA
Sbjct  179  EVKLYGDVVLRYVSY---HNGAVNFLPGFESVDDTSSFP-LDYGIRRLDHA  225



>emb|CDY10210.1| BnaC05g04530D [Brassica napus]
Length=445

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 164/234 (70%), Gaps = 20/234 (9%)
 Frame = +1

Query  73   MGKETSS-SVNHH------STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDA  231
            MG E ++ S N H      +T  + GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDA
Sbjct  1    MGHENAAVSENQHHDGDAAATSASPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDA  60

Query  232  TNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaai  411
            TN ARRFSW LGM  ++KSDLSTGN  HASYLL  + G+L+FLFTAP++ SIS       
Sbjct  61   TNVARRFSWGLGMRFSSKSDLSTGNMVHASYLL--TSGDLRFLFTAPFSPSISAGEIPPN  118

Query  412  psfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV  576
             + S        + SF ++HGLGVRAVA+ VED ++AFS S+S GA P S P+ LN+ V 
Sbjct  119  TTASIPSFDHVTYHSFFSSHGLGVRAVAIEVEDAESAFSVSISNGAVPSSPPIALNDAVT  178

Query  577  LAEVHLYGDVVLRFISYLSDPSAVTT-FLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +AEV LYGDVVLR++SY     AVT+ FLP FE ++ T+S+  LDYGIRRLDHA
Sbjct  179  IAEVKLYGDVVLRYVSY----KAVTSVFLPRFETVEDTSSFP-LDYGIRRLDHA  227



>ref|XP_008466793.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Cucumis melo]
Length=467

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 157/237 (66%), Gaps = 16/237 (7%)
 Frame = +1

Query  64   TEVMGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTA  243
            +EV  +   + +   +T    GFKL GF +F R NPKSD F VKRFHH+EFWC DATN A
Sbjct  12   SEVEAEPEPTPIEGGATAAGSGFKLTGFNNFTRTNPKSDRFKVKRFHHIEFWCTDATNVA  71

Query  244  RRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfs  423
            RRFSW LGM I AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI+   +    S +
Sbjct  72   RRFSWGLGMQIVAKSDLSTGNMTHASYLLRS--GQLCFLFTAPYSPSIAAAHNLTPASTA  129

Query  424  asaH------RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAE  585
            +         R+F+ THG G RA+AL VED + AF  SV+ GAKP   P+ L+N+ VL+E
Sbjct  130  SIPSFDHSVCRAFSGTHGFGARAIALEVEDAEIAFRTSVTHGAKPSCPPIVLDNRAVLSE  189

Query  586  VHLYGDVVLRFISYLSDPSAVTT-------FLPGFEPMDGTASYQDLDYGIRRLDHA  735
            VH+YGDVVLR+ISY +  S           FLP FE M+ TAS+  LD+GIRRLDHA
Sbjct  190  VHMYGDVVLRYISYKNPVSGDNGENKPDDWFLPKFEAMEETASFP-LDFGIRRLDHA  245



>ref|XP_006417901.1| hypothetical protein EUTSA_v10007634mg [Eutrema salsugineum]
 dbj|BAJ34100.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36254.1| hypothetical protein EUTSA_v10007634mg [Eutrema salsugineum]
Length=445

 Score =   227 bits (579),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 153/211 (73%), Gaps = 8/211 (4%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  297
            E+ GFKLVGF  FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLS
Sbjct  21   ESPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLS  80

Query  298  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-----RSFNATHGL  462
            TGN  HASYLL  + G+L+FLFTA Y+ S++        + S  +      RSF ++HGL
Sbjct  81   TGNMVHASYLL--TSGDLRFLFTAAYSPSLAAGEIRPTATASIPSFDHISWRSFFSSHGL  138

Query  463  GVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPS  642
            GVRAVA+ VED ++AFS SV+ GA P S P+ L+  V +AEV LYGDVVLR++S+    +
Sbjct  139  GVRAVAIEVEDAESAFSISVANGAIPSSPPIVLDEAVTIAEVKLYGDVVLRYVSHNGVNT  198

Query  643  AVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
              + FLPGFE ++ T+S+  LDYGIRRLDHA
Sbjct  199  DKSDFLPGFELVEDTSSFP-LDYGIRRLDHA  228



>sp|Q9ARF9.1|HPPD_PLESU RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Solenostemon scutellarioides]
 emb|CAC37394.1| 4-hydroxyphenylpyruvate dioxygenase [Solenostemon scutellarioides]
Length=436

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 162/203 (80%), Gaps = 5/203 (2%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVG K+FVR NP SDHF V RFHHVEFWCGDATNT+RRFSW LGMP+ AKSDLSTGNS
Sbjct  16   FKLVGHKNFVRSNPMSDHFPVHRFHHVEFWCGDATNTSRRFSWGLGMPLVAKSDLSTGNS  75

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
            AHASYLLR+  GEL F+FTAPY+ S++ P+SA+IP+FS S HR+F ++HGL VRAVA+ V
Sbjct  76   AHASYLLRS--GELSFVFTAPYSPSLAEPSSASIPTFSFSDHRAFTSSHGLAVRAVAIQV  133

Query  490  EDTQAAFSASVSRGAKPVSEPVTL-NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPG  666
            +   +A+SA+VSRGAKPVS PV L + +  +AEVHLYGD VLRF+S  S   A   FLPG
Sbjct  134  DSASSAYSAAVSRGAKPVSPPVVLADCETAIAEVHLYGDTVLRFVSCGS--GADGWFLPG  191

Query  667  FEPMDGTASYQDLDYGIRRLDHA  735
            FE +    S Q+LDYGIRRLDHA
Sbjct  192  FEVVGDGVSCQELDYGIRRLDHA  214



>gb|ADO62712.1| p-hydroxyphenylpyruvate dioxygenase [Mangifera indica]
Length=432

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 152/210 (72%), Gaps = 7/210 (3%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  297
            ++G F+LVGF +FVR NPKSD F VK+FHH+EFWC DATN ARRFSW LGMPI AKSDLS
Sbjct  4    QDGSFELVGFSNFVRHNPKSDRFKVKKFHHIEFWCTDATNVARRFSWGLGMPIIAKSDLS  63

Query  298  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---RSFNATHGLGV  468
            TGN  HASYLLR+  GEL F+FTAPY+ SIS        S    ++   R+F  +HGL V
Sbjct  64   TGNMVHASYLLRS--GELNFVFTAPYSPSISGDDYKNTASIPTFSYDSCRAFAVSHGLAV  121

Query  469  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAV  648
            R+V + VED + AF+ S + GAKPVS P  L+N+ V++EVHLYGDVVLR++SY S  +  
Sbjct  122  RSVGVDVEDAEIAFTTSAAHGAKPVSSPRILDNRAVISEVHLYGDVVLRYVSYKSGNNFD  181

Query  649  TT-FLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +  FLPGFE  D   S+  LDYGIRRLDHA
Sbjct  182  SCLFLPGFERTDEITSFP-LDYGIRRLDHA  210



>ref|NP_001235148.1| 4-hydroxyphenylpyruvate dioxygenase [Glycine max]
 gb|ABQ96868.1| 4-hydroxyphenylpyruvate dioxygenase [Glycine max]
Length=443

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 157/215 (73%), Gaps = 16/215 (7%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGFK+FVR NPKSD F V RFHH+EFWC DATN +RRFSW LGMPI AKSDLSTGN
Sbjct  16   GFKLVGFKNFVRTNPKSDRFQVNRFHHIEFWCTDATNASRRFSWGLGMPIVAKSDLSTGN  75

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfs----asaHRSFNATHGLGVRA  474
              HASYLLR+  G+L FLF+APY+ S+S  +SAA  +      A+   +F A HG GVRA
Sbjct  76   QIHASYLLRS--GDLSFLFSAPYSPSLSAGSSAASSASIPSFDAATCLAFAAKHGFGVRA  133

Query  475  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL--------  630
            +AL V D +AAFSASV++GA+P S PV ++++   AEV LYGDVVLR++SY         
Sbjct  134  IALEVADAEAAFSASVAKGAEPASPPVLVDDRTGFAEVRLYGDVVLRYVSYKDAAPQAPH  193

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +DPS    FLPGFE    ++S+ +LDYGIRRLDHA
Sbjct  194  ADPS--RWFLPGFEAAASSSSFPELDYGIRRLDHA  226



>gb|AIN39549.1| 4-hydroxyphenylpyruvate dioxygenase short isoform [Glycine max]
Length=447

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 157/215 (73%), Gaps = 16/215 (7%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGFK+FVR NPKSD F V RFHH+EFWC DATN +RRFSW LGMPI AKSDLSTGN
Sbjct  20   GFKLVGFKNFVRTNPKSDRFQVNRFHHIEFWCTDATNASRRFSWGLGMPIVAKSDLSTGN  79

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfs----asaHRSFNATHGLGVRA  474
              HASYLLR+  G+L FLF+APY+ S+S  +SAA  +      A+   +F A HG GVRA
Sbjct  80   QIHASYLLRS--GDLSFLFSAPYSPSLSAGSSAASSASIPSFDAATCLAFAAKHGFGVRA  137

Query  475  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL--------  630
            +AL V D +AAFSASV++GA+P S PV ++++   AEV LYGDVVLR++SY         
Sbjct  138  IALEVADAEAAFSASVAKGAEPASPPVLVDDRTGFAEVRLYGDVVLRYVSYKDAAPQAPH  197

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +DPS    FLPGFE    ++S+ +LDYGIRRLDHA
Sbjct  198  ADPS--RWFLPGFEAAASSSSFPELDYGIRRLDHA  230



>ref|XP_009351285.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Pyrus x 
bretschneideri]
Length=440

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 156/215 (73%), Gaps = 18/215 (8%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F LVGF +FVR NP+SD F V RFHHVEFWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  9    FNLVGFSNFVRTNPRSDRFKVHRFHHVEFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  68

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--------saHRSFNATHGLG  465
             HASYLLR+  G+L FLFTAPY+ +++  A  A PS S+        +A R+F+ATHGLG
Sbjct  69   THASYLLRS--GDLNFLFTAPYSPTLTRTADPARPSNSSASIPTFDHTASRAFSATHGLG  126

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----L  630
            VRAVA+ VED  +AF+ SV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L
Sbjct  127  VRAVAIQVEDAVSAFTTSVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYSDHNHL  186

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +DP     FLPGFEP+    S   +D+GIRRLDHA
Sbjct  187  TDPDPNLWFLPGFEPL---PSSFPIDFGIRRLDHA  218



>ref|XP_009377128.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Pyrus x 
bretschneideri]
Length=440

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 156/215 (73%), Gaps = 18/215 (8%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F LVGF +FVR NP+SD F V RFHHVEFWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  9    FNLVGFSNFVRTNPRSDRFKVHRFHHVEFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  68

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--------saHRSFNATHGLG  465
             HASYLLR+  G+L FLFTAPY+ +++  A  A PS S+        +A R+F+ATHGLG
Sbjct  69   THASYLLRS--GDLNFLFTAPYSPTLTRTADPARPSNSSASIPTFDHTASRAFSATHGLG  126

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----L  630
            VRAVA+ VED  +AF+ SV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L
Sbjct  127  VRAVAIQVEDAVSAFTTSVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYSDHNHL  186

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +DP     FLPGFEP+    S   +D+GIRRLDHA
Sbjct  187  TDPDPNLWFLPGFEPL---PSSFPIDFGIRRLDHA  218



>ref|XP_010457787.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=450

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 154/209 (74%), Gaps = 9/209 (4%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF +FVR NPKSD F VKRFHH+EFWCGDATN ARRFSW LGM  +AKSDLSTGN
Sbjct  27   GFKLVGFSNFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGN  86

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----saHRSFNATHGLGVR  471
              HASYLL  + G+L+FLFTAPY+ S++   +    + S       + RSF ++HGLGVR
Sbjct  87   MVHASYLL--TSGDLRFLFTAPYSPSLTAGETKPTATASIPSFDHVSCRSFFSSHGLGVR  144

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAV  648
            AVA+ VED ++AFS S+S GA P S P+ L+   V +AEV LYGDVVLR++SY    +  
Sbjct  145  AVAIEVEDAESAFSISLSNGANPSSPPMVLDGGAVTIAEVKLYGDVVLRYVSYKEGDTDK  204

Query  649  TTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            + FLPGFE ++ T+S+  LDYGIRRLDHA
Sbjct  205  SEFLPGFEHVEDTSSFP-LDYGIRRLDHA  232



>gb|AIN39550.1| chloroplast 4-hydroxyphenylpyruvate dioxygenase long isoform 
[Glycine max]
Length=488

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 157/215 (73%), Gaps = 16/215 (7%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGFK+FVR NPKSD F V RFHH+EFWC DATN +RRFSW LGMPI AKSDLSTGN
Sbjct  61   GFKLVGFKNFVRTNPKSDRFQVNRFHHIEFWCTDATNASRRFSWGLGMPIVAKSDLSTGN  120

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfs----asaHRSFNATHGLGVRA  474
              HASYLLR+  G+L FLF+APY+ S+S  +SAA  +      A+   +F A HG GVRA
Sbjct  121  QIHASYLLRS--GDLSFLFSAPYSPSLSAGSSAASSASIPSFDAATCLAFAAKHGFGVRA  178

Query  475  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYL--------  630
            +AL V D +AAFSASV++GA+P S PV ++++   AEV LYGDVVLR++SY         
Sbjct  179  IALEVADAEAAFSASVAKGAEPASPPVLVDDRTGFAEVRLYGDVVLRYVSYKDAAPQAPH  238

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +DPS    FLPGFE    ++S+ +LDYGIRRLDHA
Sbjct  239  ADPS--RWFLPGFEAAASSSSFPELDYGIRRLDHA  271



>ref|XP_008353631.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Malus domestica]
Length=457

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 156/215 (73%), Gaps = 18/215 (8%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F LVGF +FVR NP+SD F V RFHHVEFWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  26   FNLVGFSNFVRTNPRSDRFRVHRFHHVEFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  85

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--------saHRSFNATHGLG  465
             HASYLLR+  G+L FLFTAPY+ +++  A  A PS S+        +A R+F+ATHGLG
Sbjct  86   THASYLLRS--GDLNFLFTAPYSPTLTRTADPARPSNSSASIPTFDHTASRAFSATHGLG  143

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----L  630
            VRAVA+ VED  +AF+ SV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L
Sbjct  144  VRAVAIQVEDAVSAFTTSVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYSDHNHL  203

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +DP     FLPGFEP+    S   +D+GIRRLDHA
Sbjct  204  TDPDPNLWFLPGFEPL---PSSFPIDFGIRRLDHA  235



>ref|XP_004144629.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Cucumis sativus]
 gb|KGN54940.1| 4-hydroxyphenylpyruvate dioxygenase [Cucumis sativus]
Length=455

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 157/240 (65%), Gaps = 22/240 (9%)
 Frame = +1

Query  73   MGKET------SSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDAT  234
            MGKE       S + +  +T     F+L GF +F+R NPKSD F VKRFHH+EFWC DAT
Sbjct  1    MGKEADFPRAPSEATDGGATASQSEFELQGFDNFIRTNPKSDRFKVKRFHHIEFWCTDAT  60

Query  235  NTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaip  414
            N ARRFSW LGM I AKSDLSTGN  HASYLLR+  G L FLFTAPY+ SI+   +    
Sbjct  61   NVARRFSWGLGMQIVAKSDLSTGNMTHASYLLRS--GHLCFLFTAPYSPSIAAAQNLTPA  118

Query  415  sfsa------saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV  576
            S ++      S  RSF+ THG G RA+AL VED + AF  SV+ GAKP   P+ L N+ V
Sbjct  119  STASIPSFDHSVCRSFSGTHGFGARAIALEVEDAEIAFRTSVAHGAKPSCPPIVLENRAV  178

Query  577  LAEVHLYGDVVLRFISYLSDPSAVTT-------FLPGFEPMDGTASYQDLDYGIRRLDHA  735
            L+EVHLYGDVVLR+ISY +  S           FLP FE M+ TAS+  LD+GIRRLDHA
Sbjct  179  LSEVHLYGDVVLRYISYKNPVSGDNGENKPDEWFLPKFEAMEETASFP-LDFGIRRLDHA  237



>ref|XP_010542713.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Tarenaya hassleriana]
Length=454

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 150/212 (71%), Gaps = 12/212 (6%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            GFKLVGF  FVR NPKSD F VK FHHVEFWCGDATN ARRFSW LGM IA KSDLSTGN
Sbjct  22   GFKLVGFSKFVRTNPKSDKFKVKSFHHVEFWCGDATNVARRFSWGLGMRIAGKSDLSTGN  81

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---------RSFNATHG  459
              HASYLL  + G+L+FLFTAPY+ S++  A+AA      +A           SF A+HG
Sbjct  82   MVHASYLL--TSGDLRFLFTAPYSPSLAAAAAAAEIRPMTTASIPTFNPAVCCSFFASHG  139

Query  460  LGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDP  639
            L VRAV + VED ++AFS SV+ GA P S PV L   V +AEV LYGDVVLR++SY++  
Sbjct  140  LSVRAVGIEVEDAESAFSISVANGAVPSSPPVVLAGAVTIAEVKLYGDVVLRYVSYVNKA  199

Query  640  SAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                 FLPGFEP++ T S+  LDYGIRRLDHA
Sbjct  200  DFDFDFLPGFEPVEDTTSFP-LDYGIRRLDHA  230



>ref|XP_004303888.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 155/212 (73%), Gaps = 11/212 (5%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  297
            E   F LVGF +FVR NP+SD F+V RFHH+EFWC DATNTA RFSW LGMP+ AKSDLS
Sbjct  6    ETTQFNLVGFSNFVRSNPRSDRFAVTRFHHIEFWCTDATNTALRFSWGLGMPLVAKSDLS  65

Query  298  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsf-sasaHRSFNATHGLGVRA  474
            TGN +HASYLLR++  +L FLF+APY+ S+S P S+A       SA R+F+A HGL VRA
Sbjct  66   TGNHSHASYLLRSA--DLSFLFSAPYSPSLSGPTSSASIPSFDHSASRAFSAKHGLAVRA  123

Query  475  VALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----LSDP  639
            VA+ V D   AF ASVS GAKP S P+ L+N+V +AEVHLYGDVVLR++SY      SDP
Sbjct  124  VAIQVADADLAFHASVSHGAKPASPPILLDNRVTIAEVHLYGDVVLRYVSYKDPAQRSDP  183

Query  640  SAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +    FLPGFEP+    S   LD+G+RRLDHA
Sbjct  184  NPDLWFLPGFEPV---PSSFPLDFGLRRLDHA  212



>ref|XP_010053920.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89764.1| hypothetical protein EUGRSUZ_A02024 [Eucalyptus grandis]
Length=447

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 159/233 (68%), Gaps = 20/233 (9%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGK+     N   TP +  FKLVGF +FVR NP+SD F V+RFHHVEFWC DATN +RRF
Sbjct  1    MGKQ-----NDGITPVSDEFKLVGFSNFVRSNPRSDRFPVRRFHHVEFWCTDATNASRRF  55

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            SW LGMPI AKSDLSTGN+ HASYL R+  G+L FLFTAPY+ SI+        S ++  
Sbjct  56   SWGLGMPIVAKSDLSTGNATHASYLCRS--GDLCFLFTAPYSPSIAASEGLNPSSTASLP  113

Query  433  HRSFNAT------HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
              S++A       HGL VRA+A+ VED  AAF  SV++GA+PVS PV L+    +AEVHL
Sbjct  114  SFSYSACVAFAVKHGLAVRAIAIEVEDADAAFHISVAQGARPVSSPVVLDGTATIAEVHL  173

Query  595  YGDVVLRFISYLS------DPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR++SY +      + S  + FLP F+P D  +S+  LD+GIRRLDHA
Sbjct  174  YGDVVLRYVSYKTPTSDHDNSSPDSWFLPRFKPTDEVSSFP-LDFGIRRLDHA  225



>ref|XP_010274102.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Nelumbo nucifera]
Length=507

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 155/213 (73%), Gaps = 6/213 (3%)
 Frame = +1

Query  103  HHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAA  282
             H T    GFKLVG+ +FVR N KSD F VKRFHH+EFWC DATN+ARRFSW LGMPI A
Sbjct  76   EHVTNGAPGFKLVGYANFVRHNLKSDRFHVKRFHHIEFWCTDATNSARRFSWGLGMPIVA  135

Query  283  KSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfs--asaHRSFNATH  456
            KSDLSTGN  HASYLLR+  G+L FLFTAPY+ SI+   +      +   SA RSF+A+H
Sbjct  136  KSDLSTGNLVHASYLLRS--GDLDFLFTAPYSPSITGNLTNTASIPTFNHSAARSFSASH  193

Query  457  GLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSD  636
            GL VRA+++ VED  +AF+ SV+ GAKP S PV + + VVL+E+HLYGD +LR+IS   +
Sbjct  194  GLAVRAISIEVEDATSAFNISVAHGAKPSSPPVEIGDGVVLSEIHLYGDAILRYISR-KN  252

Query  637  PSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            P+    FLPGFE  +  +SY  LD+GIRRLDHA
Sbjct  253  PNLNLIFLPGFEKYEEGSSYP-LDFGIRRLDHA  284



>ref|XP_010053900.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89762.1| hypothetical protein EUGRSUZ_A02022 [Eucalyptus grandis]
Length=448

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 157/233 (67%), Gaps = 19/233 (8%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGK+    V   S      FKLVGF +FVR NP+SD F V+RFHHVEFWC DATN +RRF
Sbjct  1    MGKQNDGGVATGSDE----FKLVGFSNFVRSNPRSDRFPVRRFHHVEFWCTDATNVSRRF  56

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            +W LGMP+ AKSDLSTGN+ HASYL R+  G+L FLFTAPY+ SI+        + ++  
Sbjct  57   AWGLGMPVVAKSDLSTGNATHASYLCRS--GDLCFLFTAPYSPSIAASEGLDPSATASLP  114

Query  433  HRS------FNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
              S      F A HGLGVRAVA+ VED  AAF  SV+ GA+PVS PV L+ +  +AEVHL
Sbjct  115  SFSYSDCVAFAAKHGLGVRAVAVEVEDADAAFRTSVAHGARPVSPPVVLDGRAAVAEVHL  174

Query  595  YGDVVLRFISYLS------DPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR++SY +      D S  + FLP FEP D  +S+  L++GIRRLDHA
Sbjct  175  YGDVVLRYVSYKTPASDRGDSSPDSWFLPRFEPTDEISSFP-LEFGIRRLDHA  226



>gb|KJB08583.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=396

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 149/208 (72%), Gaps = 9/208 (4%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGF +FVR NPKSD F+VKRFHH+EFWC DATN ARRFSW LGM   AKSDLSTGN 
Sbjct  13   FKLVGFSNFVRSNPKSDRFTVKRFHHIEFWCTDATNVARRFSWGLGMQFVAKSDLSTGNL  72

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH------RSFNATHGLGVR  471
             H+SYLLR+  G+L FLFTAPY+ SI+   + +  S ++         RSF ATHGLGVR
Sbjct  73   THSSYLLRS--GDLNFLFTAPYSPSIAVAQNLSPQSTASIPSFDHSLCRSFAATHGLGVR  130

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            A+A+ V+D + AF+ SV+ GA P S P  L +   +AEV LYGDVVLR++SY +  ++  
Sbjct  131  AIAIEVDDAETAFTTSVTHGALPFSPPTPLGDVATIAEVKLYGDVVLRYVSYTTTINSDH  190

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFE ++   SY  LDYG+RRLDHA
Sbjct  191  DFLPGFEKIEDALSYP-LDYGLRRLDHA  217



>gb|KJB08582.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=413

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 149/208 (72%), Gaps = 9/208 (4%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGF +FVR NPKSD F+VKRFHH+EFWC DATN ARRFSW LGM   AKSDLSTGN 
Sbjct  13   FKLVGFSNFVRSNPKSDRFTVKRFHHIEFWCTDATNVARRFSWGLGMQFVAKSDLSTGNL  72

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH------RSFNATHGLGVR  471
             H+SYLLR+  G+L FLFTAPY+ SI+   + +  S ++         RSF ATHGLGVR
Sbjct  73   THSSYLLRS--GDLNFLFTAPYSPSIAVAQNLSPQSTASIPSFDHSLCRSFAATHGLGVR  130

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            A+A+ V+D + AF+ SV+ GA P S P  L +   +AEV LYGDVVLR++SY +  ++  
Sbjct  131  AIAIEVDDAETAFTTSVTHGALPFSPPTPLGDVATIAEVKLYGDVVLRYVSYTTTINSDH  190

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFE ++   SY  LDYG+RRLDHA
Sbjct  191  DFLPGFEKIEDALSYP-LDYGLRRLDHA  217



>ref|XP_008380188.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Malus domestica]
Length=457

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 157/214 (73%), Gaps = 17/214 (8%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F LVGF +FVR NP+SD F V RFHHV+FWC DATN A RFSW LGMP+ AKSDLSTGN 
Sbjct  18   FNLVGFSNFVRTNPRSDRFKVHRFHHVZFWCTDATNAALRFSWGLGMPMVAKSDLSTGNQ  77

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-------saHRSFNATHGLGV  468
             HASYLLR+   +L FLFTAPY+ +++  A  A P  +A       SA R+F+ATHGLGV
Sbjct  78   XHASYLLRSX--DLVFLFTAPYSPTLTRXADPARPRTTASIPTFDHSASRAFSATHGLGV  135

Query  469  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-----LS  633
            RAVA+ VED  +AF+ASV+ GAKP + P+ L+N+V +AEV LYGDVVLR++SY     L+
Sbjct  136  RAVAIQVEDAVSAFTASVAHGAKPSAAPILLDNRVTIAEVQLYGDVVLRYVSYTDHNHLT  195

Query  634  DPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            DP     FLPGFE +  T+S+  +D+GIRRLDHA
Sbjct  196  DPDPHLWFLPGFESL--TSSFP-IDFGIRRLDHA  226



>gb|KJB08581.1| hypothetical protein B456_001G092000 [Gossypium raimondii]
Length=463

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 149/208 (72%), Gaps = 9/208 (4%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGF +FVR NPKSD F+VKRFHH+EFWC DATN ARRFSW LGM   AKSDLSTGN 
Sbjct  40   FKLVGFSNFVRSNPKSDRFTVKRFHHIEFWCTDATNVARRFSWGLGMQFVAKSDLSTGNL  99

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH------RSFNATHGLGVR  471
             H+SYLLR+  G+L FLFTAPY+ SI+   + +  S ++         RSF ATHGLGVR
Sbjct  100  THSSYLLRS--GDLNFLFTAPYSPSIAVAQNLSPQSTASIPSFDHSLCRSFAATHGLGVR  157

Query  472  AVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            A+A+ V+D + AF+ SV+ GA P S P  L +   +AEV LYGDVVLR++SY +  ++  
Sbjct  158  AIAIEVDDAETAFTTSVTHGALPFSPPTPLGDVATIAEVKLYGDVVLRYVSYTTTINSDH  217

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPGFE ++   SY  LDYG+RRLDHA
Sbjct  218  DFLPGFEKIEDALSYP-LDYGLRRLDHA  244



>emb|CAN71143.1| hypothetical protein VITISV_033518 [Vitis vinifera]
Length=445

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 161/232 (69%), Gaps = 22/232 (9%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGK+ +++ N        GFKLVGF +F+R NP SD F VKRFHH+EFW  DATN ARRF
Sbjct  1    MGKQNTTTNNPAP-----GFKLVGFSNFLRTNPMSDRFGVKRFHHIEFWSTDATNLARRF  55

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMPI AKSDLSTGN  HASYL R+  G+L FLFTAPY+ SI+     A  + S   
Sbjct  56   SWGLGMPIVAKSDLSTGNVIHASYLTRS--GDLNFLFTAPYSPSIAGDLENAAATASIPS  113

Query  427  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  597
               SA  +F A+HGLGVRA+A+ V+D + AF  SV+ GA+P+S PVT+   VV++EVHLY
Sbjct  114  FDHSACHAFAASHGLGVRAIAIEVDDAEGAFHTSVAHGARPMSPPVTMGGSVVISEVHLY  173

Query  598  GDVVLRFISY-------LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            GD VLR++SY        SDPS  + FLPGFE +D  +S+  +D+G+RR+DH
Sbjct  174  GDAVLRYVSYKNPNPNATSDPS--SWFLPGFEAVDEGSSFP-VDFGLRRVDH  222



>dbj|BAF74636.1| hydroxyphenylpyruvate dioxygenase [Coptis japonica var. dissecta]
Length=430

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 146/205 (71%), Gaps = 6/205 (3%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG  +FV  NPKSD F VK+FHH+EFW  DATNTARRFSW LGMP+ AKSDLSTGN 
Sbjct  9    LKLVGHTNFVHNNPKSDKFHVKKFHHIEFWSTDATNTARRFSWGLGMPMVAKSDLSTGNM  68

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH---RSFNATHGLGVRAVA  480
             HASYLLR+  GEL FLFTAPY+ SI+        S    +H   R F +THGL VRA+A
Sbjct  69   VHASYLLRS--GELNFLFTAPYSPSIAGNTLTHTASIPTYSHNLARLFASTHGLAVRAIA  126

Query  481  LVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  660
            + V+D + A++ SV+ GAKP S P+ L+  VVL+E+ LYGDVVLR++S+  + +    FL
Sbjct  127  IEVQDAELAYNISVANGAKPSSSPIKLDEGVVLSEIQLYGDVVLRYLSF-KNTNQSCPFL  185

Query  661  PGFEPMDGTASYQDLDYGIRRLDHA  735
            PGFE +   +S + LD+GIRRLDHA
Sbjct  186  PGFEEVGEVSSSRGLDFGIRRLDHA  210



>ref|XP_007141424.1| hypothetical protein PHAVU_008G194300g [Phaseolus vulgaris]
 gb|ESW13418.1| hypothetical protein PHAVU_008G194300g [Phaseolus vulgaris]
Length=492

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 159/236 (67%), Gaps = 11/236 (5%)
 Frame = +1

Query  49   SSEKLTEVMGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGD  228
            +S   T  + +E  S+   + T     FKLVGFK+FVR N +SD F V RFHH+EFWC D
Sbjct  42   TSSPTTTAITQEPISNTMGNQTELQSPFKLVGFKNFVRTNSESDRFQVNRFHHIEFWCTD  101

Query  229  ATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaa  408
            ATN A RFSW LGMPI AKSDLSTGN  HASYLLR+  G+L FLF+APYA SIS  A++ 
Sbjct  102  ATNAASRFSWGLGMPIVAKSDLSTGNLIHASYLLRS--GDLSFLFSAPYAPSISAGAAST  159

Query  409  ipsfs--asaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLA  582
                S  A+A  SF A HG GVRA+AL V D +AAF ASV+ GA+PVS P  L+ +   A
Sbjct  160  AAIPSFDAAACLSFAAKHGFGVRAIALEVADAEAAFRASVAHGAEPVSPPALLDGRTGFA  219

Query  583  EVHLYGDVVLRFISY-----LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            EV LYGDVVLR++SY      S+ +    FLPGFE      ++++LDYGIRRLDHA
Sbjct  220  EVRLYGDVVLRYVSYKDASHASEANPSRWFLPGFEA--SAEAFRELDYGIRRLDHA  273



>gb|EPS60251.1| hydroxyphenylpyruvate dioxygenase, partial [Genlisea aurea]
Length=402

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 155/194 (80%), Gaps = 6/194 (3%)
 Frame = +1

Query  157  VRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  336
            VR NP++D FSV RFHHVEFWCGDATN A RFSW LGMP+AAKSDLSTGNSAHASYLLR+
Sbjct  1    VRNNPRTDRFSVVRFHHVEFWCGDATNAASRFSWGLGMPLAAKSDLSTGNSAHASYLLRS  60

Query  337  SGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSA  516
              G+L F+FTAPY+ S+S+P+SAAIP+FS SAHRSF ++HG GVRAVA++V    +AF+ 
Sbjct  61   --GQLDFIFTAPYSPSLSDPSSAAIPTFSVSAHRSFTSSHGFGVRAVAILVNSADSAFAE  118

Query  517  SVSRGAKPVSEPVTLNN-QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTAS  693
            SVSRGA+PV+ P  L++ +  +AEVHLYGD VLRF+S+          LPGFEP++  A 
Sbjct  119  SVSRGARPVAAPSVLSDGKTAVAEVHLYGDTVLRFVSH-DGADHKGLLLPGFEPVENEA-  176

Query  694  YQDLDYGIRRLDHA  735
            YQ LDYGIRRLDHA
Sbjct  177  YQ-LDYGIRRLDHA  189



>gb|ABO69440.1| hydroxyphenylpyruvate dioxygenase [Salvia miltiorrhiza]
Length=481

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 172/231 (74%), Gaps = 9/231 (4%)
 Frame = +1

Query  49   SSEKLTEVMGKETSSSVNHHSTPENGGFKLVGFKDFV-RVNPKSDHFSVKRFHHVEFWCG  225
            +S   T+ MG+E++++        + GFK    K+ V R NPKSDHF V RFHHVEFWCG
Sbjct  36   ASSSSTQTMGQESAATTAVEPAVVHRGFKPAARKNLVVRTNPKSDHFPVHRFHHVEFWCG  95

Query  226  DATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasa  405
            DATN ARRFSW LGMP+AAKSDLSTGNSAHASYLLR+  GEL FLFTAPY+ SI++P+SA
Sbjct  96   DATNAARRFSWGLGMPLAAKSDLSTGNSAHASYLLRS--GELSFLFTAPYSPSIADPSSA  153

Query  406  aipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-QVVLA  582
            +IP+FS SAH +F ++HGL VRAVA+ V+   +A++ASV+RGA PVS P  L++ +  +A
Sbjct  154  SIPTFSPSAHLAFTSSHGLAVRAVAIQVDSASSAYAASVARGAIPVSPPALLSDGKTAIA  213

Query  583  EVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            EVHLYGD VLR+IS      A    LPGFEP+    + Q+LDYGIRRLDHA
Sbjct  214  EVHLYGDSVLRYISTAG--GANEWLLPGFEPV---LNDQELDYGIRRLDHA  259



>ref|XP_002283275.2| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Vitis vinifera]
Length=491

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 160/232 (69%), Gaps = 19/232 (8%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGK + S     S P  G FKLVGF +F+R NP SD F VKRFHH+EFW  DATN ARRF
Sbjct  44   MGKASDSGA-QVSNPAPG-FKLVGFSNFLRTNPMSDRFGVKRFHHIEFWSTDATNLARRF  101

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMPI AKSDLSTGN  HASYL R+  G+L FLFTAPY+ SI+     A  + S   
Sbjct  102  SWGLGMPIVAKSDLSTGNVIHASYLTRS--GDLNFLFTAPYSPSIAGDLENAAATASIPS  159

Query  427  ---saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLY  597
               SA  +F A+HGLGVRA+A+ V+D + AF  SV+ GA+P+S PVT+   VV++EVHLY
Sbjct  160  FDHSACHAFAASHGLGVRAIAIEVDDAEGAFHTSVAHGARPMSPPVTMGGSVVISEVHLY  219

Query  598  GDVVLRFISY-------LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            GD VLR++SY        SDPS  + FLPGFE +D  +S+  +D+G+RR+DH
Sbjct  220  GDAVLRYVSYKNPNPNATSDPS--SWFLPGFEAVDEGSSFP-VDFGLRRVDH  268



>ref|XP_003617384.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
 gb|AET00343.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=428

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 149/214 (70%), Gaps = 6/214 (3%)
 Frame = +1

Query  106  HSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAK  285
            + T    GFKLVG K+F+R NPK+D F VK FHHVEFWC DATNTA RFS  LGMPI AK
Sbjct  3    NETHNQTGFKLVGCKNFIRTNPKTDRFKVKHFHHVEFWCTDATNTAHRFSHGLGMPIVAK  62

Query  286  SDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR---SFNATH  456
            SDLSTGN  HASYLLR+  G+L FLFTA Y+ SIS  + ++  S    +     SF+ +H
Sbjct  63   SDLSTGNLTHASYLLRS--GDLNFLFTAAYSPSISLSSPSSTASIPTFSPSTCFSFSNSH  120

Query  457  GLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISY-LS  633
            GL VRA+A+ VED + A++ SVS GA P S PV L N V LAEV L+GDVVLR++SY   
Sbjct  121  GLNVRALAVEVEDAELAYTVSVSYGALPSSPPVVLENGVKLAEVRLFGDVVLRYVSYNNP  180

Query  634  DPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            + +    FLPGFE + G +S   LD+GIR+LDHA
Sbjct  181  NQNQNLLFLPGFETLSGESSNSSLDFGIRQLDHA  214



>gb|KEH40154.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=428

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 157/225 (70%), Gaps = 18/225 (8%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MG ET +           GFKLVGFK F+R NPK+D F VKRFHHVEFWC DATNTA RF
Sbjct  1    MGNETQTKT---------GFKLVGFKKFIRTNPKTDRFKVKRFHHVEFWCTDATNTALRF  51

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            S  LGMPI AKSDLSTGN  HASYLLR+  G+L FLF+APY+ SIS  + ++  S    +
Sbjct  52   SQGLGMPIVAKSDLSTGNLIHASYLLRS--GDLNFLFSAPYSPSISLSSPSSTASIPTFS  109

Query  433  HR---SFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYG-  600
                 SF A+HGL VRA+A+ V+D + AF+ SV+ GA P S P+ L N V LAEVHL+G 
Sbjct  110  ASTCFSFCASHGLAVRAIAIEVDDAELAFTVSVNHGALPSSPPIVLENGVKLAEVHLFGV  169

Query  601  DVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            DVVLR++SY ++P+ +  FLPGFE +   +S   LD+GIRRLDHA
Sbjct  170  DVVLRYVSY-NNPNLL--FLPGFESLLNESSNSSLDFGIRRLDHA  211



>ref|XP_010688906.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +1

Query  178  DHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQF  357
            DHF VKRFHHVEFWCGDATN +RRFSW LG+PI AKSDLSTGNS HASYLLR+    L F
Sbjct  2    DHFPVKRFHHVEFWCGDATNVSRRFSWGLGIPIVAKSDLSTGNSVHASYLLRSYN--LCF  59

Query  358  LFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAK  537
            LFT+PY+ SIS+P+S+ IP+F+ S   SF  +HGLGVRA+A+ VED +AA++ S++ GA 
Sbjct  60   LFTSPYSPSISSPSSSTIPTFNTSHFTSFFTSHGLGVRAIAIEVEDAEAAYNISIAHGAI  119

Query  538  PVSEPVTLNNQVVLAEVHLYGDVVLRFISY-LSDPSAVTTFLPGFEPMDGTASYQDLDYG  714
            P S P    N  +LAEVHLYGDVVLR+IS+   +  A   FLPGFE M G +S+Q LD+G
Sbjct  120  PSSAPSRFRNGTILAEVHLYGDVVLRYISFTYKNKPASEWFLPGFEEMPGESSFQGLDFG  179

Query  715  IRRLDHA  735
            +R+LDHA
Sbjct  180  LRKLDHA  186



>ref|XP_010053910.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW89763.1| hypothetical protein EUGRSUZ_A02023 [Eucalyptus grandis]
Length=447

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 153/232 (66%), Gaps = 20/232 (9%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGK+     N      +  FKLVGF +FV  NP+SD F  + FHHVEFWC DAT+ +RRF
Sbjct  1    MGKQNDGVTNG-----SDDFKLVGFSNFVGSNPRSDRFPARHFHHVEFWCTDATSASRRF  55

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            SWALGMP+ AKSDLSTGN+ HASYL R+  G+L  LFTAPY+ SI+        S ++  
Sbjct  56   SWALGMPVVAKSDLSTGNATHASYLCRS--GDLCLLFTAPYSPSIATSDGLEPSSMASLP  113

Query  433  HRSFNAT------HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
              S++A       HGLGVRA+A+ VED   AF  S++ GA+PVS PV L+    +AEVHL
Sbjct  114  SFSYSACVAFATKHGLGVRAIAVEVEDAAGAFHISITHGARPVSPPVVLDGAATIAEVHL  173

Query  595  YGDVVLRFISYLS------DPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            YGDVVLR++SY +      + S  + FLP F+P+D  +S+  LD+GIRRLDH
Sbjct  174  YGDVVLRYVSYKTPASNRNNSSPDSWFLPRFKPLDEVSSFP-LDFGIRRLDH  224



>ref|XP_008229571.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Prunus mume]
Length=506

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 156/232 (67%), Gaps = 26/232 (11%)
 Frame = +1

Query  70   VMGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR  249
            +MGKE  S +N           LVGF +FVR NP+SD F V RFHHVEFWC DATN+A R
Sbjct  69   IMGKENDSQLN-----------LVGFSNFVRSNPRSDRFKVHRFHHVEFWCTDATNSALR  117

Query  250  FSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-  426
            FSW LGMP+ AKSDLSTGN +HASYLLR+  G+L FLFTAP A    +P     P  S  
Sbjct  118  FSWGLGMPMVAKSDLSTGNQSHASYLLRS--GDLNFLFTAPSAPXTDDPTRPNTPPASIP  175

Query  427  ----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHL  594
                SA R F++ HGLGVRAV + V++  +AF+ SV+ GAKP + P+ L+N+V +AEV L
Sbjct  176  TFDHSASRDFSSRHGLGVRAVGIQVDNAVSAFTTSVAHGAKPSAPPILLDNRVTIAEVQL  235

Query  595  YGDVVLRFISYLSDPSAVTT-----FLPGFEPMDGTASYQDLDYGIRRLDHA  735
            YGDVVLR++SY +      +     FLPGFE M  T+S+  LD+G+RRLDHA
Sbjct  236  YGDVVLRYVSYSNSSDVSDSNPDLWFLPGFEAM--TSSFP-LDFGLRRLDHA  284



>ref|XP_007215393.1| hypothetical protein PRUPE_ppa005851mg [Prunus persica]
 gb|EMJ16592.1| hypothetical protein PRUPE_ppa005851mg [Prunus persica]
Length=440

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 157/234 (67%), Gaps = 29/234 (12%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MG+E  S +N           LVGF +FVR NP+SD F V RFHHVEFWC DATN+A RF
Sbjct  1    MGQENDSQLN-----------LVGFSNFVRSNPRSDRFKVHRFHHVEFWCTDATNSALRF  49

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa--  426
            SW LGMP+ AKSDLSTGN  HASYLLR+  G+L FLFTAPY+ +++       P+ S   
Sbjct  50   SWGLGMPMVAKSDLSTGNQTHASYLLRS--GDLNFLFTAPYSPTLTRTDDPTRPNNSTAS  107

Query  427  ------saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEV  588
                  SA R F++ HGLGVRAVA+ V+D  +AF+ SV+ GAKP + P+ L N+V +AEV
Sbjct  108  IPTFDHSASRDFSSRHGLGVRAVAIQVDDAVSAFTTSVAHGAKPSAPPILLGNRVTVAEV  167

Query  589  HLYGDVVLRFISYLSDPSAVTT-----FLPGFEPMDGTASYQDLDYGIRRLDHA  735
             LYGDVVLR++SY +      +     FLPGFE M  T+S+  LD+G+RRLDHA
Sbjct  168  QLYGDVVLRYVSYSNSSDVSDSNPDLWFLPGFEAM--TSSFP-LDFGLRRLDHA  218



>ref|XP_007048965.1| Phytoene desaturation 1 [Theobroma cacao]
 gb|EOX93122.1| Phytoene desaturation 1 [Theobroma cacao]
Length=408

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 148/218 (68%), Gaps = 15/218 (7%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  297
            ++ GFKL+GF  FVR  P SD F VK FHHVEFWC DATN A RF   LG  + AKSDLS
Sbjct  6    QSSGFKLLGFSKFVRTTPMSDLFKVKGFHHVEFWCTDATNVACRFLLGLGTQMVAKSDLS  65

Query  298  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saHRSFNATHG  459
            TGN  HASYL+  S G L FLFTAPY+ SI+   + +  + ++      +A R+F+++HG
Sbjct  66   TGNMIHASYLI--SSGHLNFLFTAPYSPSIAQAENLSPTATASIPTFDHAACRAFSSSHG  123

Query  460  LGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS--  633
            L VRA+A+ V+D + AFS SV+ GAKP S P  L+N+VVLAEVHLYGDV+LRFISY +  
Sbjct  124  LTVRAIAIEVQDAEIAFSTSVAHGAKPSSPPNFLDNRVVLAEVHLYGDVILRFISYKNCD  183

Query  634  ----DPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                D      FLPGFE M    SY  LDYGIRRLDHA
Sbjct  184  DCSHDDGPGCWFLPGFEKMGEGFSYS-LDYGIRRLDHA  220



>ref|XP_002453359.1| hypothetical protein SORBIDRAFT_04g004560 [Sorghum bicolor]
 gb|EES06335.1| hypothetical protein SORBIDRAFT_04g004560 [Sorghum bicolor]
Length=440

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 133/201 (66%), Gaps = 8/201 (4%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F+LVG ++FVRVNP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGN+
Sbjct  25   FRLVGHRNFVRVNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNT  84

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
            AHAS LLR+  G L FLFTAPYA       ++     +A A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRS--GALAFLFTAPYAHGADAATASLPSFSAAEARR-FAADHGLAVRAVALRV  141

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
             D + AF ASV+ GA+P  EPV L     LAEV LYGDVVLR++SY  D  A  +FLPGF
Sbjct  142  ADAEDAFRASVAAGARPAFEPVELGLGFRLAEVELYGDVVLRYVSYPDDADA--SFLPGF  199

Query  670  EPMDGTASYQDLDYGIRRLDH  732
                G  S    DYG+RR DH
Sbjct  200  V---GVTSPGAADYGLRRFDH  217



>ref|XP_004951787.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Setaria 
italica]
Length=441

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 136/205 (66%), Gaps = 8/205 (4%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  297
            +   F+LVG + FVRVNP+SD F    FHHVE WC DAT+ A RFS+ LG P+AA+SDLS
Sbjct  22   DQAAFRLVGHRGFVRVNPRSDRFHTLSFHHVELWCADATSAAGRFSFGLGAPLAARSDLS  81

Query  298  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAV  477
            TGNSAHAS LLR+  G L FLFTAPYA  +    ++     + +A RSF A HGL VRA+
Sbjct  82   TGNSAHASLLLRS--GSLAFLFTAPYAHGVDAATASLPSFSAPAA-RSFAADHGLAVRAI  138

Query  478  ALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTF  657
             L V D + AF ASV+ GA+P  +PV L     LAEV LYGDVVLR++SY     A   F
Sbjct  139  GLRVADAEDAFRASVAAGARPAFKPVELGLGFRLAEVELYGDVVLRYVSYPDAEDA--PF  196

Query  658  LPGFEPMDGTASYQDLDYGIRRLDH  732
            LPGFE ++   +   L+YG+RR DH
Sbjct  197  LPGFENVNNPGA---LNYGLRRFDH  218



>dbj|BAD26248.1| putative 4-hydroxyphenylpyruvate dioxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD25710.1| putative 4-hydroxyphenylpyruvate dioxygenase [Oryza sativa Japonica 
Group]
Length=446

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 136/209 (65%), Gaps = 11/209 (5%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  297
            EN GF+LVG + FVR NP+SD F    FHHVE WC DA + A RF++ALG P+AA+SDLS
Sbjct  22   ENAGFRLVGHRRFVRANPRSDRFQALAFHHVELWCADAASAAGRFAFALGAPLAARSDLS  81

Query  298  TGNSAHASYLLRASGGELQFLFTapy----assisnpasaaipsfsasaHRSFNATHGLG  465
            TGNSAHAS LLR++   + FLFTAPY            +A+IPSFS  A R F A HGL 
Sbjct  82   TGNSAHASLLLRSA--SVAFLFTAPYGGDHGVGADAATTASIPSFSPGAARRFAADHGLA  139

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSA  645
            V AVAL V D   AF ASV+ GA+P  +P  L     LAEV LYGDVVLRF+S+     A
Sbjct  140  VHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEVELYGDVVLRFVSHPD--GA  197

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
               FLPGFE   G ++   +DYG+RR DH
Sbjct  198  DAPFLPGFE---GVSNPGAVDYGLRRFDH  223



>ref|XP_006853410.2| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase 
[Amborella trichopoda]
Length=442

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 136/218 (62%), Gaps = 18/218 (8%)
 Frame = +1

Query  121  NGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLST  300
            NGG KLVGFK+FVR NPK+D     +FHH+EFWC DATNT+ RF  AL MP+ AKSDLST
Sbjct  5    NGGLKLVGFKNFVRSNPKTDRIPPTKFHHIEFWCSDATNTSGRFQNALLMPLNAKSDLST  64

Query  301  GNSAHASYLLRASGGELQFLFTapyassisnpasaaipsf--sasaHRSFNATHGLGVRA  474
            GNS ++SY+LR+   +L F FTAPY  + S   S  +P      +  R F   HGLGVRA
Sbjct  65   GNSVYSSYVLRSH--DLIFAFTAPYLVNFSGNMSRNMPLPYFKPAEAREFVXGHGLGVRA  122

Query  475  VALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDP  639
            V L+V D   AF  S+  GA PV+ PV L +     ++ +AE+ LYGDVVLRF+S  SD 
Sbjct  123  VGLLVPDASEAFRKSLEGGAIPVNAPVELTSPTTAGKMTVAEIKLYGDVVLRFVSSSSDF  182

Query  640  SAVTTFLPGFEPMDGTASYQDLD-------YGIRRLDH  732
            S    FLPG+EP+      ++ +        G+ RLDH
Sbjct  183  SGA--FLPGYEPVGPAIPAKNPNSPVLAPTCGLLRLDH  218



>ref|XP_009419542.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 142/240 (59%), Gaps = 30/240 (13%)
 Frame = +1

Query  64   TEVMGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTA  243
            + VMGKE + +           FKLVGF  FVR NP+SD F V  FHHVEFW  DATN+A
Sbjct  27   SRVMGKEATEN-----------FKLVGFTRFVRANPRSDRFPVLGFHHVEFWAADATNSA  75

Query  244  RRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTa------pyassisnpasa  405
             RFS+ LGMP+AA+SDLSTGN   ASYLLR++   L+FLF+A         ++ +   ++
Sbjct  76   GRFSFGLGMPLAARSDLSTGNPFFASYLLRSAS--LRFLFSAPYGGPAAADAAANPANTS  133

Query  406  aipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAE  585
             IPSF A   R F+  HGL VRA+A+ V D   AF  SV+ GA+P   P  L     LAE
Sbjct  134  PIPSFDADRARRFSVDHGLAVRAIAVEVADAAEAFRISVAHGARPSFPPADLGEGFALAE  193

Query  586  VHLYGDVVLRFISYLSDPS----------AVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            V LYGDVVLR++S    P            V  FLPGFE +D + +     YGIRRLDHA
Sbjct  194  VELYGDVVLRYVSRPKPPPFPSEARQTPIKVPAFLPGFEDIDESETCS-FTYGIRRLDHA  252



>ref|XP_001694723.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
 emb|CAD24031.1| p-hydroxyphenylpyruvate dioxigenase [Chlamydomonas reinhardtii]
 gb|EDP02307.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=432

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 136/210 (65%), Gaps = 15/210 (7%)
 Frame = +1

Query  124  GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  303
            GG KLVG+K+FVR NP SD F+V +FHH++FWCGDATNT++RFS+ LGMP+ AKSD ST 
Sbjct  13   GGIKLVGYKNFVRQNPLSDKFTVHKFHHIDFWCGDATNTSKRFSYGLGMPLVAKSDQSTN  72

Query  304  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR-SFNATHGLGVRAVA  480
            N   ASY+LR++  +L F FTAPY+   ++ +           H   F  +HGL VRAV 
Sbjct  73   NQLFASYVLRSN--DLVFTFTAPYSRKCASVSEGVPLRHYNIDHAYEFINSHGLAVRAVG  130

Query  481  LVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFISYLSDPSA  645
            L+V+D + A+  SV+ GAK V  PV L ++      V++EV LYG+VVLR++S     S 
Sbjct  131  LLVDDAKTAYEVSVAHGAKGVLPPVELRDEASGTSQVISEVLLYGEVVLRYVS----GSF  186

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               FL G+ P+  +A      +G++RLDHA
Sbjct  187  QGPFLAGYTPVTDSAV---TSFGLQRLDHA  213



>emb|CAR47957.1| p-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=432

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 136/210 (65%), Gaps = 15/210 (7%)
 Frame = +1

Query  124  GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  303
            GG KLVG+K+FVR NP SD F+V +FHH++FWCGDATNT++RFS+ LGMP+ AKSD ST 
Sbjct  13   GGIKLVGYKNFVRQNPLSDKFTVHKFHHIDFWCGDATNTSKRFSYGLGMPLVAKSDQSTN  72

Query  304  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR-SFNATHGLGVRAVA  480
            N   ASY+LR++  +L F FTAPY+   ++ +           H   F  +HGL VRAV 
Sbjct  73   NQLFASYVLRSN--DLVFTFTAPYSRKCASVSEGVPLRHYNIDHAYEFINSHGLAVRAVG  130

Query  481  LVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFISYLSDPSA  645
            L+V+D + A+  SV+ GAK V  PV L ++      V++EV LYG+VVLR++S     S 
Sbjct  131  LLVDDAKTAYEVSVAHGAKGVLPPVELRDEASGTSQVISEVLLYGEVVLRYVS----GSF  186

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               FL G+ P+  +A      +G++RLDHA
Sbjct  187  QGPFLAGYTPVTDSAV---TSFGLQRLDHA  213



>gb|AAZ67144.1| 4-hydroxyphenylpyruvate dioxygenase [Triticum aestivum]
Length=436

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 124/195 (64%), Gaps = 8/195 (4%)
 Frame = +1

Query  148  KDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYL  327
            +  VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNS HAS L
Sbjct  27   RRMVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSVHASQL  86

Query  328  LRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAA  507
            LR+  G L FLFTAPYA+      ++     + +A R F+A HGL VR++AL V D   A
Sbjct  87   LRS--GNLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGLAVRSIALRVADAAEA  143

Query  508  FSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGT  687
            F ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D      FLPGFE   G 
Sbjct  144  FRASVDGGARPAFSPVDLGRGFGFAEVELYGDVVLRFVSHPDDTD--VPFLPGFE---GV  198

Query  688  ASYQDLDYGIRRLDH  732
            ++   +DYG+ R DH
Sbjct  199  SNPDAVDYGLTRFDH  213



>sp|O48604.1|HPPD_HORVU RecName: Full=4-hydroxyphenylpyruvate dioxygenase; AltName: Full=4-hydroxyphenylpyruvic 
acid oxidase; Short=4HPPD; Short=HPD; 
Short=HPPDase [Hordeum vulgare]
 emb|CAA04245.1| 4-hydroxyphenylpyruvate dioxygenase [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 125/193 (65%), Gaps = 8/193 (4%)
 Frame = +1

Query  154  FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  333
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR
Sbjct  27   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLR  86

Query  334  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  513
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  87   S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  143

Query  514  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTAS  693
            AS  RGA+P   PV L      AEV LYGDVVLRF+S+  D + V  FLPGFE   G  +
Sbjct  144  ASRRRGARPAFAPVDLGRGFAFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE---GVTN  198

Query  694  YQDLDYGIRRLDH  732
               +DYG+ R DH
Sbjct  199  PDAVDYGLTRFDH  211



>ref|XP_001756086.1| predicted protein [Physcomitrella patens]
 gb|EDQ78952.1| predicted protein [Physcomitrella patens]
Length=433

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 132/210 (63%), Gaps = 15/210 (7%)
 Frame = +1

Query  124  GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  303
            G   LVG + FVR NPK+D F V+RFHHVEFWCGDA+NT RRFSW LGM + AKSD +TG
Sbjct  14   GPLHLVGCERFVRNNPKTDRFGVERFHHVEFWCGDASNTWRRFSWGLGMHLVAKSDQTTG  73

Query  304  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVA  480
            N  + SY ++++  EL F FTAPY+S+I    +        S   RSF  +HGL VRAV 
Sbjct  74   NQTYCSYAIQSN--ELVFAFTAPYSSTIDQTNTKMPHPGYKSDEARSFTDSHGLAVRAVG  131

Query  481  LVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSA  645
            ++V+D   AF  SV  GA  V EP  L++     ++V+AEV LYGDVVLR   Y+S+   
Sbjct  132  ILVDDADEAFRISVEHGAVSVLEPHVLSDDAKGGKMVMAEVKLYGDVVLR---YVSEQGY  188

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
              + LP +E ++       L YG+ RLDHA
Sbjct  189  KGSMLPNYEEVESLP----LSYGLVRLDHA  214



>ref|XP_003570001.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Brachypodium 
distachyon]
Length=436

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 130/196 (66%), Gaps = 7/196 (4%)
 Frame = +1

Query  148  KDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYL  327
            +   RVNP+SD FS   FHHVE WC DA + A RFS+ALG P AA+SDLSTGNSAHAS L
Sbjct  24   RRVARVNPRSDRFSALSFHHVELWCADAASAAGRFSFALGAPPAARSDLSTGNSAHASIL  83

Query  328  LRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATH-GLGVRAVALVVEDTQA  504
            LR+  G L FLFTAPYA S ++ ++A+IPSFSASA R F A H GL VRAVAL V     
Sbjct  84   LRS--GSLAFLFTAPYAPSPASDSAASIPSFSASAARQFTADHGGLAVRAVALRVSSASD  141

Query  505  AFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDG  684
            AF ASVS GA+P   P  L     LAEV LYGDVVLRFIS+  D +    FLPGFE +  
Sbjct  142  AFHASVSAGARPSFPPADLGQGFALAEVELYGDVVLRFISH-PDENTEIPFLPGFESVSN  200

Query  685  TASYQDLDYGIRRLDH  732
              +     YG+ R DH
Sbjct  201  PGAST---YGLTRFDH  213



>dbj|BAJ86732.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86970.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91713.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 125/193 (65%), Gaps = 8/193 (4%)
 Frame = +1

Query  154  FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  333
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR
Sbjct  27   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLR  86

Query  334  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  513
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  87   S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  143

Query  514  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTAS  693
            ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FLPGFE   G  +
Sbjct  144  ASVDGGARPAFAPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE---GVTN  198

Query  694  YQDLDYGIRRLDH  732
               +DYG+ R DH
Sbjct  199  PDAVDYGLTRFDH  211



>emb|CAJ29893.1| 4-hydroxyphenylpyruvate dioxygenase [Triticum aestivum]
Length=381

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 126/195 (65%), Gaps = 8/195 (4%)
 Frame = +1

Query  148  KDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYL  327
            +  VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNS HAS L
Sbjct  27   RRMVRFNPRSDRFHTLAFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSVHASQL  86

Query  328  LRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAA  507
            LR+  G L FLFTAPYA+      ++     + +A R F+A HGL VR++AL V D   A
Sbjct  87   LRS--GNLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGLAVRSIALRVADAAEA  143

Query  508  FSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGT  687
            F ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FLPGFE   G 
Sbjct  144  FRASVDGGARPAFSPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE---GV  198

Query  688  ASYQDLDYGIRRLDH  732
            ++   +DYG+ R DH
Sbjct  199  SNPDAVDYGLTRFDH  213



>ref|XP_008620054.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia diclina VS20]
 gb|EQC26475.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia diclina VS20]
Length=444

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 128/225 (57%), Gaps = 16/225 (7%)
 Frame = +1

Query  79   KETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSW  258
            K  +S      +P     KLVG+ +FVR NPKSD F  ++FHH+EF+C DATN ++RF W
Sbjct  18   KRAASPKKPAESPSKKKMKLVGYNNFVRHNPKSDKFDARKFHHIEFYCQDATNVSKRFGW  77

Query  259  ALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-  435
              G+   AKSD STGN ++ASY+++   GELQ + TAPY+ +                H 
Sbjct  78   GAGLKCVAKSDQSTGNHSYASYVMQT--GELQLVITAPYSRANKKADQVPPHPGYDINHA  135

Query  436  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYG  600
              FN  HGL VRA+A+ V D + A+  SV  GA  V EP TL +      +V+AEV  YG
Sbjct  136  HEFNNKHGLAVRAMAVTVGDAKNAYEVSVKNGAVGVCEPKTLKDAKTGTSLVIAEVKFYG  195

Query  601  DVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            DVVLR++S          F PG+E ++G     D+  GI RLDHA
Sbjct  196  DVVLRYVS----GDYKGRFFPGYEDVEGP----DVSIGIERLDHA  232



>dbj|BAK02084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=459

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 125/193 (65%), Gaps = 8/193 (4%)
 Frame = +1

Query  154  FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  333
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR
Sbjct  52   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLR  111

Query  334  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  513
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  112  S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  168

Query  514  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTAS  693
            ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FLPGFE   G  +
Sbjct  169  ASVDGGARPAFAPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE---GVTN  223

Query  694  YQDLDYGIRRLDH  732
               +DYG+ R DH
Sbjct  224  PDAVDYGLTRFDH  236



>ref|XP_001757940.1| predicted protein [Physcomitrella patens]
 gb|EDQ77182.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 128/210 (61%), Gaps = 15/210 (7%)
 Frame = +1

Query  124  GGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTG  303
            G  +LVG   FVR NPK+DHF V+RFHH+EFWCGDA+NT RRFSW LGM + AKSD +TG
Sbjct  14   GALRLVGCDRFVRNNPKTDHFGVQRFHHIEFWCGDASNTWRRFSWGLGMHLVAKSDQTTG  73

Query  304  NSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVA  480
            N  + SY ++++  EL F FTAPY+S I    +        S   RSF   HGL VRAV 
Sbjct  74   NQTYCSYAIQSN--ELVFAFTAPYSSKIDQTNTKMPHPGYKSKEARSFVDAHGLAVRAVG  131

Query  481  LVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSA  645
            ++V+D   A+  SV  GA  V EP  L++     ++ +AEV LYGDVVLR   Y+S    
Sbjct  132  ILVDDAAEAYRTSVEHGALSVLEPHVLSDDAKGGKMSMAEVKLYGDVVLR---YVSTQGY  188

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                LP +E ++       L YG+ RLDHA
Sbjct  189  KGPMLPNYEDVESLP----LTYGLVRLDHA  214



>ref|XP_008811120.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase [Phoenix dactylifera]
Length=451

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 137/215 (64%), Gaps = 16/215 (7%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVGFK FVR NP++D F V  FHH+EFW  DATN A RFS+ LGM +AA+SDLSTGN 
Sbjct  18   FKLVGFKRFVRTNPRTDRFPVLGFHHIEFWTADATNAAGRFSFGLGMRLAARSDLSTGNP  77

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa--------HRSFNATHGLG  465
             HAS+LLR+  G LQFLF++PY+      A A      + +         R F A+HGL 
Sbjct  78   FHASFLLRS--GSLQFLFSSPYSPFTPAAAGAPAGDPGSPSIPSFDPDRARRFTASHGLA  135

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLS----  633
            VRAVA+ V D  AAF  SV+ GA+    P  L     L+EV LYGDVVLR++S  +    
Sbjct  136  VRAVAVRVADAAAAFYTSVAHGARAALPPADLGAGFALSEVELYGDVVLRYVSLPAPESS  195

Query  634  -DPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             +PS + +FLPGFE ++ +  +   DYG+RRLDHA
Sbjct  196  QNPSKIPSFLPGFEDVEESGPHSP-DYGLRRLDHA  229



>dbj|BAJ95714.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 124/193 (64%), Gaps = 8/193 (4%)
 Frame = +1

Query  154  FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  333
             VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGN AHAS LLR
Sbjct  27   MVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNFAHASQLLR  86

Query  334  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  513
            +  G L FLFTAPYA+      ++     + +A R F+A HG+ VR+VAL V D   AF 
Sbjct  87   S--GSLAFLFTAPYANGCDAATASLPSFSADAARR-FSADHGIAVRSVALRVADAAEAFR  143

Query  514  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTAS  693
            ASV  GA+P   PV L      AEV LYGDVVLRF+S+  D + V  FLPGFE   G  +
Sbjct  144  ASVDGGARPAFAPVDLGRGFGFAEVELYGDVVLRFVSH-PDGTDV-PFLPGFE---GVTN  198

Query  694  YQDLDYGIRRLDH  732
               +DYG+ R DH
Sbjct  199  PDAVDYGLTRFDH  211



>pdb|1SP8|A Chain A, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|B Chain B, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|C Chain C, 4-hydroxyphenylpyruvate Dioxygenase
 pdb|1SP8|D Chain D, 4-hydroxyphenylpyruvate Dioxygenase
Length=418

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 135/208 (65%), Gaps = 7/208 (3%)
 Frame = +1

Query  109  STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  288
            S  E   F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+S
Sbjct  2    SAAEQAAFRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARS  61

Query  289  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGV  468
            DLSTGNSAHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL V
Sbjct  62   DLSTGNSAHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAV  118

Query  469  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAV  648
            RAVAL V D + AF ASV+ GA+P   PV L     LAEV LYGDVVLR++SY  D +A 
Sbjct  119  RAVALRVADAEDAFRASVAAGARPAFGPVDLGRGFRLAEVELYGDVVLRYVSY-PDGAAG  177

Query  649  TTFLPGFEPMDGTASYQDLDYGIRRLDH  732
              FLPGFE   G AS    DYG+ R DH
Sbjct  178  EPFLPGFE---GVASPGAADYGLSRFDH  202



>ref|XP_002952694.1| 4-hydroxyphenylpyruvate dioxygenase [Volvox carteri f. nagariensis]
 gb|EFJ46247.1| 4-hydroxyphenylpyruvate dioxygenase [Volvox carteri f. nagariensis]
Length=433

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 134/217 (62%), Gaps = 17/217 (8%)
 Frame = +1

Query  109  STP--ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAA  282
            STP    GG KLVG+ +FVR NP+SD F+V++FHH+EFWC DATNT +RF   LGM + A
Sbjct  7    STPGGREGGVKLVGYHNFVRHNPRSDKFAVQKFHHIEFWCADATNTFKRFQHGLGMTLVA  66

Query  283  KSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR-SFNATHG  459
            KSD ST N+ +ASY+LR++  +L F FTAPY+   +  +               F   HG
Sbjct  67   KSDQSTNNTLYASYVLRSN--DLVFTFTAPYSRKCAAVSEGTPLRHYRVDEAYDFVNCHG  124

Query  460  LGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFIS  624
            LGV+AV L+VED +AA+  SV+ G K V  P  L ++       +AEV LYGDVVLR++S
Sbjct  125  LGVKAVGLLVEDARAAYEVSVADGGKGVLAPQELTDEATGTTQTVAEVLLYGDVVLRYVS  184

Query  625  YLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                 S    FL G+ P+  + +   + YG++R+DHA
Sbjct  185  ----GSFTGPFLAGYTPLPDSPA---ISYGLQRVDHA  214



>ref|XP_008863477.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETW07384.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=445

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 132/208 (63%), Gaps = 16/208 (8%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVGFK+FVR NPK+D F + +FHHVEF+C DATN ++RF WA G+ + AKSD STGN 
Sbjct  36   MKLVGFKNFVRHNPKTDRFPMHKFHHVEFYCQDATNVSKRFGWAAGLNLVAKSDQSTGNH  95

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVALV  486
            A+ASY++++  GELQ + TAPY+       S A   +        F A HGL VRA+ + 
Sbjct  96   AYASYVMQS--GELQLVITAPYSRQQQKAESTAPLPYFDVPFAHEFCAKHGLAVRAMGVS  153

Query  487  VEDTQAAFSASVSRGAKPVSEP-----VTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            VED +AA+  SV+ GA+ V+ P      T     V++EV LYG+VVLR++S     +   
Sbjct  154  VEDAKAAYEISVAHGAEGVNPPREIKDATTGQVTVVSEVKLYGEVVLRYVS----GNFTG  209

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             +LPG+E +DG     D+  G++RLDHA
Sbjct  210  RYLPGYENVDGP----DVSIGLQRLDHA  233



>ref|XP_010480369.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=466

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = +1

Query  208  VEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassi  387
            + ++C   TN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+
Sbjct  76   IPYFC---TNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSL  130

Query  388  snpasaaipsfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEP  552
            +        + S       + RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P
Sbjct  131  TAGEIKPTATASIPSFDHVSSRSFFSSHGLGVRAVAIEVEDAESAFSVSVSNGAIPSSPP  190

Query  553  VTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLD  729
            + L+   V +AEV LYGDVVLR++SY  D S    FLPGFEP++ T+S+  +DYG+RRLD
Sbjct  191  MVLDGGAVTIAEVKLYGDVVLRYVSYKEDKSE---FLPGFEPVEDTSSFP-VDYGLRRLD  246

Query  730  HA  735
            HA
Sbjct  247  HA  248



>ref|XP_010480368.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=466

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 127/182 (70%), Gaps = 15/182 (8%)
 Frame = +1

Query  208  VEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassi  387
            + ++C   TN ARRFSW LGM  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S+
Sbjct  76   IPYFC---TNVARRFSWGLGMRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSL  130

Query  388  snpasaaipsfsa-----saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEP  552
            +        + S       + RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P
Sbjct  131  TAGEIKPTATASIPSFDHVSSRSFFSSHGLGVRAVAIEVEDAESAFSVSVSNGAIPSSPP  190

Query  553  VTLN-NQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLD  729
            + L+   V +AEV LYGDVVLR++SY  D S    FLPGFEP++ T+S+  +DYG+RRLD
Sbjct  191  MVLDGGAVTIAEVKLYGDVVLRYVSYKEDKSE---FLPGFEPVEDTSSFP-VDYGLRRLD  246

Query  730  HA  735
            HA
Sbjct  247  HA  248



>ref|XP_009825673.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV83981.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=422

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 135/215 (63%), Gaps = 16/215 (7%)
 Frame = +1

Query  109  STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  288
            + P     +LVGFK+FVR NPKSD F++ +FHHVEF+C DATN ++RF W  G+ + AKS
Sbjct  6    AAPSTTKMQLVGFKNFVRHNPKSDRFTMHKFHHVEFYCQDATNVSKRFGWGAGLNLVAKS  65

Query  289  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLG  465
            D STGN A+ASY++++  G+LQ + TAPY+       S A            F A HGL 
Sbjct  66   DQSTGNHAYASYVMQS--GDLQLVITAPYSRQNQKTTSTAPLPHFDVPFAHEFCAKHGLA  123

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN----QV-VLAEVHLYGDVVLRFISYL  630
            VRA+ + VED +AA+  SV+ G + V+ P  L +    QV V++EV LYG+VVLRF+S  
Sbjct  124  VRAMGISVEDAKAAYDISVANGGEGVTPPQELTDAATGQVSVVSEVKLYGEVVLRFVS--  181

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               +    FLPG+E ++G     D+  G++RLDHA
Sbjct  182  --GNFAGRFLPGYENVEGP----DVSIGLQRLDHA  210



>gb|AFW70252.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Zea mays]
Length=444

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 133/201 (66%), Gaps = 7/201 (3%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGNS
Sbjct  25   FRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNS  84

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
            AHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAVRAVALRV  141

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
             D + AF ASV+ GA+P   PV L     LAEV LYGDVVLR++SY  D +A   FLPGF
Sbjct  142  ADAEDAFRASVAAGARPAFGPVDLGRGFRLAEVELYGDVVLRYVSY-PDGAAGEPFLPGF  200

Query  670  EPMDGTASYQDLDYGIRRLDH  732
            E   G AS    DYG+ R DH
Sbjct  201  E---GVASPGAADYGLSRFDH  218



>ref|NP_001105782.1| 4-hydroxyphenylpyruvate dioxygenase 1 [Zea mays]
 emb|CAG25475.1| putative p-hydroxyphenylpyruvate dioxygenase [Zea mays]
Length=444

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 132/201 (66%), Gaps = 7/201 (3%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGNS
Sbjct  25   FRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNS  84

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
            AHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAVRAVALRV  141

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
             D + AF  SV+ GA+P   PV L     LAEV LYGDVVLR++SY  D +A   FLPGF
Sbjct  142  ADAEEAFRTSVAAGARPAFGPVDLGRGFRLAEVELYGDVVLRYVSY-PDGAAGEPFLPGF  200

Query  670  EPMDGTASYQDLDYGIRRLDH  732
            E   G AS    DYG+ R DH
Sbjct  201  E---GVASPGAADYGLSRFDH  218



>ref|XP_005650422.1| p-hydroxyphenylpyruvate dioxigenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25878.1| p-hydroxyphenylpyruvate dioxigenase [Coccomyxa subellipsoidea 
C-169]
Length=426

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 129/209 (62%), Gaps = 17/209 (8%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG   F RVNP SD F V +FHH+++WC DAT+T RRF W LGM + AKSDLSTGNS
Sbjct  8    LKLVGHGQFKRVNPNSDLFKVIKFHHIDWWCSDATSTQRRFGWGLGMQLVAKSDLSTGNS  67

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFN--ATHGLGVRAVAL  483
              ASY L+++  +L F FTAPY++ +     +  P     A  + N  A HGLGVR+V +
Sbjct  68   TFASYALKSN--DLVFSFTAPYSTKVEKSKESKSPIPWYKADMALNFIAAHGLGVRSVGV  125

Query  484  VVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFISYLSDPSAV  648
            +VED   A   + + GA  V EPVTL ++      V++EV+LYGDVVLRF+S     S  
Sbjct  126  LVEDAAEAHQKATAHGAVSVVEPVTLRDEASGTEQVVSEVNLYGDVVLRFVS----GSYQ  181

Query  649  TTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
              +L G+  ++       L YGI+RLDHA
Sbjct  182  GPYLAGYTAVESPP----LSYGIQRLDHA  206



>gb|KDO16411.1| 4-hydroxyphenylpyruvate dioxygenase [Saprolegnia parasitica CBS 
223.65]
Length=417

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 127/212 (60%), Gaps = 16/212 (8%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLS  297
            EN   +LVG+ +FVR NPKSD F + +FHH+EF+C DATN ++RF W  G+   AKSD S
Sbjct  4    ENKKIQLVGYNNFVRHNPKSDRFPMHKFHHIEFYCQDATNVSKRFGWGAGLKCVAKSDQS  63

Query  298  TGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRA  474
            TGN ++ASY+++   GELQ + TAPY+ +     +          +   FN  HGL VRA
Sbjct  64   TGNHSYASYVMQT--GELQLVITAPYSRANKKADAIPPHQGFDMEYAHEFNNKHGLAVRA  121

Query  475  VALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDP  639
            +A+ V+D   A+  SV  GA  V  P T  +      +V++EV LYGDVVLR++S     
Sbjct  122  MAVSVDDAAQAYDISVKNGAVGVCSPKTTKDAATGETMVISEVKLYGDVVLRYVS----G  177

Query  640  SAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +    ++PG+E ++G     D+  GI RLDHA
Sbjct  178  NYKGRYMPGYENVEGP----DVSIGIERLDHA  205



>ref|XP_008863478.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETW07385.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=420

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 136/222 (61%), Gaps = 21/222 (9%)
 Frame = +1

Query  88   SSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALG  267
            +++ N+H T      KLVG+++FVR NP SD F + +FHHVEF+  DATN ++RF WA G
Sbjct  2    AAASNNHKT-----MKLVGYENFVRHNPMSDRFPMHKFHHVEFYTQDATNVSKRFGWAAG  56

Query  268  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSF  444
            + + AKSD STGN  +ASY++++  GELQ + TAPY+         A      +A    F
Sbjct  57   LKLVAKSDQSTGNHVYASYVMQS--GELQIVITAPYSRQQQKVDHVAPNQGFDNAFAHEF  114

Query  445  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN----QV-VLAEVHLYGDVV  609
             A HGL VRA+A+ V+D   A+  SV  GA  ++ P T  +    QV VL+EV LYG+VV
Sbjct  115  CAKHGLAVRAMAITVDDATVAYETSVKNGAVGITSPKTTTDAATGQVQVLSEVKLYGEVV  174

Query  610  LRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LRFIS     +    F+PG+E +DG     D+  GI+RLDHA
Sbjct  175  LRFIS----GNYTGRFMPGYENVDGP----DVSIGIQRLDHA  208



>ref|XP_003617383.1| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=410

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 121/193 (63%), Gaps = 35/193 (18%)
 Frame = +1

Query  166  NPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGG  345
            NPKSD F  KRFHHVEFWC DATNTARRFS  LGMPI AKSDLSTG   HASYLLR+  G
Sbjct  81   NPKSDLFKFKRFHHVEFWCTDATNTARRFSHGLGMPIVAKSDLSTGILTHASYLLRS--G  138

Query  346  ELQFLFTapyassisnpasaaipsf---sasaHRSFNATHGLGVRAVALVVEDTQAAFSA  516
            +L  LF+A Y+ SIS  + +   S    SA A  +F+A+HGL VRAVA+ V++ + AF+ 
Sbjct  139  DLNLLFSAAYSPSISLSSPSPTASIPSFSAPACFAFSASHGLSVRAVAVEVDNAELAFTT  198

Query  517  SVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASY  696
            SV+ GA P S  V LNN+V L+EV L+GDVVL                            
Sbjct  199  SVNHGAVPSSPAVVLNNRVKLSEVRLFGDVVL----------------------------  230

Query  697  QDLDYGIRRLDHA  735
              LD+GIRRLDHA
Sbjct  231  --LDFGIRRLDHA  241



>ref|XP_009825674.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV83982.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=420

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 138/222 (62%), Gaps = 21/222 (9%)
 Frame = +1

Query  88   SSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALG  267
            +++ N H T      KLVG+++FVR NPKSD F++ +FHHVEF+  DATN ++RF WA G
Sbjct  2    AATPNDHKT-----MKLVGYENFVRHNPKSDRFAMHKFHHVEFYTQDATNVSKRFGWAAG  56

Query  268  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSF  444
            + + +KSD STGN A+ASY++++  G+LQ + TAPY+       + A      +A+   F
Sbjct  57   LKLVSKSDQSTGNHAYASYVMQS--GDLQIVITAPYSRQQQKADNIAPNQGFDNAYAHEF  114

Query  445  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVV  609
             A HGL VRA+A+ V+D   A+  +V  GA  V+ P T  +       VL+EV LYGDVV
Sbjct  115  CAKHGLAVRAMAISVDDATVAYETAVKNGAVGVTSPKTSTDAATGEFQVLSEVKLYGDVV  174

Query  610  LRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LRFIS     +    FLPG++ ++G     D+  G++RLDHA
Sbjct  175  LRFIS----GNYTGRFLPGYQNVEGP----DVSIGLQRLDHA  208



>ref|XP_002461829.1| hypothetical protein SORBIDRAFT_02g008850 [Sorghum bicolor]
 gb|EER98350.1| hypothetical protein SORBIDRAFT_02g008850 [Sorghum bicolor]
Length=496

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 119/194 (61%), Gaps = 10/194 (5%)
 Frame = +1

Query  178  DHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQF  357
            D F V  FHHVEFWC DA + A RFS+ALG+P+AA+SDL+TGN+AHAS LLR+  G L  
Sbjct  83   DRFHVMDFHHVEFWCADAASAAGRFSFALGVPLAAQSDLTTGNTAHASRLLRSRSGPLAL  142

Query  358  LFTapyassisnpasaaipsfsasaHRSFNATH---------GLGVRAVALVVEDTQAAF  510
            LFTAPYA  I     A   S S+    SF+A           GL VRAVA+ V D   AF
Sbjct  143  LFTAPYARHIGARPDADATSASSPVVPSFSADAARRFAADYGGLAVRAVAVRVSDAAEAF  202

Query  511  SASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTA  690
             ASV+ GA+P   P  L +  V AEV LYGD VLRF+SY  D   V  FLPGFE +  ++
Sbjct  203  RASVAAGARPAFAPAELGHGFVFAEVELYGDAVLRFVSYPDDTGGV-AFLPGFENVANSS  261

Query  691  SYQDLDYGIRRLDH  732
            +    DYG+ R DH
Sbjct  262  ACPAPDYGLNRFDH  275



>ref|XP_002461838.1| hypothetical protein SORBIDRAFT_02g008990 [Sorghum bicolor]
 gb|EER98359.1| hypothetical protein SORBIDRAFT_02g008990 [Sorghum bicolor]
Length=480

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 117/194 (60%), Gaps = 9/194 (5%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            +D F V  FHHVEFWC DA + A RFS+ALG+P+AA SDL+TGN+AHAS+LLR+  G L 
Sbjct  75   TDRFHVMDFHHVEFWCADAASAAGRFSFALGVPLAAHSDLTTGNTAHASHLLRSRSGPLA  134

Query  355  FLFTapyassisnpasaaipsfsasaHRS------FNATHGLGVRAVALVVEDTQAAFSA  516
             LFTAPYA+           S S     S      F A HGL VRAVA+ V D   AF A
Sbjct  135  LLFTAPYAAQHGGADDDDTASSSVLPSFSADAARRFAADHGLAVRAVAVCVSDAAEAFRA  194

Query  517  SVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASY  696
            SV+ GA+P   P  L +  V AEV LYGDVVLRF+SY  D   V  FLPGF  +  +   
Sbjct  195  SVAAGARPAFAPAELGHGFVFAEVELYGDVVLRFVSYPDDTDDV-AFLPGFANVASSEDQ  253

Query  697  QDL--DYGIRRLDH  732
             +   DYG+ R DH
Sbjct  254  SECPPDYGLSRFDH  267



>gb|ETM53414.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Phytophthora parasitica]
Length=211

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 124/210 (59%), Gaps = 19/210 (9%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  483
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  484  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFISY-LSDPSA  645
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S     P  
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVSGDFEGP--  185

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               F+PG+E  +      D+  GI+RLDH 
Sbjct  186  ---FVPGYEKCE----CPDVSIGIQRLDHC  208



>gb|ETM00249.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Phytophthora parasitica]
Length=219

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 123/210 (59%), Gaps = 19/210 (9%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  483
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  484  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFISY-LSDPSA  645
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S     P  
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVSGDFEGP--  185

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               F+PG+E         D+  GI+RLDH 
Sbjct  186  ---FVPGYE----KCECPDVSIGIQRLDHC  208



>ref|XP_002974762.1| hypothetical protein SELMODRAFT_174278 [Selaginella moellendorffii]
 gb|EFJ24282.1| hypothetical protein SELMODRAFT_174278 [Selaginella moellendorffii]
Length=495

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 122/230 (53%), Gaps = 13/230 (6%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFK-LVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR  249
            +GKE           E+     LVGF  FVR NP +D F V  FHHVE WCGDATNT RR
Sbjct  62   IGKEIEQQRRQRQDLESKAKSGLVGFDKFVRSNPLTDRFKVLCFHHVELWCGDATNTWRR  121

Query  250  FSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsas  429
            FSW LGMP+ AKSD +TGN  + SY L++    L F             +    P+ +  
Sbjct  122  FSWGLGMPLVAKSDQTTGNHVYCSYALQSEDLVLVFSAPYSDKHRYQPASPPPHPAMTKP  181

Query  430  aHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHL  594
            A   F   HGL VRAV + VED   AF  SV  GA  V EP T+++     ++VL+EV L
Sbjct  182  AMLDFFDAHGLAVRAVGVRVEDAATAFRTSVEHGAIAVLEPTTMHDVHSGQELVLSEVAL  241

Query  595  YGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQD---LDYGIRRLDHA  735
            YGDVVLRF+S   D      FLPG+E +           L  G+ RLDHA
Sbjct  242  YGDVVLRFVSGGFD----GPFLPGYERVSPPPFSSSPSGLGVGLCRLDHA  287



>ref|XP_002963674.1| hypothetical protein SELMODRAFT_165961 [Selaginella moellendorffii]
 gb|EFJ35545.1| hypothetical protein SELMODRAFT_165961 [Selaginella moellendorffii]
Length=495

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 116/208 (56%), Gaps = 12/208 (6%)
 Frame = +1

Query  136  LVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAH  315
            LVGF  FVR NP +D F V  FHHVE WCGDATNT RRFSW LGMP+ AKSD +TGN  +
Sbjct  84   LVGFDKFVRSNPLTDRFKVLCFHHVELWCGDATNTWRRFSWGLGMPLVAKSDQTTGNHVY  143

Query  316  ASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVED  495
             SY L++    L F             +    P+ +  A   F   HGL VRAV + VED
Sbjct  144  CSYALQSEELVLVFSAPYSDKHRYQPASPPPHPAMTKPAMLDFFDAHGLAVRAVGVRVED  203

Query  496  TQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  660
               AF  SV  GA  V EP T+++     ++VL+EV LYGDVVLRF+S   D      FL
Sbjct  204  AATAFRTSVEHGAIAVLEPTTMHDVHSGQELVLSEVALYGDVVLRFVSGGFD----GPFL  259

Query  661  PGFEPMDGTASYQD---LDYGIRRLDHA  735
            PG+E +           L  G+ RLDHA
Sbjct  260  PGYERVSPPPFSSSPSGLGVGLCRLDHA  287



>gb|KDO32258.1| hypothetical protein SPRG_02737 [Saprolegnia parasitica CBS 223.65]
Length=432

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 125/208 (60%), Gaps = 16/208 (8%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG+++FVR NPK+D F + +FHHVEF+C DATN ++RF W  G    AKSD STGN 
Sbjct  1    MKLVGYQNFVRHNPKTDKFPMHKFHHVEFYCQDATNVSKRFGWGAGFKCVAKSDQSTGNH  60

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVALV  486
            ++ASY++++  GELQ + TAPY+     P +              FN  HGL VRA+A+ 
Sbjct  61   SYASYVMQS--GELQLVITAPYSRMNRKPDAIPPHQGFDMDFAHEFNNKHGLAVRAMAVS  118

Query  487  VEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            V+D   A+  SV  GA  V  P T  +      +V++EV LYGDVVLR++S     +   
Sbjct  119  VDDAAQAYDISVKNGAVGVCSPKTTKDATTGQTMVISEVKLYGDVVLRYVS----GNYKG  174

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             ++PG+E ++G     D+  GI RLDHA
Sbjct  175  RYMPGYENVEGP----DVSIGIERLDHA  198



>ref|XP_002901240.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
 gb|EEY59226.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
Length=418

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 123/215 (57%), Gaps = 19/215 (9%)
 Frame = +1

Query  115  PENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDL  294
            P     KLVG K+FVR NP +D F V +FHH+EF+C DATN +RRF+W LGM    KSD 
Sbjct  3    PSASDMKLVGCKNFVRNNPMTDRFDVHKFHHIEFYCADATNASRRFAWGLGMAQIGKSDQ  62

Query  295  STGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGV  468
            STGN   ASY++++  GE++ +FTAPYA        A            + F   HGL V
Sbjct  63   STGNHVSASYVIQS--GEVKLVFTAPYALETEKAPDAVSSISGYDPEFAQKFVMKHGLAV  120

Query  469  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS-YL  630
            RAV ++V D +AA+  SV  G   V EP TL ++       ++EV LYGDVV+R++S   
Sbjct  121  RAVGILVGDAKAAYELSVQNGGVGVVEPQTLTDKESGKTTTVSEVKLYGDVVIRWVSGDF  180

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
              P     F+PG+E  +      D+  GI+RLDH 
Sbjct  181  EGP-----FVPGYEKCE----CPDVSIGIQRLDHC  206



>gb|AAN28922.1| 4-hydroxyphenylpyruvate dioxygenase [Abutilon theophrasti]
Length=363

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 11/178 (6%)
 Frame = +1

Query  220  CGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpa  399
            C DATN A RFSW LGM   AKSDLSTGN +HASYLLR+    L  LFTAPY+ SI+   
Sbjct  1    CTDATNAACRFSWGLGMQFVAKSDLSTGNLSHASYLLRSD--HLSLLFTAPYSPSIALSQ  58

Query  400  saaipsfsa------saHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL  561
            + +  S ++      +  RSF+++HGL VRA+AL VED++ AF+ S+S GA P S P+ L
Sbjct  59   NISPHSTASIPSFDHTLCRSFSSSHGLVVRAIALEVEDSETAFATSISNGALPSSPPILL  118

Query  562  NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +   + +EV LYGDVVLR++SY S  +    FLPGFE ++   SY  LDYGIRRLDHA
Sbjct  119  DGATI-SEVKLYGDVVLRYVSY-SKNTNPHHFLPGFEKVEDNLSYP-LDYGIRRLDHA  173



>ref|XP_008653702.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Zea mays]
 tpg|DAA60243.1| TPA: hypothetical protein ZEAMMB73_261174 [Zea mays]
Length=445

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 131/193 (68%), Gaps = 10/193 (5%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            +D F V  FHHVEFWC DA + A RFS+ALG+P+AA+SDL+TGN+AHAS LLR+  G L 
Sbjct  35   TDRFHVIDFHHVEFWCADAASAAGRFSFALGVPLAAQSDLTTGNTAHASRLLRSRSGPLA  94

Query  355  FLFTapyas-------sisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  513
            FLFTAPYA+       + +  +S+ +PSFSA A R F A +GL VRAVA+ V D   AF 
Sbjct  95   FLFTAPYAAQHGADDDATAASSSSVLPSFSADAARRFAADYGLAVRAVAIRVSDAAEAFR  154

Query  514  ASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTAS  693
            ASV  GA+P   P  L +  V AEV LYGD VLRF+SY  D + V +FLPGFE +  ++S
Sbjct  155  ASVDAGARPAFAPAELGHGFVFAEVELYGDAVLRFVSY-PDGTDV-SFLPGFENV-ASSS  211

Query  694  YQDLDYGIRRLDH  732
             +  DYG+ R DH
Sbjct  212  AECPDYGLNRFDH  224



>ref|XP_003055822.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH61074.1| predicted protein [Micromonas pusilla CCMP1545]
Length=447

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 136/228 (60%), Gaps = 16/228 (7%)
 Frame = +1

Query  91   SSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGM  270
            +S   ++ P     KLVG K+FVR NPKSD F++++FHHVEFWC DAT TA RF+  LGM
Sbjct  2    ASSEANAAPAAKRHKLVGCKNFVRNNPKSDLFTMRKFHHVEFWCRDATTTAARFAVGLGM  61

Query  271  PIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa------  432
             + AKSDL+TGN+ +ASY+L+++  +L+F+F+APY          A  S    +      
Sbjct  62   QLVAKSDLTTGNARYASYVLQSN--DLRFVFSAPYDVPEGEENDDARSSMFEKSGVLSHD  119

Query  433  ---HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGD  603
                R+F   HGL VRAV L+V+D   AF  S   G +  +     +    ++EV LYGD
Sbjct  120  PSFMRTFCERHGLAVRAVCLLVDDAAVAFYTSGQHGGRSPAFSSACDGFARVSEVELYGD  179

Query  604  VVLRFISYLSDP--SAVTTFLPGFE--PMDGTASYQDLDYGIRRLDHA  735
            VVLR+ S+ +    +   TFLPG+E  P++   +   L YG++RLDHA
Sbjct  180  VVLRYYSFHAGEKNAKPKTFLPGYEDVPLEPPHT-TPLTYGLQRLDHA  226



>ref|XP_008900422.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETI53874.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P1569]
 gb|ETN14153.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETP23697.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
CJ01A1]
 gb|ETP51702.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P10297]
Length=471

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 126/221 (57%), Gaps = 19/221 (9%)
 Frame = +1

Query  97   VNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPI  276
            V  +  P     KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM  
Sbjct  50   VKENMAPSADDMKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQ  109

Query  277  AAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNA  450
              KSD STGN   ASY++++  GE++ +FTAPYA        A  P         + F  
Sbjct  110  IGKSDQSTGNHVSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVM  167

Query  451  THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLR  615
             HGL VRAV ++V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R
Sbjct  168  KHGLAVRAVGILVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIR  227

Query  616  FIS-YLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            ++S     P     F+PG+E         D+  GI+RLDH 
Sbjct  228  WVSGDFEGP-----FVPGYE----KCECPDVSIGIQRLDHC  259



>ref|XP_008881551.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
 gb|ETV89818.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces invadans]
Length=287

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 123/224 (55%), Gaps = 35/224 (16%)
 Frame = +1

Query  109  STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  288
            STP N   KLVG+++FVR NPKSD F++ +FHH+EF+  DATN ++RF WA G+ + AKS
Sbjct  70   STP-NKKMKLVGYENFVRHNPKSDRFTMHKFHHMEFYTQDATNVSKRFGWAAGLKVVAKS  128

Query  289  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA------  450
            D STGN A+ASY+L++  GEL+   T       +  +           H  FN       
Sbjct  129  DQSTGNHAYASYVLQS--GELKIAIT-------APYSRKNQKEGHVPPHPGFNVDFAHEF  179

Query  451  --THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN-----NQVVLAEVHLYGDVV  609
               HGL VRA+A+ V+D   A+  S   GA  V  P T+         VL+ V  YGDVV
Sbjct  180  CNKHGLAVRAMAISVDDAALAYELSTKHGAVGVCPPKTVKCAKSHTTQVLSSVKFYGDVV  239

Query  610  LRFIS--YLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LRF+S  Y         F PG+E ++G     D+  G+ RLDHA
Sbjct  240  LRFVSGDYKG------RFQPGYEDVEGP----DVSIGLERLDHA  273



>gb|EWM23898.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=525

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 128/230 (56%), Gaps = 34/230 (15%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            +LVG   FVR NPKSD F V  FHHVE +CGDATNT RRF   LGM + AKSDLSTGN  
Sbjct  86   ELVGAAKFVRQNPKSDRFKVLSFHHVEIYCGDATNTYRRFQLGLGMNLVAKSDLSTGNPL  145

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR------SFNAT-------  453
             ASY LR+    LQ +F+APY+ +       +         R       F A+       
Sbjct  146  FASYCLRSQ--RLQMVFSAPYSMNKVAAEEGSSMGKGEIVERRSSPNPGFEASHATQFFN  203

Query  454  -HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL--------NNQVVLAEVHLYGDV  606
             HG+ VRA+ L VED + A+   V+ G + V EPV L        +  +V++EV  YGDV
Sbjct  204  RHGVAVRALGLEVEDARQAYQECVANGGQGVLEPVRLDPSPGLGRDGYLVMSEVQAYGDV  263

Query  607  VLRFISYLSDPSAVTTFLPGFEPMDGTASY-------QDLDYGIRRLDHA  735
            VLRF+S     +   +FLPG++  + +A+Y       + LDYG+ R+DHA
Sbjct  264  VLRFVSRHGGYAG--SFLPGYQE-ETSAAYTTGAKVERSLDYGLERIDHA  310



>gb|ETI53876.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
P1569]
Length=420

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 123/210 (59%), Gaps = 19/210 (9%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  483
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  484  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS-YLSDPSA  645
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S     P  
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVSGDFEGP--  185

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               F+PG+E         D+  GI+RLDH 
Sbjct  186  ---FVPGYE----KCECPDVSIGIQRLDHC  208



>ref|XP_008900424.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETN14155.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
INRA-310]
 gb|ETP23699.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora parasitica 
CJ01A1]
Length=420

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 123/210 (59%), Gaps = 19/210 (9%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  483
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVVQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  484  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS-YLSDPSA  645
            +V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R++S     P  
Sbjct  128  LVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIRWVSGDFEGP--  185

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               F+PG+E         D+  GI+RLDH 
Sbjct  186  ---FVPGYE----KCECPDVSIGIQRLDHC  208



>ref|XP_005854172.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU22183.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana 
CCMP526]
Length=464

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 127/230 (55%), Gaps = 34/230 (15%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            +LVG   FVR NPKSD F V  FHHVE +CGDATNT RRF   LGM + AKSDLSTGN  
Sbjct  86   ELVGAAKFVRQNPKSDRFKVLSFHHVEIYCGDATNTYRRFQLGLGMNLVAKSDLSTGNPL  145

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR------SFNAT-------  453
             ASY LR+    LQ +F+APY+ +       +         R       F A+       
Sbjct  146  FASYCLRSQ--RLQMVFSAPYSMNKVAAEEGSSMGKGEIVERRSSPNPGFEASHATQFFN  203

Query  454  -HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL--------NNQVVLAEVHLYGDV  606
             HG+ VRA+ L VED + A+   V+ G + V EPV L        +  +V++EV  YGDV
Sbjct  204  RHGVAVRALGLEVEDARQAYQECVANGGQGVLEPVRLDPSPGLGRDGYLVMSEVQAYGDV  263

Query  607  VLRFISYLSDPSAVTTFLPGFEPMDGTASY-------QDLDYGIRRLDHA  735
            VLRF+S     +   +FLP ++  + +A+Y       + LDYG+ R+DHA
Sbjct  264  VLRFVSRHGGYAG--SFLPSYQE-ETSAAYTTGAKVERSLDYGLERIDHA  310



>ref|XP_002499380.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60639.1| predicted protein [Micromonas sp. RCC299]
Length=441

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 125/212 (59%), Gaps = 14/212 (7%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            KLVG K+F R NP SD F + RFHHVEFWC DA  TA RF+ ALGM + AKSD++TGNS 
Sbjct  12   KLVGAKNFQRHNPNSDRFPLHRFHHVEFWCHDAITTASRFAVALGMQVVAKSDMTTGNSV  71

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA--------THGLGV  468
            +ASY+LR++  +L F+F+APY       A       +   H  ++          HGL V
Sbjct  72   YASYVLRSN--DLVFVFSAPYGGGEEQTAEDIDKRRANMPHSCYDGENMTRFITKHGLAV  129

Query  469  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV--LAEVHLYGDVVLRFISYLSDPS  642
            +AV +VV+D + A  AS+  GA+  +       +    ++EV LYGDVV+RF+S  S  S
Sbjct  130  KAVGVVVDDAEEAHRASLKHGARNAAYDAGDGTKPAEGISEVELYGDVVMRFVSE-SVVS  188

Query  643  AVTTFLPGFEPMD-GTASYQDLDYGIRRLDHA  735
                 LP +EP+    A  + L YG+RRLDHA
Sbjct  189  RGPFCLPRYEPVPIEPAGSEPLCYGLRRLDHA  220



>ref|XP_009520219.1| hypothetical protein PHYSODRAFT_539872 [Phytophthora sojae]
 gb|EGZ24931.1| hypothetical protein PHYSODRAFT_539872 [Phytophthora sojae]
Length=420

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 129/210 (61%), Gaps = 19/210 (9%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            FKLVG K+F R NP SD F V++FHH+EF+C DATN + RF+W LGM   AKSD STGN 
Sbjct  10   FKLVGNKNFKRHNPMSDRFDVQKFHHIEFFCLDATNVSSRFTWGLGMRQIAKSDQSTGNH  69

Query  310  AHASYLLRASGGELQFLFTapyassisnp--asaaipsfsasaHRSFNATHGLGVRAVAL  483
              ASY++ +  GE++ +FTAPYA        A + IP + A+  + F   HGL VRA+ +
Sbjct  70   VSASYVVES--GEVKLVFTAPYALETEKAPGAVSPIPGYDAAFAQQFVLKHGLAVRALGI  127

Query  484  VVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS-YLSDPSA  645
             V D + A+  SV  GA+ V EP  L ++      V++EV +YGDVV+R++S     P  
Sbjct  128  QVADAKEAYEVSVQNGAEGVLEPQALTDKDSSKATVISEVKIYGDVVIRWVSGDFEGP--  185

Query  646  VTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
               F+PG++ +D      D+  GI+R+DH 
Sbjct  186  ---FVPGYQAVD----RPDMSIGIQRMDHC  208



>ref|XP_002968708.1| hypothetical protein SELMODRAFT_91092 [Selaginella moellendorffii]
 gb|EFJ29824.1| hypothetical protein SELMODRAFT_91092 [Selaginella moellendorffii]
Length=475

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 129/211 (61%), Gaps = 19/211 (9%)
 Frame = +1

Query  76   GKETSSSVNHHSTPENGGFKL--VGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR  249
            G ++S+S   H      G+KL  VG   FVR NP SD F V  FHHVEFWCGDA+NT RR
Sbjct  48   GHQSSASCADHQ-----GYKLGLVGHDKFVRSNPMSDRFGVLGFHHVEFWCGDASNTWRR  102

Query  250  FSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaai--psfs  423
            F+W LGM + AKSD STGN  + SY++  S  EL F FTAPY+S  ++   + +  P FS
Sbjct  103  FAWGLGMHLVAKSDHSTGNHTYCSYVI--SSRELVFAFTAPYSSKKADQELSQMPHPGFS  160

Query  424  asaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEV  588
            +S  R F + HGL VRAV L+VED + AF  SV  GA  V +P  L ++      V++EV
Sbjct  161  SSDARRFFSMHGLAVRAVGLLVEDAEEAFRKSVLGGALAVFQPQELADEATGAKAVISEV  220

Query  589  HLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
             L GDVVLR++S      A   FLP + P++
Sbjct  221  KLLGDVVLRYVSLKGFSGA---FLPNYTPVE  248



>ref|XP_010475412.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Camelina 
sativa]
Length=197

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 113/162 (70%), Gaps = 12/162 (7%)
 Frame = +1

Query  268  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa-----sa  432
            M  +AKSDLSTGN  HASYLL  + G+L+FLFTAPY+ S++        + S       +
Sbjct  1    MRFSAKSDLSTGNMVHASYLL--TSGDLRFLFTAPYSPSLTAGEIKPTATASIPSFDHVS  58

Query  433  HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN-NQVVLAEVHLYGDVV  609
             RSF ++HGLGVRAVA+ VED ++AFS SVS GA P S P+ L+   V +AEV LYGDVV
Sbjct  59   SRSFFSSHGLGVRAVAIEVEDAESAFSVSVSNGAIPSSPPMVLDGGAVTIAEVKLYGDVV  118

Query  610  LRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            LR++SY  D S    FLPGFEP++ T+S+  +DYG+RRLDHA
Sbjct  119  LRYVSYKEDKS---EFLPGFEPVEDTSSFP-VDYGLRRLDHA  156



>gb|ETL47152.1| hypothetical protein L916_03076, partial [Phytophthora parasitica]
Length=237

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 110/183 (60%), Gaps = 9/183 (5%)
 Frame = +1

Query  97   VNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPI  276
            V  +  P     KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM  
Sbjct  50   VKENMAPSADDMKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQ  109

Query  277  AAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNA  450
              KSD STGN   ASY++++  GE++ +FTAPYA        A  P         + F  
Sbjct  110  IGKSDQSTGNHVSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVM  167

Query  451  THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLR  615
             HGL VRAV ++V D +AA+ +SV  G   V +P TL ++       ++EV LYGDVV+R
Sbjct  168  KHGLAVRAVGILVGDAKAAYESSVQNGGVGVLKPHTLTDKESGKTTTVSEVKLYGDVVIR  227

Query  616  FIS  624
            ++S
Sbjct  228  WVS  230



>ref|XP_011402112.1| 4-hydroxyphenylpyruvate dioxygenase [Auxenochlorella protothecoides]
 gb|KFM29063.1| 4-hydroxyphenylpyruvate dioxygenase [Auxenochlorella protothecoides]
Length=973

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 121/208 (58%), Gaps = 16/208 (8%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            KLVG K F R NP +D F + RFHH EF+CGDATNT+RRF   LG+   AKSD  TGN  
Sbjct  546  KLVGAKGFQRHNPLTDKFPIHRFHHFEFYCGDATNTSRRFGLGLGLSQVAKSDQGTGNQK  605

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsfs----asaHRSFNATHGLGVRAVA  480
             ASY++R++  +L F FTAPY  +    +     S        A  +FN  HGLGVRAV 
Sbjct  606  FASYVMRSN--QLIFTFTAPYNGAGGEASGPDAGSPVPWYDVDAAHTFNRNHGLGVRAVG  663

Query  481  LVVEDTQAAFSASVSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVT  651
            +VVED   AF  S + G  PV  P  L +    + ++E+ LYGDVVLRF+S   D S   
Sbjct  664  IVVEDAAEAFRISTANGGIPVQPPTRLADARGSLTVSEIVLYGDVVLRFLS--GDYSG--  719

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            ++LPG+E     A      +GIRR DHA
Sbjct  720  SYLPGYEE---EARPSPRCFGIRRADHA  744



>ref|XP_004368015.1| 4hydroxyphenylpyruvate dioxygenase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25260.1| 4hydroxyphenylpyruvate dioxygenase [Acanthamoeba castellanii 
str. Neff]
Length=420

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 122/208 (59%), Gaps = 12/208 (6%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            KLVG+ +F R NP +D F+VK+FHH+EF+ GDA N +RR++  LGM + AKSD STGN  
Sbjct  5    KLVGYANFKRNNPMTDKFAVKKFHHIEFYSGDALNVSRRWALGLGMALVAKSDQSTGNGT  64

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVE  492
            +ASY++++   +L F      A   S    A     +A A   FN  HG+   AV + VE
Sbjct  65   YASYVMQSHDIKLVFTAPYTTAGDKSQSKIAHPQFDTAKAQAFFNK-HGVAASAVGIEVE  123

Query  493  DTQAAFSASVSRGAKPVSEPVTLNNQ-----VVLAEVHLY--GDVVLRFISYLSDPSAVT  651
            D   A+  +V  GA  ++EP TL N+      V++EV LY  GDV LRFIS+        
Sbjct  124  DAAEAYRIAVENGAVSIAEPATLVNEATGAKTVVSEVLLYTKGDVALRFISF--SEGYDH  181

Query  652  TFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             FLPG+E +  T     L+YGI+R+DHA
Sbjct  182  PFLPGYETV--TDQGPRLNYGIKRIDHA  207



>ref|XP_003078281.1| p-hydroxyphenylpyruvate dioxigenase (ISS) [Ostreococcus tauri]
 emb|CAL53021.1| Glyoxalase/fosfomycin resistance/dioxygenase domain [Ostreococcus 
tauri]
Length=432

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 115/218 (53%), Gaps = 22/218 (10%)
 Frame = +1

Query  127  GFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGN  306
            G KLVG  +FVR NP SD F    F HVEFWCGDATN A RF   LGM + AKSD STGN
Sbjct  7    GRKLVGHANFVRCNPLSDAFECVGFDHVEFWCGDATNAASRFGVGLGMSLRAKSDASTGN  66

Query  307  SAHASYLLRASGGELQFLFTapyassisnpasaaips------fsasaHRSFNATHGLGV  468
              +ASY +++   +L F+FTAPY                        A   F   HGL  
Sbjct  67   GIYASYAMKSH--DLTFVFTAPYGDDERAVGCGGSSVNVPHPGNERGAMMRFFERHGLAA  124

Query  469  RAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQ---------VVLAEVHLYGDVVLRFI  621
            RAV L V D +AA+  ++ RGA+ V EP  + ++          +++EV LYGDVVLRF+
Sbjct  125  RAVGLRVGDARAAYEEAMKRGARGVLEPTEMRHEKHDGCVMGTQIISEVELYGDVVLRFV  184

Query  622  SYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            S          FL  +E    T     + YG+RRLDHA
Sbjct  185  SRADGFDG--DFLCNYEA---TRDVPSVSYGLRRLDHA  217



>ref|XP_001416712.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95005.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=427

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 118/211 (56%), Gaps = 17/211 (8%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            KLVG  +FVR NP SD F  ++F H+EFWCGDATN A RF   LGM +  KSD +TGN  
Sbjct  9    KLVGCANFVRSNPLSDAFECEKFDHIEFWCGDATNAAARFGVGLGMGLRCKSDATTGNGT  68

Query  313  HASYLLRASGGELQFLFTa-pyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
            +ASY ++++  +L F+FTA     S  +   A  P     A   F   HGL  RAV + V
Sbjct  69   YASYAMKSN--DLTFVFTAPYGVESGGSRGEAPHPGHEGRAMMRFFEKHGLAARAVGVRV  126

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQV---------VLAEVHLYGDVVLRFISYLSDPS  642
            +D +AA+  +V RGA+ V  P  L + V         V+AE+ LYGDVVLRF++      
Sbjct  127  KDARAAYEEAVKRGARGVLAPTVLTHTVDDGCAKGGQVIAEIELYGDVVLRFVNATDGFD  186

Query  643  AVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                FL  +     T    D+ YG++RLDHA
Sbjct  187  G--DFLCNYS---ATRDAPDVSYGLQRLDHA  212



>ref|XP_009825872.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
 gb|ETV84180.1| 4-hydroxyphenylpyruvate dioxygenase [Aphanomyces astaci]
Length=475

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 117/215 (54%), Gaps = 29/215 (13%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG+++FVR NPK+D F++ +FHH+EF+  DATN ++RF WA G+ + AKSD STGN 
Sbjct  65   MKLVGYENFVRHNPKTDRFTMHKFHHIEFYTQDATNVSKRFGWAAGLKLVAKSDQSTGNH  124

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA--------THGLG  465
            A+ASY+L++  G+L+   T                      H  FN          HGL 
Sbjct  125  AYASYVLQS--GDLKIAIT------APYSRKNQKDGGHVPPHPGFNVDYAHEFCNKHGLA  176

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVVLRFISYL  630
            VRA+A+ V+D   A+  S   GA  V  P T+ +       V++ V LYGDVVLRF+S  
Sbjct  177  VRAMAISVDDAALAYELSTKHGAVGVCPPKTIKDAATHTTQVISSVKLYGDVVLRFVS--  234

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                    F PG+  ++G     D+  G+ RLDHA
Sbjct  235  --GDYKGRFQPGYHDVEGP----DVGIGLDRLDHA  263



>gb|ACN36372.1| unknown [Zea mays]
Length=426

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 125/201 (62%), Gaps = 25/201 (12%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            F+LVG ++FVR NP+SD F    FHHVE WC DA + A RFS+ LG P+AA+SDLSTGNS
Sbjct  25   FRLVGHRNFVRFNPRSDRFHTLAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTGNS  84

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
            AHAS LLR+      F       +  ++ A+AA+PSFSA+A R F A HGL VRAVAL V
Sbjct  85   AHASLLLRSGSLSFLF---TAPYAHGADAATAALPSFSAAAARRFAADHGLAVRAVALRV  141

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
             D + AF     RG +             LAEV LYGDVVLR++SY  D +A   FLPGF
Sbjct  142  ADAEDAF-----RGFR-------------LAEVELYGDVVLRYVSY-PDGAAGEPFLPGF  182

Query  670  EPMDGTASYQDLDYGIRRLDH  732
            E   G AS    DYG+ R DH
Sbjct  183  E---GVASPGAADYGLSRFDH  200



>ref|XP_005850767.1| hypothetical protein CHLNCDRAFT_20078 [Chlorella variabilis]
 gb|EFN58665.1| hypothetical protein CHLNCDRAFT_20078 [Chlorella variabilis]
Length=446

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 124/215 (58%), Gaps = 23/215 (11%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARR---------FSWALGMPIAAK  285
            KLVG+  F R NP+SD F + +FHHVEFWCGDAT T+ R         F + LG+ + AK
Sbjct  22   KLVGYDGFQRHNPRSDRFPMHKFHHVEFWCGDATTTSCRQARPPEAPMFGYGLGLTLVAK  81

Query  286  SDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLG  465
            SD STGN  +ASY++++  G+L   FTAPY++      S+   ++   A  +F   HG+ 
Sbjct  82   SDQSTGNHHYASYVMQS--GDLVMAFTAPYSTQTDKSGSSPPAAYDQDAAYAFLKKHGMA  139

Query  466  VRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYL  630
            VRA  ++V+D   A+  + + G   V+ P T  +      +  +EV LYGD VLRF+S  
Sbjct  140  VRAFGILVDDAAEAYRIATAHGGVGVAPPTTRTDAASGTSLTWSEVQLYGDCVLRFVSGD  199

Query  631  SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             +      F+PG++P++       + YG++RLDHA
Sbjct  200  YE----GAFIPGYQPVEDAPQ---VSYGLQRLDHA  227



>ref|XP_002902379.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
 gb|EEY56305.1| 4-hydroxyphenylpyruvate dioxygenase [Phytophthora infestans T30-4]
Length=335

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 111/195 (57%), Gaps = 19/195 (10%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            +D F V +FHH+EF+C DATN +RRF+W LGM    KSD STGN   ASY++++  GE++
Sbjct  2    TDRFDVHKFHHIEFYCADATNASRRFAWGLGMAQIGKSDQSTGNHVSASYVIQS--GEVK  59

Query  355  FLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVALVVEDTQAAFSASVSR  528
             +FTAPYA        A            + F   HGL VRAV ++V D +AA+  SV  
Sbjct  60   LVFTAPYALETEKAPDAVSSISGYDPEFAQKFVMKHGLAVRAVGILVGDAKAAYELSVQN  119

Query  529  GAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFIS-YLSDPSAVTTFLPGFEPMDGTA  690
            G   V EP TL ++       ++EV LYGDVV+R++S     P     F+PG+E  +   
Sbjct  120  GGVGVVEPQTLTDKESGKTTTVSEVKLYGDVVIRWVSGDFEGP-----FVPGYEKCECP-  173

Query  691  SYQDLDYGIRRLDHA  735
               D+  GI+RLDH 
Sbjct  174  ---DVSIGIQRLDHC  185



>gb|EAZ21880.1| hypothetical protein OsJ_05532 [Oryza sativa Japonica Group]
Length=447

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 119/210 (57%), Gaps = 12/210 (6%)
 Frame = +1

Query  118  ENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDL-  294
            EN GF+LVG + FVR NP+SD F    FHHVE WC DA + A RF++ALG   AA+  + 
Sbjct  22   ENAGFRLVGHRRFVRANPRSDRFQALAFHHVELWCADAASAAGRFAFALGR--AARRQVR  79

Query  295  ----STGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGL  462
                 T  +  +S     S         A  AS+     +A+IPSFS  A R F A HGL
Sbjct  80   PLHGGTPRTPPSSSAPPPSRSSSPPPTAATTASATDAATTASIPSFSPGAARRFAADHGL  139

Query  463  GVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPS  642
             V AVAL V D   AF ASV+ GA+P  +P  L     LAEV LYGDVVLRF+S+     
Sbjct  140  AVHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEVELYGDVVLRFVSHPD--G  197

Query  643  AVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            A   FLPGFE   G ++   +DYG+RR DH
Sbjct  198  ADAPFLPGFE---GVSNPGAVDYGLRRFDH  224



>gb|EWM22210.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=439

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 129/229 (56%), Gaps = 39/229 (17%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            +LVG K FVR NP SD F +KRFHH+EF+CGDATNT+RRFSW LG+   AKSD STGN  
Sbjct  24   ELVGHKRFVRHNPLSDRFEMKRFHHLEFYCGDATNTSRRFSWGLGLSQVAKSDNSTGNPL  83

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsf------------sasaHRSFNAT-  453
            +ASY+L++   EL F+FTAPYAS+  + + AA  S             + S H +F+++ 
Sbjct  84   YASYVLQSQ--ELVFVFTAPYASTPPSSSVAAALSQPSHRIAEASPSLAPSPHPAFDSSM  141

Query  454  -------HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV-----LAEVHLY  597
                   HGL VRA+ + V D   A+ A ++ G K V  P  L +        +AEV  Y
Sbjct  142  AMGFFGRHGLAVRAIGIEVHDASQAYEACLAHGGKGVLAPQILKDTATGQVKWIAEVLAY  201

Query  598  ----GDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
                 +VVLRF+S   D      FLP ++          L YG++R+DH
Sbjct  202  PGNDAEVVLRFVSGDFD----GPFLPNYQ----ETPIPPLSYGLQRIDH  242



>gb|EWM22209.1| 4-hydroxyphenylpyruvate dioxygenase [Nannochloropsis gaditana]
Length=458

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 129/229 (56%), Gaps = 39/229 (17%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            +LVG K FVR NP SD F +KRFHH+EF+CGDATNT+RRFSW LG+   AKSD STGN  
Sbjct  24   ELVGHKRFVRHNPLSDRFEMKRFHHLEFYCGDATNTSRRFSWGLGLSQVAKSDNSTGNPL  83

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsf------------sasaHRSFNAT-  453
            +ASY+L++   EL F+FTAPYAS+  + + AA  S             + S H +F+++ 
Sbjct  84   YASYVLQSQ--ELVFVFTAPYASTPPSSSVAAALSQPSHRIAEASPSLAPSPHPAFDSSM  141

Query  454  -------HGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVV-----LAEVHLY  597
                   HGL VRA+ + V D   A+ A ++ G K V  P  L +        +AEV  Y
Sbjct  142  AMGFFGRHGLAVRAIGIEVHDASQAYEACLAHGGKGVLAPQILKDTATGQVKWIAEVLAY  201

Query  598  ----GDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
                 +VVLRF+S   D      FLP ++          L YG++R+DH
Sbjct  202  PGNDAEVVLRFVSGDFD----GPFLPNYQ----ETPIPPLSYGLQRIDH  242



>ref|XP_002990594.1| hypothetical protein SELMODRAFT_161008 [Selaginella moellendorffii]
 gb|EFJ08226.1| hypothetical protein SELMODRAFT_161008 [Selaginella moellendorffii]
Length=399

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 111/176 (63%), Gaps = 12/176 (7%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            SD F V  FHHVEFWCGDA+NT RRF+W LGM + AKSD STGN  + SY++  S  EL 
Sbjct  2    SDRFGVLGFHHVEFWCGDASNTWRRFAWGLGMHLVAKSDHSTGNHTYCSYVI--SSRELV  59

Query  355  FLFTapyassisnpasaai--psfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSR  528
            F FTAPY+S  ++   + +  P FS+S  R F + HGL VRAV L+VED + AF  SV  
Sbjct  60   FAFTAPYSSKKADQELSQMPHPGFSSSDARRFFSMHGLAVRAVGLLVEDAEEAFRKSVLG  119

Query  529  GAKPVSEPVTLNNQ-----VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
            GA  V +P  L ++      V+AEV L GDVVLR+IS      A   FLP + P++
Sbjct  120  GALAVFQPQELTDEATGTKAVIAEVKLLGDVVLRYISLKGFSGA---FLPNYTPVE  172



>gb|KDD74142.1| hypothetical protein H632_c1538p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=362

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 121/207 (58%), Gaps = 15/207 (7%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSA  312
            +LVG K F R NP +D F + +F H EF+C DATN ++RF + +GM + AKSD  TGN  
Sbjct  15   QLVGHKVFKRNNPMTDRFPMHKFLHFEFYCQDATNVSKRFGYGMGMTMVAKSDQGTGNHT  74

Query  313  HASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH-RSFNATHGLGVRAVALVV  489
            +ASY+++++  E+ F FTAPY  S +   S     +   A   +F A HGL VRAV + V
Sbjct  75   YASYVMKSN--EVVFTFTAPYGLSTNKSDSQPPLPYFDCAQAHAFVADHGLAVRAVGVAV  132

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDVVLRFISYLSDPSAVTT  654
            +D   AF  +   GA  +  PV L +     ++ ++EV LYGDV LRF+S   D   V  
Sbjct  133  DDAAEAFRIATENGAVAMQSPVVLEDASGAGKLTVSEVKLYGDVALRFVS--GDYHGV--  188

Query  655  FLPGFEPMDGTASYQDLDYGIRRLDHA  735
            ++PG+E    T      ++G++R+DHA
Sbjct  189  YMPGYE---ATPEAPVQNFGLQRVDHA  212



>ref|XP_002307562.2| hypothetical protein POPTR_0005s22680g [Populus trichocarpa]
 gb|EEE94558.2| hypothetical protein POPTR_0005s22680g [Populus trichocarpa]
Length=254

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 105/221 (48%), Gaps = 68/221 (31%)
 Frame = +1

Query  73   MGKETSSSVNHHSTPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRF  252
            MGKE  +S     TP  G FKLVGF +FVR N +SD F V RFHHVEFWC DATNTAR  
Sbjct  1    MGKENETS----ETP--GEFKLVGFSNFVRTNSRSDLFKVNRFHHVEFWCSDATNTARP-  53

Query  253  SWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasa  432
            S  + +   A + + T N                                          
Sbjct  54   SMDVNLSHTATASIPTFNHETC--------------------------------------  75

Query  433  HRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVL  612
             R+F+A HGL VRA+A+ V+D + AF+ SV+ GAKP + P+ L+N  V+ E         
Sbjct  76   -RNFSAKHGLAVRAIAIEVDDAELAFTTSVAHGAKPSASPILLDNGAVITE---------  125

Query  613  RFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
                     S    FLP FE +    S   LDYGIRRLDHA
Sbjct  126  ---------SPDNWFLPKFEAV----SSFPLDYGIRRLDHA  153



>ref|XP_003575746.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Brachypodium 
distachyon]
Length=493

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 114/193 (59%), Gaps = 10/193 (5%)
 Frame = +1

Query  178  DHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS--GGEL  351
            +   V  FHH EFWC DA + A RFS  LG+P+AA+SDLS GN+ HAS+LLR+S  G  +
Sbjct  82   NRLRVIDFHHAEFWCADAASAAARFSSGLGVPVAARSDLSMGNTVHASHLLRSSSPGSSI  141

Query  352  QFLFTapyassisnpasaaipsfsasaHRSFNATH-----GLGVRAVALVVEDTQAAFSA  516
              LFTAPYA + S+ +S++  S   S              GL VR VA+ V D   A+ A
Sbjct  142  ALLFTAPYADAASSSSSSSSSSTVPSFSADAARAFTAAHGGLAVRTVAVRVADAAEAYHA  201

Query  517  SVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASY  696
            SV  GA+P   PV L +  + AEV LYGD VLRF+SY  D      FLPGFE +  ++S 
Sbjct  202  SVEAGARPAFAPVDLGHGFLFAEVELYGDSVLRFVSYPDDTE--VPFLPGFENLVSSSSK  259

Query  697  -QDLDYGIRRLDH  732
              + DYG+ R DH
Sbjct  260  ASEEDYGLTRFDH  272



>ref|XP_007048969.1| Phytoene desaturation 1, putative [Theobroma cacao]
 gb|EOX93126.1| Phytoene desaturation 1, putative [Theobroma cacao]
Length=422

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 104/166 (63%), Gaps = 16/166 (10%)
 Frame = +1

Query  274  IAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsa------saH  435
            I  +   STGN A ASYL+R+  GE  FLFTAPY+ SI+   + +  + ++      +  
Sbjct  84   IGCQVRPSTGNMAQASYLIRS--GECNFLFTAPYSLSIAQAENLSPTATASIPTFDHAIC  141

Query  436  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLR  615
            R+F A+HGL  RA+ + VED + AF  SVS GAKP S P  L+NQ VLAEV L+GDVVLR
Sbjct  142  RAFVASHGLAPRAIFVEVEDAETAFFISVSHGAKPSSPPTVLDNQAVLAEVFLFGDVVLR  201

Query  616  FISYL-------SDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            +IS+        +D    T FLP FE M+ T SY  LDYGIRRLDH
Sbjct  202  YISFKNSDHESPNDDENCTWFLPRFEKMEDTLSY-PLDYGIRRLDH  246



>gb|ETK93728.1| hypothetical protein L915_03107, partial [Phytophthora parasitica]
Length=146

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVAL  483
              ASY++++  GE++ +FTAPYA        A  P         + F   HGL VRAV +
Sbjct  70   VSASYVIQS--GEVKLVFTAPYALETEKAPDAVSPIPGYDPEFAQKFVMKHGLAVRAVGI  127

Query  484  VVEDTQAAFSASVSRG  531
            +V D +AA+ +SV  G
Sbjct  128  LVGDAKAAYESSVQNG  143



>ref|XP_008881550.1| hypothetical protein H310_15345 [Aphanomyces invadans]
 gb|ETV89817.1| hypothetical protein H310_15345 [Aphanomyces invadans]
Length=238

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 91/159 (57%), Gaps = 18/159 (11%)
 Frame = +1

Query  109  STPENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKS  288
            STP N   KLVG+++FVR NPKSD F++ +FHH+EF+  DATN ++RF WA G+ + AKS
Sbjct  70   STP-NKKMKLVGYENFVRHNPKSDRFTMHKFHHIEFYTQDATNVSKRFGWAAGLKVVAKS  128

Query  289  DLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNA------  450
            D STGN A+ASY+L++  GEL+   T       +  +           H  FN       
Sbjct  129  DQSTGNHAYASYVLQS--GELKIAIT-------APYSRKNQKEGHVPPHPGFNVDFAHEF  179

Query  451  --THGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL  561
               HGL VRA+A+ V+D   A+  S   GA  V  P T+
Sbjct  180  CNKHGLAVRAMAISVDDAALAYELSTKHGAVGVCPPKTV  218



>ref|XP_007511204.1| 4-hydroxyphenylpyruvate dioxygenase [Bathycoccus prasinos]
 emb|CCO66764.1| 4-hydroxyphenylpyruvate dioxygenase [Bathycoccus prasinos]
Length=466

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 113/230 (49%), Gaps = 31/230 (13%)
 Frame = +1

Query  133  KLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSD-LSTGNS  309
            KLVG+ +F R NP+SD F V RFH +EF+C DA  TA RF+ ALGM +   SD  +TGN 
Sbjct  15   KLVGYSNFKRANPRSDLFPVTRFHSIEFFCQDAKTTANRFAIALGMNVIGLSDQTTTGNV  74

Query  310  AHASYLLRASGGELQFLFT----------------apyassisnpasaaipsfsasaHRS  441
             + SY ++++  EL F+FT                     ++S+  +        +  + 
Sbjct  75   IYNSYAMKSN--ELVFVFTAPVMTEEKGYGRDLEGEKEEKNVSDDETTKAIEEEKALAKQ  132

Query  442  FNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNN-----QVVLAEVHLYGDV  606
            F   HGL V+ V + V D + A++ S   G   V  P TL N     +  +AEV LYGDV
Sbjct  133  FVEKHGLAVKRVCVRVNDCKEAYAVSTKNGGVSVRAPRTLRNRKDGREATVAEVALYGDV  192

Query  607  VLRFISYLS---DPSAVTTFLP----GFEPMDGTASYQDLDYGIRRLDHA  735
             LRF+   +   D      +L       E  + +   +  +YG++RLDH 
Sbjct  193  ELRFVEDATTHLDDDETYRYLDYDAVEQEQEEQSCKSEKRNYGLKRLDHC  242



>gb|ERN14876.1| hypothetical protein AMTR_s00032p00156270 [Amborella trichopoda]
Length=144

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +1

Query  121  NGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLST  300
            NGG KLVGFK+FVR NPK+D     +FHH+EFWC DATNT+ RF  AL MP+ AKSDLST
Sbjct  5    NGGLKLVGFKNFVRSNPKTDRIPPTKFHHIEFWCSDATNTSGRFQNALLMPLNAKSDLST  64

Query  301  GNSAHASYLLRASGGELQFLFT  366
            GNS ++SY+LR+   +L F FT
Sbjct  65   GNSVYSSYVLRSH--DLIFAFT  84



>gb|AET00342.2| 4-hydroxyphenylpyruvate dioxygenase [Medicago truncatula]
Length=314

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 102/160 (64%), Gaps = 19/160 (12%)
 Frame = +1

Query  268  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRS--  441
            MPI AKSDLSTG   HASYLLR+  G+L  LF+A Y+ SIS  + +   S  + +  +  
Sbjct  1    MPIVAKSDLSTGILTHASYLLRS--GDLNLLFSAAYSPSISLSSPSPTASIPSFSAPACF  58

Query  442  -FNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRF  618
             F+A+HGL VRAVA+ V++ + AF+ SV+ GA P S  V LNN+V L+EV L+GDVVLR+
Sbjct  59   AFSASHGLSVRAVAVEVDNAELAFTTSVNHGAVPSSPAVVLNNRVKLSEVRLFGDVVLRY  118

Query  619  ISY-LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            ISY   + +    FLP             +D+GIRRLDHA
Sbjct  119  ISYNNPNQNQNLLFLP-------------VDFGIRRLDHA  145



>gb|EEC72567.1| hypothetical protein OsI_06005 [Oryza sativa Indica Group]
Length=601

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 98/163 (60%), Gaps = 12/163 (7%)
 Frame = +1

Query  256  WALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsas--  429
            W +G+ +  +SDLSTGNSAHAS LLR++   + FLFTAPY       A AA  +   S  
Sbjct  224  W-MGICVMDRSDLSTGNSAHASLLLRSA--SVAFLFTAPYGGDHGVGADAATTASIPSFS  280

Query  430  --aHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGD  603
              A R F A HGL V AVAL V D   AF ASV+ GA+P  +P  L     LAEV LYGD
Sbjct  281  PGAARRFAADHGLAVHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEVELYGD  340

Query  604  VVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            VVLRF+S+     A   FLPGFE   G ++   +DYG+RR DH
Sbjct  341  VVLRFVSHPD--GADAPFLPGFE---GVSNPGAVDYGLRRFDH  378



>ref|XP_002287272.1| 4-hydroxyphenylpyruvate dioxygenase [Thalassiosira pseudonana 
CCMP1335]
 gb|EED94715.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Thalassiosira pseudonana 
CCMP1335]
Length=418

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 99/193 (51%), Gaps = 17/193 (9%)
 Frame = +1

Query  199  FHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapya  378
            FHH+EF+  DA  TA+RF  ALG+PI   S L+TGN    +Y L   G + + + T    
Sbjct  1    FHHIEFFASDALTTAKRFELALGLPITCWSSLATGNDVCVTYGLE--GMQTRKIETDNAN  58

Query  379  ssisnpasaaips------fsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKP  540
             +    ++  + +      +       F + HGL VRAV + V+D   A++ +V  GA  
Sbjct  59   KNGGAGSNVQMTAPLPLPGYDIDKAHEFYSKHGLAVRAVGVEVKDATVAYANAVENGATG  118

Query  541  VSEPVTLNN--------QVVLAEVHLYGDVVLRFISYLSDPSA-VTTFLPGFEPMDGTAS  693
            V EP  + N        +  +AEV LYGDVVLR +S+  D SA  +TFLP   P    ++
Sbjct  119  VLEPTIVENFNSDGDSQKCHMAEVELYGDVVLRLVSFHGDCSAEQSTFLPHLSPYPSNSN  178

Query  694  YQDLDYGIRRLDH  732
                 YG+ RLDH
Sbjct  179  KNKPTYGLARLDH  191



>emb|CBJ28697.1| 4-hydroxyphenylpyruvate dioxygenase, plastid precursor [Ectocarpus 
siliculosus]
Length=516

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 78/240 (33%), Positives = 116/240 (48%), Gaps = 53/240 (22%)
 Frame = +1

Query  160  RVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS  339
            + N  +D F +K+FHHVEF+CGDAT  A RF W LGM + AKSD STGN+ HASY+++++
Sbjct  35   KENTGTDLFRMKKFHHVEFYCGDATAAASRFVWGLGMKLVAKSDQSTGNAQHASYVVQSN  94

Query  340  GGELQFLFTapyassisnpasaaipsfsasaHR---------------------SFNATH  456
              +L+F+ TAPY+ + +             + R                      F   H
Sbjct  95   --DLRFVCTAPYSLATTPTTEGGAGDRRDPSSRVVDVGESGGSPLPGFDPAAAHEFFRRH  152

Query  457  GLGVRAVALVVEDTQAAFSASV----SRGAKP-VSEPVTLNN-----QVVLAEVHLYGDV  606
            GL  RA+ + VED   A+   +    S G+   V  P  + +     +  ++EV  YGDV
Sbjct  153  GLAGRAIGIEVEDAAHAYEQCIEHCGSDGSNASVRRPTRVTDVDGRGRATISEVRAYGDV  212

Query  607  VLRFISYLSDPSAV------------------TTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            VLRFIS+  +   V                    FLP F  ++G  + +  D+G++R DH
Sbjct  213  VLRFISFEPESKMVGEGDIGGAKGGGDGGRFEGAFLPNFVDIEGEEARE--DFGLQRADH  270



>ref|XP_008360256.1| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxyphenylpyruvate dioxygenase-like 
[Malus domestica]
Length=347

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 75/105 (71%), Gaps = 8/105 (8%)
 Frame = +1

Query  436  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLR  615
            R+F+AT GL VRAVA+ VEDT +AF+ASV+ G KP + P  +NN+V +AEV LYGDV+LR
Sbjct  79   RTFSATQGLSVRAVAIQVEDTISAFTASVAHGTKPSAAPNLVNNRVTIAEVQLYGDVILR  138

Query  616  FISY-----LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            ++SY      +DP     FLPGFE +  T+S+  +D+ IR LDHA
Sbjct  139  YVSYTNHNHFTDPDLHLWFLPGFESL--TSSFP-IDFEIRHLDHA  180



>ref|XP_002895668.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
 ref|XP_002901242.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
 gb|EEY55147.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
 gb|EEY59228.1| 4-hydroxyphenylpyruvate dioxygenase, putative [Phytophthora infestans 
T30-4]
Length=175

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 4/134 (3%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            +D F V +FHH++F+C DATN +RRF+W LGM    KSD STGN   ASY++++  GE++
Sbjct  2    TDRFDVHKFHHIKFYCADATNASRRFAWGLGMAQIGKSDQSTGNHVSASYVIQS--GEVK  59

Query  355  FLFTapyassisnpasaaipsfsasaH--RSFNATHGLGVRAVALVVEDTQAAFSASVSR  528
             +FTAPYA        A            + F   HGL VRAV ++V D +AA+  SV  
Sbjct  60   LVFTAPYALETEKAPDAVSSISGYDPEFAQMFVMKHGLAVRAVGILVGDAKAAYELSVQN  119

Query  529  GAKPVSEPVTLNNQ  570
            G   V EP TL ++
Sbjct  120  GGVGVVEPQTLTDK  133



>ref|XP_008390582.1| PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like [Malus domestica]
Length=361

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 75/104 (72%), Gaps = 8/104 (8%)
 Frame = +1

Query  439  SFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLRF  618
            +F+ATHGLG+RAVA+ VEDT +AF ASV+   KP + P+ ++N+V + EV LYGDV+LR+
Sbjct  97   TFSATHGLGIRAVAIQVEDTVSAFIASVAHDTKPSAAPIIVDNRVTITEVQLYGDVILRY  156

Query  619  ISY-----LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +SY     L++P     FLPGF+ +  T+S+  +++GIR  DHA
Sbjct  157  VSYTDHNHLTEPDLHLWFLPGFKSL--TSSFP-INFGIRHFDHA  197



>dbj|BAJ93624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 2/68 (3%)
 Frame = +1

Query  157  VRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  336
            VR NP+SD F    FHHVEFWC DA + A RF++ALG P+AA+SDLSTGNSAHAS LLR+
Sbjct  28   VRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLRS  87

Query  337  SGGELQFL  360
              G L FL
Sbjct  88   --GSLAFL  93



>gb|ETP51665.1| hypothetical protein F442_03207, partial [Phytophthora parasitica 
P10297]
Length=74

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  130  FKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
             KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD STGN 
Sbjct  10   MKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSDQSTGNH  69

Query  310  AHASY  324
              ASY
Sbjct  70   VSASY  74



>ref|XP_005852430.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Nannochloropsis 
gaditana CCMP526]
 gb|EKU23402.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Nannochloropsis 
gaditana CCMP526]
Length=200

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 22/142 (15%)
 Frame = +1

Query  187  SVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFT  366
            ++KRFHH+EF+CGDATNT+RRFSW LG+   AKSD STGN  +ASY+L++   EL F+FT
Sbjct  9    NMKRFHHLEFYCGDATNTSRRFSWGLGLSQVAKSDNSTGNPLYASYVLQSQ--ELVFVFT  66

Query  367  apyassisnpasaaipsf------------sasaHRSFNAT--------HGLGVRAVALV  486
            APYAS+  + + AA  S             + S H +F+++        HGL VRA+ + 
Sbjct  67   APYASTPPSSSVAAALSQPSHRIAEASPSLAPSPHPAFDSSMAMGFFGRHGLAVRAIGIE  126

Query  487  VEDTQAAFSASVSRGAKPVSEP  552
            V D   A+ A ++ G K V  P
Sbjct  127  VHDASQAYEACLAHGGKGVLAP  148



>gb|EJK75816.1| hypothetical protein THAOC_02448 [Thalassiosira oceanica]
Length=508

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 73/222 (33%), Positives = 104/222 (47%), Gaps = 47/222 (21%)
 Frame = +1

Query  199  FHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA---------SGGEL  351
            FHHVEF+ GDA  TA+RF  ALG+PI   S L+TGN    +Y L           SG  +
Sbjct  80   FHHVEFYTGDALMTAKRFELALGVPITCWSSLATGNDVCVTYGLECGIDYNSDTESGHGV  139

Query  352  QFLFTapyassisnpasaaipsfsasaHR------------------SFNATHGLGVRAV  477
            +FL TAP + ++    + A  + +                        F + HGL VRAV
Sbjct  140  RFLITAPLSRAMQKVNNDAPSAPTGVPSNVQMTAPLPLPGYSIEGAHEFYSKHGLAVRAV  199

Query  478  ALVVEDTQAAFSASVSRGAKPVSEPVTL--------NNQVVLAEVHLYGDVVLRFISYLS  633
             + V+D + A+ A++  GA  V  P  +          +  +AEV LYGDVVLRF+S+  
Sbjct  200  GVEVQDAKEAYEAALRNGAHGVLPPTDIPTNYEGQFTGECQMAEVKLYGDVVLRFVSFGD  259

Query  634  DPSAVTT-------FLPGFEPMDGTASYQDL--DYGIRRLDH  732
            +             FLP   P     SY+    +YG++R+DH
Sbjct  260  EHCEQKARDGIPEPFLPHLAPY---PSYKPTRPNYGLKRIDH  298



>gb|EDL65287.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. SG-1]
Length=378

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 92/190 (48%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   ++E++ G+A   A  F  A G  I A S L TGN    SY+L+ +  +++
Sbjct  20   EDFFPVRDVDYLEYYTGNAKQAAHYFCTAFGFKIVAYSGLETGNRETVSYVLQQN--KVR  77

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             L T     S                  SF   HG G++ +ALVV+D + A+S +VSRGA
Sbjct  78   MLVTGSLTESSRVA--------------SFVKKHGDGIKDIALVVDDVEKAYSEAVSRGA  123

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P+TL   N  +  A +  YGD +   +    D   V  F+PGFE M+    ++D 
Sbjct  124  IEITPPMTLSDDNGTIKKAIIGTYGDTIHTLVER-KDYKGV--FMPGFEAMEMKIPFKDA  180

Query  706  DYGIRRLDHA  735
              GI  +DH 
Sbjct  181  --GIIAVDHV  188



>ref|WP_044022537.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. SG-1]
Length=373

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 92/190 (48%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   ++E++ G+A   A  F  A G  I A S L TGN    SY+L+ +  +++
Sbjct  15   EDFFPVRDVDYLEYYTGNAKQAAHYFCTAFGFKIVAYSGLETGNRETVSYVLQQN--KVR  72

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             L T     S                  SF   HG G++ +ALVV+D + A+S +VSRGA
Sbjct  73   MLVTGSLTESSRVA--------------SFVKKHGDGIKDIALVVDDVEKAYSEAVSRGA  118

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P+TL   N  +  A +  YGD +   +    D   V  F+PGFE M+    ++D 
Sbjct  119  IEITPPMTLSDDNGTIKKAIIGTYGDTIHTLVER-KDYKGV--FMPGFEAMEMKIPFKDA  175

Query  706  DYGIRRLDHA  735
              GI  +DH 
Sbjct  176  --GIIAVDHV  183



>gb|ETM53453.1| hypothetical protein L914_03077, partial [Phytophthora parasitica]
Length=61

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  115  PENGGFKLVGFKDFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSD  291
            P     KLVG K+FVR NP +D F V +FHH+EF+C DATN ARRF+W LGM    KSD
Sbjct  3    PSADDMKLVGCKNFVRHNPMTDRFDVHKFHHIEFYCADATNVARRFAWGLGMGQIGKSD  61



>ref|XP_001694722.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
 gb|EDP02306.1| 4-hydroxyphenylpyruvate dioxygenase [Chlamydomonas reinhardtii]
Length=372

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 91/162 (56%), Gaps = 15/162 (9%)
 Frame = +1

Query  268  MPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHR-SF  444
            MP+ AKSD ST N   ASY+LR++  +L F FTAPY+   ++ +           H   F
Sbjct  1    MPLVAKSDQSTNNQLFASYVLRSN--DLVFTFTAPYSRKCASVSEGVPLRHYNIDHAYEF  58

Query  445  NATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQV-----VLAEVHLYGDVV  609
              +HGL VRAV L+V+D + A+  SV+ GAK V  PV L ++      V++EV +YGDVV
Sbjct  59   INSHGLAVRAVGLLVDDAKTAYEVSVAHGAKGVLPPVELRDEASGTSQVISEVIVYGDVV  118

Query  610  LRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
             R++S     S    F+ G+ P+  +        G++R+DHA
Sbjct  119  FRYVS----GSFEGPFMAGYTPVTDSPV---ASIGLQRVDHA  153



>ref|WP_020060738.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. 123MFChir2]
Length=372

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 92/189 (49%), Gaps = 24/189 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  T+   + A G  IAA S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQTSYYLARAFGFSIAAYSGLETGNRDKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +    ++                   F   HG GV+ VAL+VED + A++ +V RGA
Sbjct  72   FVVSGALNTNSRIA--------------EFVKQHGDGVKDVALLVEDVEKAYAEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L+++   +  A +  YGD +   +   +   A   F+PG+EP++    +++ 
Sbjct  118  VAIAPPEVLSDEHGTLKKAVIGTYGDTIHTLVERKNYKGA---FMPGYEPLESIVPFEET  174

Query  706  DYGIRRLDH  732
              G+  +DH
Sbjct  175  --GLVAVDH  181



>gb|AIF24945.1| 4-hydroxyphenylpyruvate dioxygenase (HPD, hppD) [uncultured marine 
group II/III euryarchaeote SAT1000_41_C12]
Length=362

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 89/191 (47%), Gaps = 30/191 (16%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D   +K  HH+EFW G+A   A  +  A G    A S L TGN   ASY+L    G+++
Sbjct  3    KDPVPLKAVHHLEFWVGNAKQAAYFYRTAFGFNQIAYSGLETGNRERASYVLEQ--GKIR  60

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             +F+ P  S+                       HG GV+ +A  V+D +A + A ++RGA
Sbjct  61   LMFSTPLNSNNRISEHI--------------KLHGDGVKDIAFHVDDAKACYEACITRGA  106

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFE--PMDGTASYQ  699
            K   EP  +   N  V  A ++ YG+ +  FISY +D      FLP F+   ++G     
Sbjct  107  KSAKEPEVISDDNGSVTQAAIYTYGETIHSFISY-NDYDG--PFLPEFQEKKVEGNT---  160

Query  700  DLDYGIRRLDH  732
                G+R LDH
Sbjct  161  ---VGLRFLDH  168



>ref|WP_035350816.1| 4-hydroxyphenylpyruvate dioxygenase [Edaphobacter aggregans]
Length=374

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 87/173 (50%), Gaps = 26/173 (15%)
 Frame = +1

Query  166  NPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGG  345
             P +D   +K   HVEF+ G+A  +A  +  A GM + A S   TG+   ASY+L+   G
Sbjct  10   TPAADFLPLKGTDHVEFYVGNARQSAYFYCAAFGMTLVAYSGPETGHRDRASYVLQQ--G  67

Query  346  ELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVS  525
            +++F+ T                      H+     HG GVRA+AL V+D + A+  + S
Sbjct  68   KVRFVLTTALRPDSEIAQHV---------HK-----HGDGVRAIALWVDDARQAWRETTS  113

Query  526  RGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFI--SYLSDPSAVTTFLPGF  669
            RGA+ + EP  L++   QVV + +  YGD +  F+  ++ + P     FLPGF
Sbjct  114  RGARSIQEPTELSDEHGQVVTSSIAAYGDTIHTFVERTHYTGP-----FLPGF  161



>ref|WP_027987430.1| 4-hydroxyphenylpyruvate dioxygenase [delta proteobacterium JGI 
0002000-E07]
Length=357

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 92/188 (49%), Gaps = 30/188 (16%)
 Frame = +1

Query  184  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  363
              +K  HHVE + G+A  +A  +  A G    A S L TGN   ASY+L  + G+++F+ 
Sbjct  1    MKLKSVHHVELYAGNAKQSAWFYRKAFGFSQIAYSGLETGNRTAASYVL--AQGKIRFVI  58

Query  364  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  543
            T+P                           HG GV  +AL+VED   AF+ +V RGAKP 
Sbjct  59   TSPLTPHHPGAEHIR--------------RHGDGVCDIALLVEDADFAFAEAVRRGAKPA  104

Query  544  SEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFE--PMDGTASYQDLD  708
             +P  ++++   V  A +H+YGD +  F+SY     A   FLPG++  P+ G       D
Sbjct  105  IDPHDVHDEHGSVRRAAIHIYGDTIHTFLSYKDYKGA---FLPGYQAAPVPGE------D  155

Query  709  YGIRRLDH  732
             G+  +DH
Sbjct  156  GGLLVVDH  163



>gb|EMT08063.1| 4-hydroxyphenylpyruvate dioxygenase [Aegilops tauschii]
Length=343

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = +1

Query  436  RSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLNNQVVLAEVHLYGDVVLR  615
            R F A +GL VRA+A+ V D   AFSASV  GA+P      L +  V+A+V L GD VLR
Sbjct  67   RRFTADYGLAVRALAIRVADAAEAFSASVDAGARPTE----LGHDFVMAKVELLGDAVLR  122

Query  616  FISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            F+SY  D + V TF+PGFE     AS   LD+G+ R DH
Sbjct  123  FVSY-PDGTDV-TFIPGFE---SVASSGSLDFGLTRFDH  156



>gb|AJD92913.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus sp. D5]
Length=373

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 86/201 (43%), Gaps = 26/201 (13%)
 Frame = +1

Query  148  KDFVRVNPK--SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHAS  321
            KD   V  +   D F V+ FHH+E + G+A  +A  F  A G  I A   L TG+    S
Sbjct  3    KDVTEVTQEMVEDIFPVESFHHLELYVGNAKQSAYYFCHAFGFEIKAYRGLETGSRERVS  62

Query  322  YLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQ  501
            Y+L    G ++ + T    +                    F   HG G + + L V D  
Sbjct  63   YVLEQ--GVIRLVITGSLTNETDIA--------------EFVKLHGEGTKDIGLEVSDID  106

Query  502  AAFSASVSRGAKPVSEPVT---LNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFE  672
             A+  +V RG   + EP T    N  V  A +  YGDV+   +  +    A   FLPG+E
Sbjct  107  KAYYGAVERGGTGIREPWTEKDENGTVKKAIIGTYGDVIHTLVENVDYEGA---FLPGYE  163

Query  673  PMDGTASYQDLDYGIRRLDHA  735
            P DG +  + +  G+  +DH 
Sbjct  164  PYDGPSKSKSI--GLVGIDHV  182



>ref|WP_039814073.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus sp. D5]
Length=362

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 82/190 (43%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+ FHH+E + G+A  +A  F  A G  I A   L TG+    SY+L    G ++
Sbjct  3    EDIFPVESFHHLELYVGNAKQSAYYFCHAFGFEIKAYRGLETGSRERVSYVLEQ--GVIR  60

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             + T    +                    F   HG G + + L V D   A+  +V RG 
Sbjct  61   LVITGSLTNETDIA--------------EFVKLHGEGTKDIGLEVSDIDKAYYGAVERGG  106

Query  535  KPVSEPVT---LNNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              + EP T    N  V  A +  YGDV+   +  +    A   FLPG+EP DG +  + +
Sbjct  107  TGIREPWTEKDENGTVKKAIIGTYGDVIHTLVENVDYEGA---FLPGYEPYDGPSKSKSI  163

Query  706  DYGIRRLDHA  735
              G+  +DH 
Sbjct  164  --GLVGIDHV  171



>ref|WP_035432465.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. UNC322MFChir4.1]
Length=372

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 90/189 (48%), Gaps = 24/189 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  T+   + A G  IAA S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQTSYYLARAFGFSIAAYSGLETGNRDKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +    ++                   F   HG GV+ VAL+VED + A++ +V RGA
Sbjct  72   FVVSGALNTNSRIA--------------EFVKQHGDGVKDVALLVEDVEKAYTEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L+++   +  A +  YGD +   +   +   A   F+PG+EP   T   ++ 
Sbjct  118  VAIAPPEELSDEHGTLKKAVIGTYGDTIHTLVERKNYKGA---FMPGYEPFTSTVPVEET  174

Query  706  DYGIRRLDH  732
              G+  +DH
Sbjct  175  --GLVAVDH  181



>ref|WP_026951577.1| 4-hydroxyphenylpyruvate dioxygenase [Algoriphagus mannitolivorans]
Length=364

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 93/190 (49%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D   +    H+E + G+A  +A  + +A G  + A S   TG    ASY+L+    +++
Sbjct  3    EDFLPINGTDHIELYVGNAKQSALYYQYAFGFELIAYSGPETGVKDRASYVLKQD--KIR  60

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             + T+P +++                       HG GV+ +AL V+D + ++  + SRGA
Sbjct  61   LILTSPLSANHPIAEHI--------------QKHGDGVKVLALWVDDAEKSWKETTSRGA  106

Query  535  KPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
            K  SEP T  +   +V +A +H YGD +  F+    + S V  FLPGF+P    +SY+  
Sbjct  107  KSASEPKTFQDEHGEVKMASIHTYGDTIHTFVE-RKNYSGV--FLPGFKPK--KSSYKAE  161

Query  706  DYGIRRLDHA  735
              G++ +DH 
Sbjct  162  PIGLKYIDHC  171



>gb|KIZ04447.1| 4-hydroxyphenylpyruvate dioxygenase [Monoraphidium neglectum]
Length=341

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +1

Query  172  KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  351
            + D F V  FHH+EFW  DATNT++RF   LGM +AAKSD STGNS  ASY LR+  G++
Sbjct  37   RRDRFCVHGFHHLEFWTADATNTSKRFQHGLGMSLAAKSDYSTGNSQCASYALRS--GDV  94

Query  352  QFLFT  366
             F+FT
Sbjct  95   LFVFT  99



>ref|WP_019037466.1| 4-hydroxyphenylpyruvate dioxygenase [Psychroflexus tropicus]
Length=379

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 93/195 (48%), Gaps = 25/195 (13%)
 Frame = +1

Query  160  RVNPKSDHF-SVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  336
            +VNPK++ F  +     VE + G+A   A  +  A G    A + L TG     SY+L+ 
Sbjct  12   KVNPKAEDFLPILGTDFVELYVGNAKQAAYYYQTAWGFQPVAYAGLETGKKDTTSYVLQQ  71

Query  337  SGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSA  516
              G+++ + T+P +                       + HG GV+ V+L V+D   +F  
Sbjct  72   --GKIRLVLTSPMSKGGDLNRHI--------------SEHGDGVKFVSLWVDDATKSFEE  115

Query  517  SVSRGAKPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGT  687
            +V RGA+P +EP T+   N + V++ +H YG+ +  FI           FLPG++    T
Sbjct  116  TVKRGARPYAEPYTIKDDNGKAVISGIHTYGETIHLFI---ERKDYAGPFLPGYKAW--T  170

Query  688  ASYQDLDYGIRRLDH  732
              YQ  D G++ +DH
Sbjct  171  KPYQTEDVGLKYIDH  185



>ref|WP_041057061.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus campisalis]
 gb|KIL47474.1| 4-hydroxyphenylpyruvate dioxygenase [Jeotgalibacillus campisalis]
Length=371

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            +D F VK   ++E + G+A  +A  F  A G  + A S L TGN    SY+L+ +  +++
Sbjct  13   NDFFPVKEVDYLEIYTGNAKQSAHFFCTAFGFKMVAYSGLETGNRETVSYVLQQN--KVR  70

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             + T     S                  +F   HG GVR +AL +++ ++A+  +VSRGA
Sbjct  71   LVITGSLTDSSDVA--------------AFVKKHGDGVRDIALTMDNVESAYKEAVSRGA  116

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              + +P  + +Q   V  A +  YGD +   +           FLPGFEP + +   +D 
Sbjct  117  IEIKKPFEVEDQYGIVKKAIIGTYGDTIHTMVERTGYKG---IFLPGFEPYESSVPVKDA  173

Query  706  DYGIRRLDHA  735
              GI  +DH 
Sbjct  174  --GIVAVDHV  181



>ref|WP_012793017.1| 4-hydroxyphenylpyruvate dioxygenase [Chitinophaga pinensis]
 gb|ACU62849.1| 4-hydroxyphenylpyruvate dioxygenase [Chitinophaga pinensis DSM 
2588]
Length=378

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 87/180 (48%), Gaps = 24/180 (13%)
 Frame = +1

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            +VEF+ G+A   A  +  A G    A +   TG    ASY+L  +  +L+F+ T P    
Sbjct  27   YVEFYVGNAKQAAHYYKTAFGFQSLAYAGPETGVKDRASYVLVQN--KLRFVLTTPLNPD  84

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  564
                                   HG GV+ +AL V+D +AAF  +V RGAKP  EPVT  
Sbjct  85   NEIAQHIL--------------EHGDGVKVIALWVDDARAAFEETVKRGAKPYLEPVTEE  130

Query  565  NQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            ++   VV + +H+YGD V  F+      +    FLPG++  +   +YQ  D G++ +DH 
Sbjct  131  DEFGAVVRSGIHIYGDTVHLFV---ERKNYNGPFLPGYKAWN--PAYQPTDTGLQYVDHC  185



>ref|WP_009334741.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus]
 gb|EFV75864.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. 2_A_57_CT2]
Length=371

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 89/197 (45%), Gaps = 24/197 (12%)
 Frame = +1

Query  154  FVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLR  333
             +R   K+D F VK   ++E + G+A  +   F  A G    A S L TGN    SY+L+
Sbjct  6    MLREQKKADFFPVKEVDYLEIYSGNAKQSCHYFCTAFGFKPVAYSGLETGNRETVSYVLQ  65

Query  334  ASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFS  513
                +++ + T     S                  +F   HG GV+ +AL V+D + A++
Sbjct  66   QR--KIRLVITGTLNDSSRVS--------------NFIKKHGDGVKDIALAVDDVETAYN  109

Query  514  ASVSRGAKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDG  684
            A+V RGA  +  P  + ++   V  A +  YGD +   +   +D   V  F+PGFEP   
Sbjct  110  AAVERGAIEIQPPFEIKDEHGTVKKAVIGTYGDTIHTLVE-RNDYKGV--FMPGFEPYQT  166

Query  685  TASYQDLDYGIRRLDHA  735
               ++D   G   +DH 
Sbjct  167  EVPFEDA--GFIGIDHV  181



>ref|WP_012930763.1| 4-hydroxyphenylpyruvate dioxygenase [Spirosoma linguale]
 gb|ADB42279.1| 4-hydroxyphenylpyruvate dioxygenase [Spirosoma linguale DSM 74]
Length=377

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 90/179 (50%), Gaps = 24/179 (13%)
 Frame = +1

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            ++E + G+A  +A  F  A G    A + L+TG     SYL++   G+++ + T+P    
Sbjct  26   YLELYVGNARQSAHYFQTAFGFQPVAHAGLATGLRDRESYLVQQ--GKIRLVLTSPLHGD  83

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  564
                             R  +  HG GVR VAL V+D + AF  +  RGAKP  EPV   
Sbjct  84   SEIG-------------RHIDQ-HGDGVRVVALWVDDARKAFDETTKRGAKPYMEPVREQ  129

Query  565  NQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDH  732
            +    VV + +H+YGD V  F+   +D + V  FLPG++P + T  Y+  D G+  +DH
Sbjct  130  DDTGYVVRSGIHIYGDTVHVFVE-RNDYTGV--FLPGYQPWNPT--YRPADVGLNYVDH  183



>ref|WP_018620037.1| 4-hydroxyphenylpyruvate dioxygenase [Spirosoma luteum]
Length=374

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 91/197 (46%), Gaps = 24/197 (12%)
 Frame = +1

Query  151  DFVRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLL  330
            + V+     D   +    ++E + G+A  +A  F  A G    A + L+TG     SY++
Sbjct  5    ELVKSETGQDFLPLNGTDYIELYVGNARQSAHYFQTAFGFQPVAHAGLATGLRDRESYVV  64

Query  331  RASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAF  510
            +   G+++ + T+P                           HG GVR VAL V+D + AF
Sbjct  65   QQ--GKIRLVLTSPLHGDTEIGNHLD--------------QHGDGVRVVALWVDDARRAF  108

Query  511  SASVSRGAKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
              +VSRGA P   P    +    VV + +H YGD V  F+   ++ S V  FLPG+EP  
Sbjct  109  DETVSRGANPYMHPTREQDDHGYVVRSGIHTYGDTVHVFVE-RTEYSGV--FLPGYEPW-  164

Query  682  GTASYQDLDYGIRRLDH  732
             T  YQ  D G++ +DH
Sbjct  165  -TPMYQPTDAGLKYVDH  180



>ref|WP_026581629.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. J33]
Length=371

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 86/196 (44%), Gaps = 24/196 (12%)
 Frame = +1

Query  157  VRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  336
            ++V    D F VK   ++E + G+A  +   F  A G    A S L TGN    SY+L+ 
Sbjct  7    LKVQKTEDFFPVKEVDYLEIYSGNAKQSCHYFCTAFGFKPVAYSGLETGNRETVSYVLQQ  66

Query  337  SGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSA  516
               +++ + T     S                   F   HG GV+ +AL V+D + A+ A
Sbjct  67   R--KIRLVITGTLTDSSRVS--------------GFINKHGDGVKDIALTVDDVEKAYQA  110

Query  517  SVSRGAKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGT  687
            +VSRGA  +  P  + ++   V  A +  YGD +   I      +    FLPG+EP +  
Sbjct  111  AVSRGAIEIQPPYEMKDEHGIVKKAVIGTYGDTIHTLI---ERNNYKGVFLPGYEPYETN  167

Query  688  ASYQDLDYGIRRLDHA  735
              ++D   G   +DH 
Sbjct  168  VPFEDA--GFIGIDHV  181



>ref|WP_002115481.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ56242.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG6X1-2]
Length=372

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 90/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++  F+ A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHIEFYVGNAKQSSYYFARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_028785141.1| 4-hydroxyphenylpyruvate dioxygenase [Thalassobacillus devorans]
Length=373

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 85/190 (45%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F VK   ++E++ G+A   A  F  A G    A S L TGN    SY+L+    +++
Sbjct  15   EDFFPVKEVDYLEYYTGNAKQAAHFFCTAFGFEPVAYSGLETGNRETVSYVLQQR--KVR  72

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             + T     S                   F   HG GV+ VAL V+D   A+  +VSRGA
Sbjct  73   IVVTGTLTESSRVA--------------EFTKKHGDGVKDVALTVDDVDKAYKEAVSRGA  118

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P T++++   V  A +  YGD +   +    D   V  F+PGF P D    +Q  
Sbjct  119  IEITPPFTIDDEYGPVKKAVIGTYGDTIHTLVE-RKDYKGV--FMPGFLPADFEIPHQST  175

Query  706  DYGIRRLDHA  735
              GI  +DH 
Sbjct  176  --GIAAIDHV  183



>ref|WP_020602511.1| 4-hydroxyphenylpyruvate dioxygenase [Spirosoma spitsbergense]
Length=378

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  172  KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  351
            + D   +    ++E + G+A  +A  F  A G    A + L+TG     SY+++   G++
Sbjct  16   RQDFLPLNGTDYIELYVGNARQSAHYFQTAFGFQPVAHAGLATGLRDRESYVVQQ--GKI  73

Query  352  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  531
            + + T+P                    H      HG GVR VAL V+D + AF  ++SRG
Sbjct  74   RLVLTSPLHGDTEIGD-----------HLDL---HGDGVRVVALWVDDARQAFDETISRG  119

Query  532  AKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQD  702
            A P   P    +    VV + +H YGD V  F+      +    FLPG+EP   T SYQ 
Sbjct  120  ANPYMHPTQEQDDHGYVVRSGIHTYGDTVHVFVER---AAYSGVFLPGYEPW--TPSYQP  174

Query  703  LDYGIRRLDH  732
             D G++ +DH
Sbjct  175  ADAGLKYVDH  184



>gb|ABI53728.2| 4-hydroxyphenylpyruvate dioxygenase [uncultured bacterium]
Length=375

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 76/168 (45%), Gaps = 22/168 (13%)
 Frame = +1

Query  184  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  363
              +K+ HHVEF+ G+A      +  A G   AA S L TGN    SYL+R +   + F+ 
Sbjct  12   LGLKKIHHVEFYVGNAKQAEFYYRKAFGFSRAAYSGLETGNRETTSYLIRQNN--VNFVL  69

Query  364  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  543
            T P +                         HG GVR +A +V+D   AF+ +V RGA+  
Sbjct  70   TTPLSPDHPAAEHI--------------KQHGDGVRDIAFLVDDADHAFNEAVKRGARVA  115

Query  544  SEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVT---TFLPGF  669
             EP  L   N  V  A +  YGD +  FISY +  +       FLPGF
Sbjct  116  VEPRDLKDDNGSVRHAAIATYGDTIHSFISYNNSHNGHNYSGPFLPGF  163



>ref|WP_033694710.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Bacillus thuringiensis]
Length=371

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_000810915.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|AIE77850.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|KFM92484.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 4342]
 gb|AJH73133.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 4342]
Length=372

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_034756925.1| 4-hydroxyphenylpyruvate dioxygenase [Chryseobacterium sp. OV259]
Length=376

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 84/180 (47%), Gaps = 24/180 (13%)
 Frame = +1

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            ++EF+ G+A   A  +  A G    A +   TG    ASY+L+   G+++ + T    S 
Sbjct  24   YIEFYVGNAKQAAHYYKTAFGFQSVAYAGPETGVRDRASYVLQQ--GKIRLILTTGLKSD  81

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  564
                                  THG GV+ +AL V+D  AAF  +  RG KP  EPVTL 
Sbjct  82   SPISEHV--------------KTHGDGVKILALWVDDAYAAFEETTKRGGKPYLEPVTLT  127

Query  565  N---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +   +V ++ ++ YG+ V  FI      +    F+PG+E  + T  YQ  D G+  +DH 
Sbjct  128  DEHGEVRMSGIYTYGETVHMFI---ERKNYTGPFMPGYEKWEST--YQPEDAGLLYVDHC  182



>ref|WP_000810916.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ39449.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG5X2-1]
 gb|EJS63351.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2X1-2]
 gb|EJV56473.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG6X1-1]
Length=372

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQQVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>gb|EEK86219.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 4342]
 gb|EEM24586.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
tochigiensis BGSC 4Y1]
Length=389

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  31   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  88

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  89   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  134

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  135  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  189

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  190  ESGLIAVDHV  199



>gb|EEK69629.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MM3]
 gb|EEL84061.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH1271]
Length=385

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQQVEFNIPFE--  185

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  186  ESGLIAVDHV  195



>ref|WP_001975475.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EAL14217.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus G9241]
 gb|KDB41847.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AIY74588.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AJG92647.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AJI05457.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus G9241]
Length=372

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +                     F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSGDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>gb|AHM63488.1| 4-hydroxyphenylpyruvate dioxygenase [Flammeovirgaceae bacterium 
311]
Length=364

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 96/191 (50%), Gaps = 24/191 (13%)
 Frame = +1

Query  172  KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  351
            + D   +    H+EFW G+A  +A  +  ALG  + A +   TG    ASY+L+ +  +L
Sbjct  2    EQDFLPINGTDHIEFWVGNAKQSAMYYMAALGFELVAYAGPETGLRDRASYVLQQN--KL  59

Query  352  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  531
            +F+ T            +++   +  A   +N  HG GV+ +AL V+D + +F  +VSRG
Sbjct  60   RFVLT------------SSLQPDTEIAKHVYN--HGDGVKVLALWVDDAERSFKETVSRG  105

Query  532  AKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQD  702
            A+    P  L +   +VV++ +  YG+ + +F+   +   A   FLPG+ P    +SY  
Sbjct  106  AEAAMTPERLKDEQGEVVISAIKTYGETIHKFVERKNYKGA---FLPGYVPK--KSSYPV  160

Query  703  LDYGIRRLDHA  735
               G++ +DH 
Sbjct  161  KPIGLKYVDHC  171



>gb|KIW05916.1| 4-hydroxyphenylpyruvate dioxygenase [Verruconis gallopava]
Length=425

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 85/174 (49%), Gaps = 12/174 (7%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            S   + K +HH+ +W G+A   A  +    G    AKSDL+TG+   AS+++  + G ++
Sbjct  38   SSQPTYKGYHHITWWVGNAKQAASYYITRFGFRPVAKSDLTTGSRTVASHVV--ASGNIK  95

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+F +P  +S                       HG  V+ VA  V D +A +  +++RGA
Sbjct  96   FVFQSPILASNPRRGGLKKEDKLLEDMYESLEQHGDAVKDVAFEVNDVRAVYEGAIARGA  155

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISY--LSDPSAVTTFLPGFEPMD  681
            + V EP T+ ++   V +A V  YGD    F+     + P     FLPGF+P+D
Sbjct  156  EGVREPWTVKDEFGAVTMASVKTYGDTTHTFVERDGYNGP-----FLPGFKPVD  204



>ref|WP_016089597.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EOP03960.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2O-3]
 gb|EOQ18488.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus B5-2]
 gb|EOQ35092.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG3O-1]
Length=372

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 90/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPVELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_009054081.1| 4-hydroxyphenylpyruvate dioxygenase [Nitritalea halalkaliphila]
 gb|EIM77556.1| 4-hydroxyphenylpyruvate dioxygenase [Nitritalea halalkaliphila 
LW7]
Length=364

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 90/191 (47%), Gaps = 24/191 (13%)
 Frame = +1

Query  172  KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  351
            + D   +    +VEF+ G+A  +A  + +A G  + A +   TG    ASY+L+    ++
Sbjct  2    EQDFLPINGTDYVEFYVGNAKQSALYYQYAFGYELIAYAGPETGVKDRASYVLKQD--KI  59

Query  352  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  531
            + + T    +                       THG GV+ +AL V+D + +F  +  RG
Sbjct  60   RLVLTTALQAEHPIAEHV--------------KTHGDGVKVLALWVDDARKSFEETTKRG  105

Query  532  AKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQD  702
            AK   EP  L +   +VV++ +H YG+ V  F+   S+ S +  FLPG+ P   T  Y+ 
Sbjct  106  AKAYQEPTVLQDEHGEVVISGIHTYGETVHLFVE-RSNYSGI--FLPGYVPRQST--YKP  160

Query  703  LDYGIRRLDHA  735
               G++ +DH 
Sbjct  161  EPIGLKYIDHC  171



>ref|WP_019122205.1| 4-hydroxyphenylpyruvate dioxygenase [Brevibacillus massiliensis]
Length=362

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 74/172 (43%), Gaps = 22/172 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            +D F +K + HVEF+ G+A       + A G    A S L TG+    SY+L+ +   L 
Sbjct  3    TDFFPIKDWDHVEFYVGNAKQAMHYLTKAFGFKATAYSGLETGSREMVSYVLKQN--HLT  60

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +                         F   HG GV+ +AL VED   AF  +VSRGA
Sbjct  61   FVVSGALVPEHPIA--------------EFVREHGEGVKDIALTVEDCDKAFREAVSRGA  106

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
             PV EP   ++Q   V  A +  YGD V    S +        F PGF   D
Sbjct  107  VPVMEPTEYSDQHGTVKKATIRTYGDTVH---SLIERKQYTGPFFPGFVSYD  155



>dbj|BAH39165.1| 4-hydroxyphenylpyruvate dioxygenase [Gemmatimonas aurantiaca 
T-27]
Length=374

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 91/195 (47%), Gaps = 24/195 (12%)
 Frame = +1

Query  160  RVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS  339
             +  + D F +    +VEF+ G+A   +  +  A G  + A     TG    ASYL++  
Sbjct  8    EIGTEQDAFPINGTDYVEFYVGNAKQASHYYRAAFGYSLVAYRGPETGVRDRASYLMQQ-  66

Query  340  GGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSAS  519
             G+++ + T    +                 HR     HG GVR  AL V+D + A+  +
Sbjct  67   -GKIRLVLTTSITADTPIAEHV---------HR-----HGDGVRDYALWVDDARLAYETA  111

Query  520  VSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTA  690
            ++RGA P+ EP   ++   +VV+A +  YGD +    S +   +    FLPGF+ +  T 
Sbjct  112  IARGAIPIQEPQVYSDEHGEVVIAAIGTYGDTIH---SLVERRNYNGVFLPGFKAV--TP  166

Query  691  SYQDLDYGIRRLDHA  735
             YQ  D G++ +DH 
Sbjct  167  HYQPSDVGLKYIDHC  181



>ref|WP_011522806.1| 4-hydroxyphenylpyruvate dioxygenase [Candidatus Koribacter versatilis]
 gb|ABF41005.1| 4-hydroxyphenylpyruvate dioxygenase [Candidatus Koribacter versatilis 
Ellin345]
Length=361

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 82/186 (44%), Gaps = 26/186 (14%)
 Frame = +1

Query  184  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  363
              +K+ HHVEFW G+A   A  +    G    A   L TG+   ASY+L+ +  +  F+ 
Sbjct  5    LKLKKIHHVEFWVGNAKQAAYYYRKGFGFNQLAYRGLETGSRDVASYVLQQN--KCNFVL  62

Query  364  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  543
            T                             HG GV+ +AL VED   AF  +V RGAK V
Sbjct  63   TTAINPEHPAADHVR--------------RHGDGVKDIALHVEDADFAFEEAVKRGAKAV  108

Query  544  SEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYG  714
             EP  + +    V  A VH YG+ +  FISY    +    FLPGF+    +A     + G
Sbjct  109  FEPKDVIDNYGTVRWAAVHTYGETIHSFISY---KNYGGPFLPGFQ----SAIVPGEETG  161

Query  715  IRRLDH  732
            I  +DH
Sbjct  162  ILLVDH  167



>ref|WP_018479076.1| 4-hydroxyphenylpyruvate dioxygenase [Pontibacter roseus]
Length=364

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 86/180 (48%), Gaps = 24/180 (13%)
 Frame = +1

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            H+EF+ G+A   A  +  A G  + A +   TG    ASY+++    +++ + T     +
Sbjct  13   HIEFYVGNAKQAAHFYQTAFGFKLVAYAGPETGVRDRASYVVQQE--KIRLVLTTSLDPN  70

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  564
                                   HG GV+ +AL V+D +A+F  +V RGAKP  EP TL 
Sbjct  71   SDIAQHVH--------------LHGDGVKVLALWVDDAEASFRGTVERGAKPALEPKTLT  116

Query  565  N---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +   +V +A +H YGD +  F+    + S V  F+PG+EP       + +  G++ +DH 
Sbjct  117  DEHGEVKVASIHTYGDTIHTFVER-RNYSGV--FMPGYEPRQSLLEVEPV--GLKYVDHC  171



>ref|WP_007921180.1| 4-hydroxyphenylpyruvate dioxygenase [Ktedonobacter racemifer]
 gb|EFH82795.1| 4-hydroxyphenylpyruvate dioxygenase [Ktedonobacter racemifer 
DSM 44963]
Length=367

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 88/191 (46%), Gaps = 22/191 (12%)
 Frame = +1

Query  172  KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  351
            + D   ++ F ++E + GDA +T+  FS A G    A + L TG   H SY+L    G +
Sbjct  3    EQDFMPIQNFDYIEMYVGDARHTSYYFSQAWGFVPVAYAGLETGVRDHTSYVLEQ--GNI  60

Query  352  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  531
            + + TAP +                         HG GV+ VA  VE+ + A+  + SRG
Sbjct  61   RLVITAPLSPEGEIAEHVH--------------LHGDGVKDVAFRVENAEQAYREATSRG  106

Query  532  AKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQD  702
            A+ V EP    +    V LA +  YGD +  F+    D   +  FLPGF+P++   S + 
Sbjct  107  AQGVLEPTERRDNYGSVKLAAIKTYGDTIHTFVER-QDYKGI--FLPGFKPLESNQSRRA  163

Query  703  LDYGIRRLDHA  735
               G+  +DH 
Sbjct  164  RPAGLAGIDHV  174



>ref|WP_043930760.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. EB01]
Length=371

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 86/189 (46%), Gaps = 24/189 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   ++E + G+A   A  F  A G    A S L TGN    SY+L+    +++
Sbjct  13   EDFFPVRDVDYMEIYTGNAKQAAYFFCKAFGFRTVAYSGLETGNRQTVSYVLQQR--KIR  70

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             + T  Y  +                  SF   HG GV+ +AL+V+D + AF A+V RGA
Sbjct  71   LVITGSYDENSDVA--------------SFVKKHGDGVKDIALLVDDVEKAFGAAVDRGA  116

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              +  P  LN++   V  A +  YGD V   I       A   FLPGF+    T + Q  
Sbjct  117  IALEAPTVLNDEFGTVKKAVIGTYGDTVHSLIERQDYKGA---FLPGFDRF--TDTVQVP  171

Query  706  DYGIRRLDH  732
            D G+  +DH
Sbjct  172  DAGLIAVDH  180



>ref|WP_041266432.1| 4-hydroxyphenylpyruvate dioxygenase [Gemmatimonas aurantiaca]
Length=366

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 90/191 (47%), Gaps = 24/191 (13%)
 Frame = +1

Query  172  KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  351
            + D F +    +VEF+ G+A   +  +  A G  + A     TG    ASYL++   G++
Sbjct  4    EQDAFPINGTDYVEFYVGNAKQASHYYRAAFGYSLVAYRGPETGVRDRASYLMQQ--GKI  61

Query  352  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  531
            + + T    +                 HR     HG GVR  AL V+D + A+  +++RG
Sbjct  62   RLVLTTSITADTPIAEHV---------HR-----HGDGVRDYALWVDDARLAYETAIARG  107

Query  532  AKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQD  702
            A P+ EP   ++   +VV+A +  YGD +    S +   +    FLPGF+ +  T  YQ 
Sbjct  108  AIPIQEPQVYSDEHGEVVIAAIGTYGDTIH---SLVERRNYNGVFLPGFKAV--TPHYQP  162

Query  703  LDYGIRRLDHA  735
             D G++ +DH 
Sbjct  163  SDVGLKYIDHC  173



>ref|WP_034761020.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus vietnamensis]
Length=371

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 83/187 (44%), Gaps = 24/187 (13%)
 Frame = +1

Query  184  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  363
            F V+   ++E++ G+A   A  F  A G    A S L TGN    SY+L+ +  +++ L 
Sbjct  16   FPVRDVDYLEYYTGNAKQAAHFFCTAFGFKTVAYSGLETGNRDTVSYVLQQN--KVRLLI  73

Query  364  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  543
            T                         F   HG G++ +ALVV+D + A+S +V RGA  +
Sbjct  74   TGSLHEGSRVS--------------QFVKKHGDGIKDIALVVDDIEKAYSGAVERGAIEI  119

Query  544  SEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYG  714
              P TL   N  V  A +  YGD +   +    D   +  F+PGFE  D     +D   G
Sbjct  120  MPPSTLEDDNGTVKKAVIGTYGDTIHTLVER-KDYKGI--FMPGFEKYDTVLKNEDA--G  174

Query  715  IRRLDHA  735
            I  +DH 
Sbjct  175  IIAVDHV  181



>ref|WP_038414892.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=371

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 88/189 (47%), Gaps = 24/189 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  172

Query  706  DYGIRRLDH  732
            + G+  +DH
Sbjct  173  ESGLIAVDH  181



>ref|WP_000810913.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 ref|NP_842794.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Ames]
 ref|YP_026511.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Sterne]
 ref|YP_034568.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
konkukian str. 97-27]
 gb|AAP24280.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Ames]
 gb|AAS39196.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ATCC 10987]
 gb|AAT29321.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
'Ames Ancestor']
 gb|AAT52562.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Sterne]
 gb|AAT61344.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
konkukian str. 97-27]
 gb|AAU20018.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus E33L]
 gb|EDR18205.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0488]
 gb|EDR87062.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0193]
 gb|EDR93230.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0442]
 gb|EDS96130.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0389]
 gb|EDT19033.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0465]
 gb|EDT66480.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0174]
 gb|EDV15418.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Tsiankovskii-I]
 gb|EDX55333.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus W]
 gb|EDX61593.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB108]
 gb|EDX66616.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus NVH0597-99]
 gb|EDZ56110.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus H3081.97]
 gb|ACJ77205.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH187]
 gb|ACK91608.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AH820]
 gb|ACM10759.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Q1]
 gb|ACO29802.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB102]
 gb|ACP14951.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
CDC 684]
 gb|ACQ48677.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A0248]
 gb|ADK03036.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus biovar anthracis 
str. CI]
 gb|ADY19499.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
finitimus YBT-020]
 dbj|BAL16024.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus NC7401]
 gb|AEW53459.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus F837/76]
 gb|EJP84191.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus IS075]
 gb|EJP97338.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus AND1407]
 gb|EJQ89793.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus ISP3191]
 gb|EJR04636.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MSX-A12]
 gb|EJR10798.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MSX-D12]
 gb|EJR45949.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD102]
 gb|AFQ09250.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus FRI-35]
 gb|EJT17712.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
UR-1]
 gb|EJY89136.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
BF1]
 gb|EOO91640.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus IS845/00]
 gb|EOO97721.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus IS195]
 gb|AHE81666.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A16R]
 gb|AHE87585.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
A16]
 dbj|GAE95744.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis CZC5]
 gb|EVT94759.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis 8903-G]
 gb|EVU00623.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis 9080-G]
 gb|EVU07353.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis 52-G]
 gb|AHK36414.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
SVA11]
 gb|EXJ22173.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
95014]
 gb|AIF54723.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KEY91929.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Carbosap]
 gb|KFJ83554.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AIK33094.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AIK56777.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AIK64954.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Vollum]
 gb|AIK52764.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KFK76181.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|KFL76766.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KFL80543.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KFL86061.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|KGZ43021.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ52713.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ54706.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ60952.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ64652.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ65585.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ76649.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ80211.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ90236.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ90981.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KGZ96990.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA06012.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA11873.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA11984.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA16035.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA31764.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA31801.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA36204.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHA39131.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHG47433.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHG58166.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|KHG58290.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJA84730.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJF88079.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG27196.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG45707.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Turkey32]
 gb|AJG51749.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB102]
 gb|AJG56882.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus D17]
 gb|AJG64551.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG73240.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG74673.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJG82863.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJG87144.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH28712.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH32893.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH38811.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH47932.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
Sterne]
 gb|AJH51070.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH59928.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJH99617.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
V770-NP-1R]
 gb|AJH66759.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJI10714.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 03BB108]
 gb|AJH88550.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJI29185.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus E33L]
 gb|AJH95416.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJI31852.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJI37788.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
 gb|AJM79009.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=372

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 88/189 (47%), Gaps = 24/189 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  172

Query  706  DYGIRRLDH  732
            + G+  +DH
Sbjct  173  ESGLIAVDH  181



>ref|WP_000810914.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|AJH63292.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|AJH83337.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
 gb|AJK33581.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
Length=372

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_045688974.1| 4-hydroxyphenylpyruvate dioxygenase [Hymenobacter sp. AT01-02]
Length=377

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 81/174 (47%), Gaps = 22/174 (13%)
 Frame = +1

Query  157  VRVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRA  336
            V+ +P  D   +    ++EF+ G+A  +A  +  A G  + A +   TG    ASY+L+ 
Sbjct  9    VQAHPSQDFLPLNGTDYIEFYVGNAKQSAYYYQAAFGFELVAYAGPETGVRDRASYVLQQ  68

Query  337  SGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSA  516
            +  +++F+ T                           A HG GV+ +AL V+D + +F  
Sbjct  69   N--KIRFVLTTSLLPDSDITRHV--------------AQHGDGVKVMALWVDDARKSFEE  112

Query  517  SVSRGAKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF  669
            +  RGAKP  EP TL +Q   V LA ++ YG+ +  F+       A   FLPGF
Sbjct  113  TTKRGAKPAFEPYTLEDQHGSVTLAGIYTYGETIHTFVERSQYSGA---FLPGF  163



>ref|WP_044339125.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus aquimaris]
Length=371

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 88/187 (47%), Gaps = 24/187 (13%)
 Frame = +1

Query  184  FSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLF  363
            F V+   ++E++ G+A   A  F  A G    A S L TGN    SY+L+ +  +++ + 
Sbjct  16   FPVRDVDYLEYYTGNAKQAAHFFCTAFGFKTVAYSGLETGNRDTVSYVLQQN--KVRLVI  73

Query  364  TapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPV  543
            T                         F   HG G++ +ALVV+D + A++ +VSRGA  +
Sbjct  74   TGSLHEGSRVS--------------QFVKHHGDGIKDIALVVDDVEKAYTGAVSRGAIEI  119

Query  544  SEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYG  714
              P TL   N ++  A +  YGD +   +    D   +  F+PGFE  D  ++ ++ D G
Sbjct  120  MSPSTLEDDNGKLKKAIIGTYGDTIHTLVE-RKDYKGI--FMPGFEKYD--SALKNEDAG  174

Query  715  IRRLDHA  735
            I  +DH 
Sbjct  175  IIAVDHV  181



>gb|EEL19135.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 95/8201]
Length=385

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  185

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  186  ESGLIAVDHV  195



>gb|EEK46877.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus m1293]
 gb|EEK58419.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BGSC 6E1]
 gb|EEL02587.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BDRD-ST26]
 gb|EEL47650.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus Rock3-42]
 gb|EEM73647.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
andalousiensis BGSC 4AW1]
 gb|EEM79775.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
pondicheriensis BGSC 4BA1]
 gb|EEM91674.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
pulsiensis BGSC 4CC1]
Length=385

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  185

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  186  ESGLIAVDHV  195



>ref|WP_029288834.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. R20-19]
Length=376

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 90/195 (46%), Gaps = 24/195 (12%)
 Frame = +1

Query  160  RVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS  339
            +++   D   +    ++EF+ G+A   A  +  A G    A +   TG    ASY+L+  
Sbjct  9    KISKAPDFLPINGTDYIEFYVGNAKQAAHYYKTAFGFQSLAYAGPETGVRDRASYVLQQ-  67

Query  340  GGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSAS  519
             G+++ + T    S                        HG GV+ +AL V+D  +AF  +
Sbjct  68   -GKIKLILTTALKSDHPISEHV--------------KKHGDGVKVLALWVDDAYSAFEET  112

Query  520  VSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTA  690
            V RGAKP  EP TL +   +V ++ ++ YG+ +  FI      +   TF+PG+   +  +
Sbjct  113  VKRGAKPYMEPKTLTDEQGEVRMSGIYTYGETIHMFI---ERKNYSGTFMPGYRVWE--S  167

Query  691  SYQDLDYGIRRLDHA  735
             YQ  D G++ +DH 
Sbjct  168  DYQPADAGLQYIDHC  182



>gb|AFH81613.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis str. 
H9401]
Length=385

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  185

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  186  ESGLIAVDHV  195



>ref|WP_044202951.1| 4-hydroxyphenylpyruvate dioxygenase [Flammeovirga sp. OC4]
Length=365

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 89/180 (49%), Gaps = 24/180 (13%)
 Frame = +1

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            H+EF+ G+A   A  +  A G  + A S   TG    +SY+L+   G+L+F+FT   +S+
Sbjct  14   HIEFYVGNAKQAAYFYQAAFGFELLAYSGPETGVRDRSSYVLQQ--GKLRFVFTTSLSSN  71

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  564
                            H+     HG GV+ +AL V+D + +F  +V RGA PV  P  ++
Sbjct  72   SEISDHV---------HK-----HGDGVKVLALWVDDARKSFEETVKRGAIPVHTPRVMS  117

Query  565  N---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
            +   +VV+A +  YGD V  F+      +   TFLP FE     A++     G++ +DH 
Sbjct  118  DESGEVVMATIKTYGDTVHTFVER---KNYKGTFLPKFEAR--QANFPTKAVGLKYVDHC  172



>gb|AIM04210.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus anthracis]
Length=384

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  185

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  186  ESGLIAVDHV  195



>gb|EDM38745.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. BAL39]
Length=403

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 89/195 (46%), Gaps = 24/195 (12%)
 Frame = +1

Query  160  RVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS  339
            ++    D   +    ++EF+ G+A   A  +  A G    A +   TG    ASY+L+  
Sbjct  36   KIAKAQDFLPINGTDYIEFYVGNAKQAAHYYKTAFGFQSLAYAGPETGVRDRASYVLKQ-  94

Query  340  GGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSAS  519
             G+++ + T    S     A                  HG GV+ +AL V+D  +AF  +
Sbjct  95   -GKIRLVLTTAMRSDHPISAHV--------------KNHGDGVKVLALWVDDAYSAFEET  139

Query  520  VSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTA  690
              RGA+P  EPVT  +   +V ++ ++ YG+ V  FI      +   TFLPG++  D  +
Sbjct  140  TKRGARPYLEPVTQRDEHGEVRMSGIYTYGETVHMFI---ERKNYTGTFLPGYQ--DWNS  194

Query  691  SYQDLDYGIRRLDHA  735
             YQ  D G+  +DH 
Sbjct  195  EYQPSDAGLLYIDHC  209



>ref|WP_025606603.1| 4-hydroxyphenylpyruvate dioxygenase [Pontibacter actiniarum]
Length=364

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 85/182 (47%), Gaps = 28/182 (15%)
 Frame = +1

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            ++EF+ G+A   A  +  A G  + A +   TG    ASY+L+    +++F+FT      
Sbjct  13   YIEFYVGNAKQAAHYYQTAFGFKLVAYAGPETGVRDRASYVLQQE--KIRFVFTTAINPD  70

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTLN  564
                                   HG GV+ +AL V+D + AF  +V RGAKP  EP T++
Sbjct  71   SDIARHVH--------------QHGDGVKVLALWVDDAEEAFRGTVERGAKPAMEPKTIS  116

Query  565  N---QVVLAEVHLYGDVVLRFISY--LSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLD  729
            +   +V LA +H YG+ +  F+     S P     F+PGF   +     + +  G++ +D
Sbjct  117  DEHGEVKLASIHTYGETIHTFVERKNYSGP-----FMPGFVARESIVKVEPV--GLKYVD  169

Query  730  HA  735
            H 
Sbjct  170  HC  171



>ref|WP_010602368.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter agri]
Length=376

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 89/195 (46%), Gaps = 24/195 (12%)
 Frame = +1

Query  160  RVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS  339
            +++   D   +    ++EF+ G+A   A  +  A G    A +   TG    ASY+L+  
Sbjct  9    KISKAQDFLPINGTDYIEFYVGNAKQAAHYYKTAFGFQSLAYAGPETGVRDRASYVLQQ-  67

Query  340  GGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSAS  519
             G+++ + T    S                        HG GV+ +AL V+D  +AF  +
Sbjct  68   -GKIRLILTTALKSDHPISEHV--------------KKHGDGVKVLALWVDDAYSAFEET  112

Query  520  VSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTA  690
              RGAKP  EP TL +   +V ++ ++ YG+ V  FI      + + TF+PG+   +  +
Sbjct  113  TKRGAKPYMEPKTLTDEYGEVKMSGIYTYGETVHMFI---ERKNYIGTFMPGYRVWE--S  167

Query  691  SYQDLDYGIRRLDHA  735
             YQ  D G+  +DH 
Sbjct  168  DYQPADAGLLYIDHC  182



>gb|ABK83632.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis str. 
Al Hakam]
Length=389

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  31   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  88

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  89   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  134

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  135  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  189

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  190  ESGLIAVDHV  199



>ref|WP_035404066.1| 4-hydroxyphenylpyruvate dioxygenase [Chlorobium sp. GBChlB]
Length=366

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 90/192 (47%), Gaps = 28/192 (15%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            S    V+ F +VEF+ G+A   A  +   LG  I A     TG    ASYL++   G++ 
Sbjct  3    SKALPVRDFDYVEFYVGNAKQAAHYYRAVLGFDIKAYQGPETGKRDCASYLVQQ--GKIC  60

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ T+P +SS    A                  HG GV+ VA   +D +AA+  ++ RGA
Sbjct  61   FILTSPLSSSSEIAAHI--------------QKHGDGVKDVAFETDDARAAYQTAIERGA  106

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF---EPMDGTASY  696
                EP+ L ++   VV A +  YGD +  F+      +    FLPGF      +G ASY
Sbjct  107  TSAYEPIELRDEHGVVVKAGIRTYGDTIHSFV---ERKNYNGIFLPGFVEKASTNGKASY  163

Query  697  QDLDYGIRRLDH  732
               + G+R +DH
Sbjct  164  ---NLGLRAIDH  172



>ref|WP_026963420.1| 4-hydroxyphenylpyruvate dioxygenase [Alicyclobacillus pomorum]
Length=369

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            +DH  ++   +VEF+ G+A   A   S A G  + A + + TG    ASY+L    G+++
Sbjct  7    ADHLPLQGIDYVEFYVGNAKQFAYFLSRAYGFQVVAYAGMETGVRDKASYVLEQ--GDIR  64

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ T+                        F   HG GV+ +A  V+D   A+  S SRGA
Sbjct  65   FVVTSALGPDHPIA--------------EFVKKHGDGVKEIAFTVDDAAVAYRESTSRGA  110

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
             PV++ + L ++   V  + +  YG+ V  FI           FLPG+EPMD
Sbjct  111  IPVADVIELKDKHGVVRKSVIGTYGETVHAFI---EREKYDGVFLPGYEPMD  159



>ref|WP_040930444.1| hypothetical protein [Prochloron didemni]
Length=403

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 87/183 (48%), Gaps = 23/183 (13%)
 Frame = +1

Query  136  LVGFKDFVRV--NPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNS  309
            LVG    V+   N + +  + + FHHVE W G+A   A  +S  +G+   A   L TG+ 
Sbjct  13   LVGLDAGVKYQKNSRPNFGAYQGFHHVEMWVGNAYQAALYYSTHMGLKPIAYKGLETGDR  72

Query  310  AHASYLLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVV  489
             +AS++LRA  GE+  + T+P     +                 F A HG  V  VA  V
Sbjct  73   QYASHVLRA--GEVTLVLTSPLKPGETKI-------------NQFLAQHGDAVYDVAFRV  117

Query  490  EDTQAAFSASVSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFL  660
            E+ +A +  +++ GAK +S P  L +   QV +A VH +G  V  F+          TFL
Sbjct  118  ENAKATYEHALAYGAKSISPPKILEDERGQVTVATVHAFGSTVHSFV---EKKDYQGTFL  174

Query  661  PGF  669
            PG+
Sbjct  175  PGY  177



>gb|KER09254.1| 4-hydroxyphenylpyruvate dioxygenase [Chlorobium sp. GBChlB]
Length=368

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 90/192 (47%), Gaps = 28/192 (15%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
            S    V+ F +VEF+ G+A   A  +   LG  I A     TG    ASYL++   G++ 
Sbjct  5    SKALPVRDFDYVEFYVGNAKQAAHYYRAVLGFDIKAYQGPETGKRDCASYLVQQ--GKIC  62

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ T+P +SS    A                  HG GV+ VA   +D +AA+  ++ RGA
Sbjct  63   FILTSPLSSSSEIAAHI--------------QKHGDGVKDVAFETDDARAAYQTAIERGA  108

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGF---EPMDGTASY  696
                EP+ L ++   VV A +  YGD +  F+      +    FLPGF      +G ASY
Sbjct  109  TSAYEPIELRDEHGVVVKAGIRTYGDTIHSFV---ERKNYNGIFLPGFVEKASTNGKASY  165

Query  697  QDLDYGIRRLDH  732
               + G+R +DH
Sbjct  166  ---NLGLRAIDH  174



>ref|WP_039865967.1| 4-hydroxyphenylpyruvate dioxygenase [Pedobacter sp. BAL39]
Length=376

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 89/195 (46%), Gaps = 24/195 (12%)
 Frame = +1

Query  160  RVNPKSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRAS  339
            ++    D   +    ++EF+ G+A   A  +  A G    A +   TG    ASY+L+  
Sbjct  9    KIAKAQDFLPINGTDYIEFYVGNAKQAAHYYKTAFGFQSLAYAGPETGVRDRASYVLKQ-  67

Query  340  GGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSAS  519
             G+++ + T    S     A                  HG GV+ +AL V+D  +AF  +
Sbjct  68   -GKIRLVLTTAMRSDHPISAHV--------------KNHGDGVKVLALWVDDAYSAFEET  112

Query  520  VSRGAKPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTA  690
              RGA+P  EPVT  +   +V ++ ++ YG+ V  FI      +   TFLPG++  D  +
Sbjct  113  TKRGARPYLEPVTQRDEHGEVRMSGIYTYGETVHMFI---ERKNYTGTFLPGYQ--DWNS  167

Query  691  SYQDLDYGIRRLDHA  735
             YQ  D G+  +DH 
Sbjct  168  EYQPSDAGLLYIDHC  182



>ref|WP_000810921.1| hypothetical protein, partial [Bacillus cereus]
Length=248

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 89/189 (47%), Gaps = 24/189 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSENRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +   +   A   F+PGF+ ++    ++  
Sbjct  118  VAIAPPQELTDEDGTLKKAVIGTYGDTIHTLVERKNYKGA---FMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDH  732
            + G+  +DH
Sbjct  173  ESGLIAVDH  181



>ref|WP_037328791.1| 4-hydroxyphenylpyruvate dioxygenase [Runella zeae]
Length=380

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  172  KSDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGEL  351
            + D   +    ++E + G+A   A  F  A G    A + L TG     SY+++   G++
Sbjct  18   EEDFLPLNGTDYIELYVGNAKQAAHYFQTAFGFQPLAYAGLQTGLRDRESYVVQQ--GKI  75

Query  352  QFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRG  531
            + + T+P                          THG GV+ VAL V+D + A+  +V RG
Sbjct  76   RLVLTSPLKGGTEIGKHID--------------THGDGVKVVALWVDDAEYAYHTTVERG  121

Query  532  AKPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQD  702
            AKP  EPV   +Q   V+ + +H YGD V  F+   ++   V  FLPGF+      +YQ 
Sbjct  122  AKPYFEPVLEEDQWGKVIRSGIHTYGDTVHVFVE-RNEYEGV--FLPGFQAW--KPAYQP  176

Query  703  LDYGIRRLDH  732
             D G++ +DH
Sbjct  177  TDVGLKYVDH  186



>ref|WP_041488236.1| 4-hydroxyphenylpyruvate dioxygenase, partial [Bacillus mycoides]
Length=359

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  1    EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  58

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +    S                    F   HG GV+ VAL+V+D + A+S +V RGA
Sbjct  59   FVVSGTLNSDSRIA--------------EFVKIHGDGVKDVALLVDDVEKAYSEAVKRGA  104

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
              ++ P  L ++   +  A +  YGD +   +      +   TF+PG+E +D
Sbjct  105  VAIAPPEELTDEQGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGYEKID  153



>ref|WP_025151089.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus sp. H1a]
Length=372

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHIEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNLPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_002113414.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ39468.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG5X1-1]
 gb|EJR01088.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MC67]
 gb|EJV58524.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG6O-2]
 gb|EOP02261.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus MC118]
Length=372

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHIEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDGRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_000810925.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis]
Length=372

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 87/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++     A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLVRAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  118  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_003205593.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus]
 gb|EEM13055.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides Rock3-17]
 gb|EEM18929.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus pseudomycoides 
DSM 12442]
 gb|AIK37583.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
 gb|KFN14696.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
 gb|AJI18127.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
Length=372

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +    S                    F   HG GV+ VAL+V+D + A+S +V RGA
Sbjct  72   FVVSGTLNSDSRIA--------------EFVKIHGDGVKDVALLVDDVEKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
              ++ P  L ++   +  A +  YGD +   +      +   TF+PG+E +D
Sbjct  118  VAIAPPEELTDEQGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGYEKID  166



>ref|WP_016117024.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EOP61844.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD136]
 gb|EOP76842.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM006]
 gb|EOQ17961.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM021]
Length=372

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 80/172 (47%), Gaps = 22/172 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +    S                    F   HG GV+ VAL+V+D + A+S +V RGA
Sbjct  72   FVVSGTLNSDSRIA--------------EFVKIHGDGVKDVALLVDDVEKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMD  681
              ++ P  L ++   +  A +  YGD +   +      +   TF+PG+E +D
Sbjct  118  VAIAPPEELTDEQGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGYEKID  166



>gb|EEM61947.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus thuringiensis serovar 
monterrey BGSC 4AJ1]
Length=385

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 87/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++     A G  I A S L TGN    SY+L      ++
Sbjct  27   EDFFPVRDVDHLEFYVGNAKQSSYYLVRAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  84

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  85   FVVSGALSSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  130

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ PV L   N  +  A +  YGD +   +      +   TF+PGF+  +    ++  
Sbjct  131  VAIAPPVELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKAEFDIPFE--  185

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  186  ESGLIAVDHV  195



>ref|WP_044219112.1| 4-hydroxyphenylpyruvate dioxygenase [Flammeovirga pacifica]
Length=373

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 86/180 (48%), Gaps = 24/180 (13%)
 Frame = +1

Query  205  HVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQFLFTapyass  384
            H+EF+ G+A   A  +  A G    A S   TG    ASY+L+   G+L+F+FT    ++
Sbjct  22   HIEFYVGNAKQAAYFYQTAFGFKQVAYSGPETGVKEKASYVLQQ--GKLRFVFTTSLNTN  79

Query  385  isnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGAKPVSEPVTL-  561
                            H+     HG GV+ +AL V+D + ++  ++ RGA  +  P ++ 
Sbjct  80   SEIAKHV---------HQ-----HGDGVKVLALWVDDARKSYEETIKRGAVSIQAPYSIS  125

Query  562  --NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDLDYGIRRLDHA  735
              N +VVL+ +  YGD +  F+   +   A   FLP F   D     +D+  G++ +DH 
Sbjct  126  DENGEVVLSSIKTYGDTIHTFVERKNYSGA---FLPNFVAKDPLMEVKDV--GLKYVDHC  180



>ref|WP_002091386.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJP82364.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD142]
Length=372

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIRFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_000810917.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|EJQ05296.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG3X2-1]
 gb|EJR97166.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM034]
 gb|EJS16914.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM062]
 gb|EJS48049.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG1X1-3]
 gb|EOO81278.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG1O-1]
 gb|EOP61967.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM053]
Length=372

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEDGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_029566295.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cibi]
 gb|KEZ47475.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cibi]
Length=371

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 83/190 (44%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F VK   ++E + G+A  +A  F  A G  + A S L TGN    SY+L+    +++
Sbjct  13   EDFFPVKDVDYLEMYSGNAKQSAHYFCTAFGFKLVAYSGLETGNRETVSYVLQQQ--KVR  70

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
             + T     +                   F   HG GVR VALVV+D + A+  +V RGA
Sbjct  71   LIITGSLNDTSRVA--------------EFVKKHGDGVRDVALVVDDVEKAYKGAVERGA  116

Query  535  KPVSEPVTLNN---QVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L +    V  A +  YGD +    S +        F+PG+E  +    Y + 
Sbjct  117  IAITPPSELKDDHGMVKKAVIGTYGDTIH---SLIERKEYKGVFMPGYEKAEMKFPYTEA  173

Query  706  DYGIRRLDHA  735
              GI  +DH 
Sbjct  174  --GIIGVDHV  181



>ref|WP_015024438.1| 4-hydroxyphenylpyruvate dioxygenase [Psychroflexus torquis]
 gb|AFU68856.1| 4-hydroxyphenylpyruvate dioxygenase [Psychroflexus torquis ATCC 
700755]
Length=379

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 94/199 (47%), Gaps = 25/199 (13%)
 Frame = +1

Query  148  KDFVRVNPKSDHF-SVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASY  324
            +   +VN +++ F  +     VE + G+A   A  +  A G    A + L TG     SY
Sbjct  8    QKLTKVNLEAEDFLPILGTDFVELYVGNAKQAAYYYQTAWGYQPVAYAGLETGRKDSTSY  67

Query  325  LLRASGGELQFLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQA  504
            +L+   G+++ + T+P +                  +R  N  HG GV+ V+L V+D   
Sbjct  68   VLQQ--GKIRLVLTSPMSDGGDI-------------NRHINE-HGDGVKFVSLWVDDAAK  111

Query  505  AFSASVSRGAKPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEP  675
            +F  +V RGAKP  EP T+   N + V++ +H YG+ +  FI           FLPG+  
Sbjct  112  SFEETVKRGAKPYVEPYTIEDDNGKAVISGIHTYGETIHLFI---ERKDYEGPFLPGYNA  168

Query  676  MDGTASYQDLDYGIRRLDH  732
               T SY+  D G++ +DH
Sbjct  169  W--TKSYKTEDVGLKYIDH  185



>ref|WP_002151375.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJQ72946.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuA4-10]
Length=372

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_002140158.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|ABY41487.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis 
KBAB4]
 gb|EJQ75308.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuA2-4]
 gb|EOO10879.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus HuA3-9]
 gb|EOO65845.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD021]
 dbj|GAE42774.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis 
NBRC 101238 = DSM 11821]
 gb|AIW88023.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis]
 gb|KIV72987.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
Length=372

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_002124802.1| MULTISPECIES: 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus 
group]
 gb|EJQ58964.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus CER074]
 gb|EJQ69070.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus CER057]
 gb|EJR25222.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD048]
 gb|EJR32688.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD078]
 gb|EJR96276.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM022]
 gb|EJV73442.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BtB2-4]
 gb|EOO42613.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VDM019]
 gb|EOP47603.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus VD146]
 gb|ETT73992.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus weihenstephanensis 
FSL H7-687]
 gb|AJH20958.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus mycoides]
Length=372

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 89/190 (47%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +   +S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALSSDSRIA--------------DFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTLNNQ---VVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L ++   +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDEEGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_000810912.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
Length=372

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 87/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



>ref|WP_000810911.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus]
 gb|EJS63651.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2X1-1]
 gb|EJS70402.1| 4-hydroxyphenylpyruvate dioxygenase [Bacillus cereus BAG2X1-3]
Length=372

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 87/190 (46%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  SDHFSVKRFHHVEFWCGDATNTARRFSWALGMPIAAKSDLSTGNSAHASYLLRASGGELQ  354
             D F V+   H+EF+ G+A  ++   + A G  I A S L TGN    SY+L      ++
Sbjct  14   EDFFPVRDVDHLEFYVGNAKQSSYYLARAFGFKIVAYSGLETGNREKVSYVLVQKN--MR  71

Query  355  FLFTapyassisnpasaaipsfsasaHRSFNATHGLGVRAVALVVEDTQAAFSASVSRGA  534
            F+ +    S                    F  THG GV+ VAL+V+D   A+S +V RGA
Sbjct  72   FVVSGALGSDNRIA--------------EFVKTHGDGVKDVALLVDDVDKAYSEAVKRGA  117

Query  535  KPVSEPVTL---NNQVVLAEVHLYGDVVLRFISYLSDPSAVTTFLPGFEPMDGTASYQDL  705
              ++ P  L   N  +  A +  YGD +   +      +   TF+PGF+ ++    ++  
Sbjct  118  VAIAPPEELTDENGTLKKAVIGTYGDTIHTLVER---KNYKGTFMPGFQKVEFNIPFE--  172

Query  706  DYGIRRLDHA  735
            + G+  +DH 
Sbjct  173  ESGLIAVDHV  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1372351877325