BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10673

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351772.1|  PREDICTED: uncharacterized protein LOC102578792    159   5e-42   
ref|XP_004230598.1|  PREDICTED: uncharacterized protein LOC101259293    148   4e-38   Solanum lycopersicum
ref|XP_007042933.1|  Uncharacterized protein isoform 4                  142   2e-36   
ref|XP_007042930.1|  Uncharacterized protein isoform 1                  142   4e-36   
ref|XP_009790037.1|  PREDICTED: uncharacterized protein LOC104237564    139   5e-35   Nicotiana sylvestris
gb|KDO49111.1|  hypothetical protein CISIN_1g0173162mg                  129   3e-32   Citrus sinensis [apfelsine]
gb|EYU18473.1|  hypothetical protein MIMGU_mgv1a025704mg                132   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_009615990.1|  PREDICTED: uncharacterized protein LOC104108615    130   8e-32   Nicotiana tomentosiformis
ref|XP_002525863.1|  conserved hypothetical protein                     128   1e-31   
ref|XP_006423858.1|  hypothetical protein CICLE_v10028678mg             129   1e-31   
ref|XP_006423857.1|  hypothetical protein CICLE_v10028678mg             129   2e-31   Citrus clementina [clementine]
ref|XP_006493891.1|  PREDICTED: uncharacterized protein LOC102621...    128   2e-31   
ref|XP_006493890.1|  PREDICTED: uncharacterized protein LOC102621...    128   4e-31   Citrus sinensis [apfelsine]
ref|XP_011041858.1|  PREDICTED: uncharacterized protein LOC105137724    129   4e-31   Populus euphratica
emb|CDO97440.1|  unnamed protein product                                123   1e-30   Coffea canephora [robusta coffee]
ref|XP_002323979.1|  hypothetical protein POPTR_0017s08030g             126   3e-30   
emb|CAN83764.1|  hypothetical protein VITISV_022124                     123   1e-29   Vitis vinifera
ref|XP_002272705.1|  PREDICTED: uncharacterized protein LOC100261012    124   1e-29   Vitis vinifera
ref|XP_010269304.1|  PREDICTED: uncharacterized protein LOC104606004    120   4e-28   Nelumbo nucifera [Indian lotus]
gb|KHF99141.1|  hypothetical protein F383_18933                         120   4e-28   Gossypium arboreum [tree cotton]
ref|XP_007199902.1|  hypothetical protein PRUPE_ppa006716mg             120   5e-28   Prunus persica
ref|XP_004137277.1|  PREDICTED: uncharacterized protein LOC101222931    119   1e-27   Cucumis sativus [cucumbers]
ref|XP_009337875.1|  PREDICTED: uncharacterized protein LOC103930...    117   6e-27   Pyrus x bretschneideri [bai li]
ref|XP_009337874.1|  PREDICTED: uncharacterized protein LOC103930...    117   6e-27   Pyrus x bretschneideri [bai li]
ref|XP_009344578.1|  PREDICTED: uncharacterized protein LOC103936468    116   9e-27   Pyrus x bretschneideri [bai li]
gb|KJB32061.1|  hypothetical protein B456_005G221000                    115   2e-26   Gossypium raimondii
ref|XP_010520922.1|  PREDICTED: uncharacterized protein LOC104799930    114   6e-26   Tarenaya hassleriana [spider flower]
ref|XP_004290342.1|  PREDICTED: uncharacterized protein LOC101311058    114   7e-26   Fragaria vesca subsp. vesca
gb|KJB77540.1|  hypothetical protein B456_012G142500                    114   8e-26   Gossypium raimondii
gb|KJB77539.1|  hypothetical protein B456_012G142500                    113   9e-26   Gossypium raimondii
ref|XP_008348814.1|  PREDICTED: uncharacterized protein LOC103411982    113   1e-25   
ref|XP_008342511.1|  PREDICTED: uncharacterized protein LOC103405323    112   2e-25   
ref|XP_012069136.1|  PREDICTED: uncharacterized protein LOC105631579    110   2e-24   Jatropha curcas
ref|XP_008462861.1|  PREDICTED: uncharacterized protein LOC103501143    109   4e-24   Cucumis melo [Oriental melon]
ref|XP_011087891.1|  PREDICTED: uncharacterized protein LOC105169231    106   5e-23   
gb|KJB77538.1|  hypothetical protein B456_012G142400                    105   5e-23   Gossypium raimondii
gb|KJB77537.1|  hypothetical protein B456_012G142400                    105   6e-23   Gossypium raimondii
ref|XP_010030036.1|  PREDICTED: uncharacterized protein LOC104419903    105   7e-23   Eucalyptus grandis [rose gum]
ref|XP_010690509.1|  PREDICTED: uncharacterized protein LOC104904034    101   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009130442.1|  PREDICTED: uncharacterized protein LOC103855230    100   3e-21   Brassica rapa
ref|XP_010094145.1|  hypothetical protein L484_017184                 99.8    4e-21   
emb|CDY31332.1|  BnaA02g34090D                                        99.4    8e-21   Brassica napus [oilseed rape]
emb|CDY63725.1|  BnaC02g48850D                                        99.0    1e-20   Brassica napus [oilseed rape]
gb|KHG29062.1|  1,8-cineole synthase, chloroplastic                   98.6    1e-20   Gossypium arboreum [tree cotton]
ref|XP_004485586.1|  PREDICTED: uncharacterized protein LOC101515692  90.1    1e-17   Cicer arietinum [garbanzo]
dbj|BAE71289.1|  hypothetical protein                                 90.1    1e-17   Trifolium pratense [peavine clover]
gb|KDP40903.1|  hypothetical protein JCGZ_24902                       89.0    3e-17   Jatropha curcas
ref|NP_568987.2|  uncharacterized protein                             89.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09854.1|  unnamed protein product                              89.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003593210.1|  hypothetical protein MTR_2g008960                88.6    4e-17   Medicago truncatula
gb|ADE77727.1|  unknown                                               86.3    5e-16   Picea sitchensis
ref|XP_010461545.1|  PREDICTED: uncharacterized protein LOC104742256  85.5    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010939663.1|  PREDICTED: uncharacterized protein LOC105058425  84.3    2e-15   Elaeis guineensis
ref|XP_002454249.1|  hypothetical protein SORBIDRAFT_04g027520        81.6    1e-14   
gb|KFK28114.1|  hypothetical protein AALP_AA8G474500                  80.9    2e-14   Arabis alpina [alpine rockcress]
ref|XP_010484194.1|  PREDICTED: uncharacterized protein LOC104762577  80.9    3e-14   Camelina sativa [gold-of-pleasure]
gb|EEC74030.1|  hypothetical protein OsI_08983                        79.7    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002864888.1|  hypothetical protein ARALYDRAFT_496623           80.5    4e-14   
ref|XP_006280766.1|  hypothetical protein CARUB_v10026735mg           79.3    6e-14   Capsella rubella
ref|NP_001048156.1|  Os02g0754600                                     79.3    9e-14   
ref|XP_004955218.1|  PREDICTED: uncharacterized protein LOC101770073  78.2    3e-13   
ref|XP_010444356.1|  PREDICTED: uncharacterized protein LOC104727054  77.4    4e-13   Camelina sativa [gold-of-pleasure]
gb|ACJ84769.1|  unknown                                               74.3    6e-13   Medicago truncatula
ref|XP_010937431.1|  PREDICTED: uncharacterized protein LOC105056...  76.3    1e-12   Elaeis guineensis
ref|XP_010937432.1|  PREDICTED: uncharacterized protein LOC105056...  75.9    1e-12   Elaeis guineensis
ref|XP_002963079.1|  hypothetical protein SELMODRAFT_404646           76.3    2e-12   Selaginella moellendorffii
ref|XP_008790884.1|  PREDICTED: uncharacterized protein LOC103707937  75.5    2e-12   Phoenix dactylifera
ref|XP_008778096.1|  PREDICTED: uncharacterized protein LOC103697933  75.5    2e-12   
ref|XP_009399671.1|  PREDICTED: uncharacterized protein LOC103984006  73.6    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419802.1|  PREDICTED: uncharacterized protein LOC103999707  69.7    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394183.1|  hypothetical protein EUTSA_v10004757mg           68.6    2e-10   Eutrema salsugineum [saltwater cress]
gb|ERN09424.1|  hypothetical protein AMTR_s00029p00061100             68.9    3e-10   Amborella trichopoda
ref|XP_006847843.2|  PREDICTED: uncharacterized protein LOC18437576   67.8    8e-10   
gb|AAK93619.1|  unknown protein                                       66.2    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAN75502.1|  hypothetical protein VITISV_034157                   66.6    2e-09   Vitis vinifera
ref|XP_010034289.1|  PREDICTED: uncharacterized protein LOC104423502  66.6    2e-09   Eucalyptus grandis [rose gum]
gb|KCW51322.1|  hypothetical protein EUGRSUZ_J00876                   66.6    2e-09   Eucalyptus grandis [rose gum]
ref|XP_002521651.1|  conserved hypothetical protein                   66.6    2e-09   Ricinus communis
emb|CBI29026.3|  unnamed protein product                              66.6    2e-09   Vitis vinifera
ref|XP_002270447.1|  PREDICTED: uncharacterized protein LOC100240757  66.6    2e-09   Vitis vinifera
ref|XP_002980258.1|  hypothetical protein SELMODRAFT_112193           65.9    3e-09   
ref|XP_012072843.1|  PREDICTED: uncharacterized protein LOC105634579  66.2    3e-09   Jatropha curcas
ref|XP_002984405.1|  hypothetical protein SELMODRAFT_423623           65.5    5e-09   Selaginella moellendorffii
ref|XP_008813455.1|  PREDICTED: uncharacterized protein LOC103724075  64.7    1e-08   Phoenix dactylifera
ref|XP_002972832.1|  hypothetical protein SELMODRAFT_441994           63.9    2e-08   Selaginella moellendorffii
ref|XP_006853180.2|  PREDICTED: uncharacterized protein LOC18442912   63.5    2e-08   Amborella trichopoda
ref|XP_009135652.1|  PREDICTED: uncharacterized protein LOC103859827  62.4    6e-08   Brassica rapa
emb|CDY22946.1|  BnaC03g41230D                                        62.4    6e-08   Brassica napus [oilseed rape]
ref|XP_010508223.1|  PREDICTED: uncharacterized protein LOC104784...  62.0    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006297645.1|  hypothetical protein CARUB_v10013663mg           62.0    9e-08   Capsella rubella
ref|XP_002885346.1|  hypothetical protein ARALYDRAFT_479510           61.6    1e-07   Arabidopsis lyrata subsp. lyrata
dbj|BAC43081.1|  unknown protein                                      61.6    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508216.1|  PREDICTED: uncharacterized protein LOC104784...  61.6    1e-07   Camelina sativa [gold-of-pleasure]
ref|NP_188626.2|  uncharacterized protein                             61.6    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570616.2|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...  62.0    1e-07   Brachypodium distachyon [annual false brome]
ref|XP_010487950.1|  PREDICTED: uncharacterized protein LOC104765...  61.6    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010487951.1|  PREDICTED: uncharacterized protein LOC104765...  61.6    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010466158.1|  PREDICTED: uncharacterized protein LOC104746...  61.2    1e-07   Camelina sativa [gold-of-pleasure]
gb|KHG26415.1|  Chaperone DnaJ                                        60.1    2e-07   Gossypium arboreum [tree cotton]
ref|XP_010466159.1|  PREDICTED: uncharacterized protein LOC104746...  60.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010096783.1|  hypothetical protein L484_004764                 60.8    2e-07   Morus notabilis
ref|XP_010940354.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    4e-07   Elaeis guineensis
ref|XP_009793569.1|  PREDICTED: uncharacterized protein LOC104240425  60.1    4e-07   Nicotiana sylvestris
ref|XP_009590559.1|  PREDICTED: uncharacterized protein LOC104087710  59.7    4e-07   Nicotiana tomentosiformis
ref|XP_010935667.1|  PREDICTED: uncharacterized protein LOC105055529  59.7    4e-07   
gb|KFK39313.1|  hypothetical protein AALP_AA3G228700                  59.7    4e-07   Arabis alpina [alpine rockcress]
gb|KFK39314.1|  hypothetical protein AALP_AA3G228700                  59.7    5e-07   Arabis alpina [alpine rockcress]
ref|XP_010688666.1|  PREDICTED: uncharacterized protein LOC104902557  59.7    5e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004143698.1|  PREDICTED: uncharacterized protein LOC101206051  59.7    5e-07   Cucumis sativus [cucumbers]
gb|KJB31863.1|  hypothetical protein B456_005G211600                  59.7    6e-07   Gossypium raimondii
ref|XP_011459749.1|  PREDICTED: uncharacterized protein LOC101309613  58.9    1e-06   Fragaria vesca subsp. vesca
ref|XP_008445882.1|  PREDICTED: uncharacterized protein LOC103488768  57.8    3e-06   Cucumis melo [Oriental melon]
ref|XP_006406441.1|  hypothetical protein EUTSA_v10022300mg           57.4    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010541857.1|  PREDICTED: uncharacterized protein LOC104815236  55.8    1e-05   Tarenaya hassleriana [spider flower]
emb|CDY25358.1|  BnaA05g19260D                                        55.5    1e-05   Brassica napus [oilseed rape]
ref|XP_009145731.1|  PREDICTED: uncharacterized protein LOC103869...  55.5    1e-05   Brassica rapa
ref|XP_009145732.1|  PREDICTED: uncharacterized protein LOC103869...  55.5    1e-05   Brassica rapa
ref|XP_004231494.1|  PREDICTED: uncharacterized protein LOC101263358  55.5    1e-05   Solanum lycopersicum
ref|XP_006345317.1|  PREDICTED: uncharacterized protein LOC102606286  55.5    1e-05   
emb|CDY24594.1|  BnaC05g32780D                                        54.7    2e-05   Brassica napus [oilseed rape]
ref|XP_006484584.1|  PREDICTED: uncharacterized protein LOC102623953  50.8    4e-04   Citrus sinensis [apfelsine]
ref|XP_006437611.1|  hypothetical protein CICLE_v10033897mg           50.8    5e-04   
ref|XP_001768702.1|  predicted protein                                50.1    7e-04   



>ref|XP_006351772.1| PREDICTED: uncharacterized protein LOC102578792 [Solanum tuberosum]
Length=411

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  163  ENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfp  342
            E++ +++A  +L+ LLTS F +ADKP I+  ++ K L+ IR FL+SAFLFFLRLLPSLFP
Sbjct  28   ESTSSSIAPLLLRNLLTSAFIFADKPFILLAERYKLLETIRYFLISAFLFFLRLLPSLFP  87

Query  343  sfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVR  522
            S N S  ++Y +    K+GE   PVA  G  E GI+RALTQVLSIV DIPVSSRKYEVVR
Sbjct  88   SLNPSG-ENYGYPLKPKKGEIYSPVAASGRAESGISRALTQVLSIVNDIPVSSRKYEVVR  146

Query  523  SLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVI  648
            SLAERLID+NLL+GN+AL+EVN   L+AAF RTL QLESA++
Sbjct  147  SLAERLIDENLLEGNEALREVNCAALSAAFTRTLSQLESAMV  188



>ref|XP_004230598.1| PREDICTED: uncharacterized protein LOC101259293 [Solanum lycopersicum]
Length=411

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  163  ENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfp  342
            E++ +++A  +L+ LLTS F  ADKP I+  ++ K L+ IR FL+SAFLFFLRLLPSLFP
Sbjct  28   ESTSSSIAPLLLRNLLTSAFIIADKPFILLAERYKLLETIRYFLISAFLFFLRLLPSLFP  87

Query  343  sfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVR  522
            S N S  ++Y +    K+GE   P A GGG E GI+RALTQ+LSIV DIPVSSRKYEVVR
Sbjct  88   SLNPSG-ENYGYPLKPKKGEIYSPAAAGGGAESGISRALTQLLSIVNDIPVSSRKYEVVR  146

Query  523  SLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVI  648
            SLAERLID+NLL+GN+AL+EVN   L+AAF RTL QLESA++
Sbjct  147  SLAERLIDENLLEGNEALREVNCAALSAAFTRTLNQLESAMM  188



>ref|XP_007042933.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
 gb|EOX98764.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
Length=343

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 125/169 (74%), Gaps = 3/169 (2%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENSPTA+A  +L+ ++TS+F YADK L+   +K K L+ IR  +++ FLFFLRLLPSL 
Sbjct  4    MENSPTAIAPLLLRNMVTSIFIYADKSLLNLAEKYKLLELIRAVVITFFLFFLRLLPSLI  63

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVV  519
            PS    P Q+  + F   +  +    A  G G+ GIARAL+Q+LSIV DIPVSSRKYE+V
Sbjct  64   PS-TLHP-QADHYTFKHPQNHSYVAAA-YGVGDSGIARALSQLLSIVNDIPVSSRKYEIV  120

Query  520  RSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGES  666
            RSLAERLI++N  +  +AL+EVNRTVL+AAF RTL+QLE+A+++ G ++
Sbjct  121  RSLAERLIEENRKEDVEALREVNRTVLSAAFARTLRQLEAAMVELGQDT  169



>ref|XP_007042930.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007042931.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007042932.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX98761.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX98762.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX98763.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=384

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 125/169 (74%), Gaps = 3/169 (2%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENSPTA+A  +L+ ++TS+F YADK L+   +K K L+ IR  +++ FLFFLRLLPSL 
Sbjct  4    MENSPTAIAPLLLRNMVTSIFIYADKSLLNLAEKYKLLELIRAVVITFFLFFLRLLPSLI  63

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVV  519
            PS    P Q+  + F   +  +    A  G G+ GIARAL+Q+LSIV DIPVSSRKYE+V
Sbjct  64   PS-TLHP-QADHYTFKHPQNHSYVAAA-YGVGDSGIARALSQLLSIVNDIPVSSRKYEIV  120

Query  520  RSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGES  666
            RSLAERLI++N  +  +AL+EVNRTVL+AAF RTL+QLE+A+++ G ++
Sbjct  121  RSLAERLIEENRKEDVEALREVNRTVLSAAFARTLRQLEAAMVELGQDT  169



>ref|XP_009790037.1| PREDICTED: uncharacterized protein LOC104237564 [Nicotiana sylvestris]
Length=398

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 113/152 (74%), Gaps = 9/152 (6%)
 Frame = +1

Query  193  VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsfNASPFQSY  372
            +L+ +LTS FF+ADKP  +  +K K L+FIR FL+ +FLFFL+L PS     N+ P +  
Sbjct  37   LLRNILTSAFFFADKPFFLLAEKYKLLEFIRWFLIQSFLFFLKLFPSGEYD-NSYPLKP-  94

Query  373  KFCFNSKRGEALCPVA-DGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDD  549
                  ++GE   P A  GGGGE GI+RALTQVLSIV DIPVSSRKYEVVRSLAERLID+
Sbjct  95   ------QKGEIYSPAAVGGGGGESGISRALTQVLSIVNDIPVSSRKYEVVRSLAERLIDE  148

Query  550  NLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            NLL+GN+AL+EVN   L+AAF RTL QLESAV
Sbjct  149  NLLEGNEALREVNCAALSAAFTRTLGQLESAV  180



>gb|KDO49111.1| hypothetical protein CISIN_1g0173162mg, partial [Citrus sinensis]
Length=257

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 114/176 (65%), Gaps = 20/176 (11%)
 Frame = +1

Query  160  MENSPTAMAFS--VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllps  333
            MEN+P++++ +  +L+ L TS+F YADK  +    K K L+ IRC L++ FLF LRLL  
Sbjct  4    MENTPSSISVAPLLLRNLATSIFIYADKSFLSLARKYKLLEIIRCILITFFLFILRLL--  61

Query  334  lfpsfNASPFQSYKFCFNSKRGEALCPVADG-------GGGEPGIARALTQVLSIVTDIP  492
                  AS   S+   FNS       P  D           + GIARAL+Q+LSI+ DIP
Sbjct  62   ------ASFLPSF---FNSNSLYIYAPKKDNYVSASASPSADSGIARALSQLLSILNDIP  112

Query  493  VSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGG  660
            V+SRKY+VVRSLAERLID+N  D  +AL+EVNRTVL+ AF RTL QLE+AV++ GG
Sbjct  113  VNSRKYQVVRSLAERLIDENHKDNIQALREVNRTVLSVAFSRTLGQLEAAVLELGG  168



>gb|EYU18473.1| hypothetical protein MIMGU_mgv1a025704mg [Erythranthe guttata]
Length=399

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 113/161 (70%), Gaps = 9/161 (6%)
 Frame = +1

Query  193  VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsfNASPFQSY  372
            +L+ L+T++F +A+K LI F  K K L+ +RCF+VS FLFFL LLPS F   + S    Y
Sbjct  14   LLRNLVTAIFIHANKSLISFSHKYKFLELLRCFIVSVFLFFLGLLPSFFSCLSPSQHNEY  73

Query  373  KFC---FNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
                  F S+R +      D  GG  G++RAL+Q+LSI+ DIPVSSRKYEVVRSLAE+LI
Sbjct  74   SSSCPNFTSRRDD------DCYGGGSGVSRALSQLLSIMNDIPVSSRKYEVVRSLAEKLI  127

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGES  666
            D+NLL+ N+AL+EVN +VL+ AF R+L QLE+A+ + G  S
Sbjct  128  DENLLENNRALREVNCSVLSVAFARSLSQLEAALAEQGRRS  168



>ref|XP_009615990.1| PREDICTED: uncharacterized protein LOC104108615 [Nicotiana tomentosiformis]
Length=401

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 116/162 (72%), Gaps = 9/162 (6%)
 Frame = +1

Query  163  ENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfp  342
            E+S +++A  +L+ +LTS F +ADKP  +  +K K L+F+R FL+ AFLFFL+L P    
Sbjct  30   ESSSSSIAPLLLRNILTSAFIFADKPFFLLAEKYKLLEFVRWFLIQAFLFFLKLFP----  85

Query  343  sfNASPFQSYKFCFNSKRGEALCPVA-DGGGGEPGIARALTQVLSIVTDIPVSSRKYEVV  519
              +   + SY      ++GE   P A  GG GE GI+RALTQVLSI  DIPVSSRKYEVV
Sbjct  86   --SGENYNSYPL--KPQKGEIYSPAAVGGGSGESGISRALTQVLSIANDIPVSSRKYEVV  141

Query  520  RSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            RSLAERLID+NLL+GN+AL+EVN   L+AAF RTL QLE+AV
Sbjct  142  RSLAERLIDENLLEGNEALREVNCAALSAAFTRTLGQLEAAV  183



>ref|XP_002525863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36557.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 117/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            ME SPTA+A  VLK L+T +F YADK  +   +K K L+F+R  L++ FLF LRL+PS  
Sbjct  4    METSPTAIASLVLKNLVTPIFIYADKSFVNLGEKYKLLEFLRYLLMTFFLFILRLIPSFL  63

Query  340  psfNASPFQS--YKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYE  513
            PS N+    S  Y       + + L P +  G G+ GIARAL+Q+LS+V DIPVSSRKYE
Sbjct  64   PSLNSIHPDSCCYPLVNKPPKTDNLLPAS--GAGDSGIARALSQLLSLVNDIPVSSRKYE  121

Query  514  VVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGES  666
            VVRSLAE++I+DN  +  + L +VNR  L+AAF +TL QLE+A+++ G +S
Sbjct  122  VVRSLAEKIIEDNQNEHLEVLHQVNRISLSAAFEKTLSQLEAAMMETGCDS  172



>ref|XP_006423858.1| hypothetical protein CICLE_v10028678mg [Citrus clementina]
 gb|ESR37098.1| hypothetical protein CICLE_v10028678mg [Citrus clementina]
Length=313

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 113/169 (67%), Gaps = 6/169 (4%)
 Frame = +1

Query  160  MENSPTAMAFS--VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllps  333
            MEN+P++++ +  +L+ L TS+F YADK  +    K K L+ IRC L++ FLF LRLL S
Sbjct  4    MENTPSSISVAPLLLRNLATSIFIYADKSFLSLARKYKLLEIIRCILITFFLFILRLLAS  63

Query  334  lfpsfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYE  513
                   S F S      + + +     +     + GIARAL+Q+LSI+ DIPV+SRKY+
Sbjct  64   FL----PSFFNSNSLYIYAPKKDNYVSASASPSADSGIARALSQLLSILNDIPVNSRKYQ  119

Query  514  VVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGG  660
            VVRSLAERLID+N  D  +AL+EVNRTVL+ AF RTL QLE+AV++ GG
Sbjct  120  VVRSLAERLIDENHRDNIQALREVNRTVLSVAFSRTLGQLEAAVLELGG  168



>ref|XP_006423857.1| hypothetical protein CICLE_v10028678mg [Citrus clementina]
 gb|ESR37097.1| hypothetical protein CICLE_v10028678mg [Citrus clementina]
Length=373

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 114/176 (65%), Gaps = 20/176 (11%)
 Frame = +1

Query  160  MENSPTAMAFS--VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllps  333
            MEN+P++++ +  +L+ L TS+F YADK  +    K K L+ IRC L++ FLF LRLL  
Sbjct  4    MENTPSSISVAPLLLRNLATSIFIYADKSFLSLARKYKLLEIIRCILITFFLFILRLL--  61

Query  334  lfpsfNASPFQSYKFCFNSKRGEALCPVADG-------GGGEPGIARALTQVLSIVTDIP  492
                  AS   S+   FNS       P  D           + GIARAL+Q+LSI+ DIP
Sbjct  62   ------ASFLPSF---FNSNSLYIYAPKKDNYVSASASPSADSGIARALSQLLSILNDIP  112

Query  493  VSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGG  660
            V+SRKY+VVRSLAERLID+N  D  +AL+EVNRTVL+ AF RTL QLE+AV++ GG
Sbjct  113  VNSRKYQVVRSLAERLIDENHRDNIQALREVNRTVLSVAFSRTLGQLEAAVLELGG  168



>ref|XP_006493891.1| PREDICTED: uncharacterized protein LOC102621648 isoform X2 [Citrus 
sinensis]
Length=310

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = +1

Query  160  MENSPTAMAFS--VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllps  333
            MEN+P++++ +  +L+ L TS+F YADK  +    K K L+ IRC L++ FLF LRLLPS
Sbjct  4    MENTPSSISVAPLLLRNLATSIFIYADKSFLSLARKYKLLEIIRCILITFFLFILRLLPS  63

Query  334  lfpsfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYE  513
                   S F S      + + +     +     + GIARAL+Q+LSI+ DIPV+SRKY+
Sbjct  64   FL----PSFFNSNSLYIYAPKKDNYVSASASPSADSGIARALSQLLSILNDIPVNSRKYQ  119

Query  514  VVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGG  660
            VVRSLAERLID+N  D  +AL+EVNRTVL+ AF RTL QLE+AV++ GG
Sbjct  120  VVRSLAERLIDENHKDNIQALREVNRTVLSVAFSRTLGQLEAAVLELGG  168



>ref|XP_006493890.1| PREDICTED: uncharacterized protein LOC102621648 isoform X1 [Citrus 
sinensis]
Length=373

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = +1

Query  160  MENSPTAMAFS--VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllps  333
            MEN+P++++ +  +L+ L TS+F YADK  +    K K L+ IRC L++ FLF LRLLPS
Sbjct  4    MENTPSSISVAPLLLRNLATSIFIYADKSFLSLARKYKLLEIIRCILITFFLFILRLLPS  63

Query  334  lfpsfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYE  513
                   S F S      + + +     +     + GIARAL+Q+LSI+ DIPV+SRKY+
Sbjct  64   FL----PSFFNSNSLYIYAPKKDNYVSASASPSADSGIARALSQLLSILNDIPVNSRKYQ  119

Query  514  VVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGG  660
            VVRSLAERLID+N  D  +AL+EVNRTVL+ AF RTL QLE+AV++ GG
Sbjct  120  VVRSLAERLIDENHKDNIQALREVNRTVLSVAFSRTLGQLEAAVLELGG  168



>ref|XP_011041858.1| PREDICTED: uncharacterized protein LOC105137724 [Populus euphratica]
 ref|XP_011041859.1| PREDICTED: uncharacterized protein LOC105137724 [Populus euphratica]
Length=387

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 125/176 (71%), Gaps = 13/176 (7%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            ME SP  +A  +++ + T++F +ADK L+    K K L+ IR  LV++FLFFLRLLPSLF
Sbjct  4    METSPITIAPLLIRNIATAIFIFADKSLVALAQKHKLLEHIRYLLVTSFLFFLRLLPSLF  63

Query  340  psfN-ASPFQSYKFCFNSKRGEALCPV--AD----GGGGEPGIARALTQVLSIVTDIPVS  498
            PS N +S  Q +    ++ +   L P+  AD     G G+ GIARALTQ+LSIV DIPVS
Sbjct  64   PSLNPSSDHQDH----DNIQYHHLQPLKSADYLPSSGYGDSGIARALTQLLSIVNDIPVS  119

Query  499  SRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVID--HGG  660
            SRKYE+VRSLAE+++DDN  + N+AL+EVNR VL+AAF RTL QLE+A+++  H G
Sbjct  120  SRKYEIVRSLAEKVVDDNHGENNEALREVNRGVLSAAFSRTLSQLEAAMMEIAHDG  175



>emb|CDO97440.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 16/175 (9%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            ME S  +M+  +L+ L+TSLF +ADK L  F    K  + +R  ++S+FLFFLR+LPS F
Sbjct  4    MEASLISMSPLLLRNLITSLFIFADKCLAFFSQNSKVFEGLRYVILSSFLFFLRILPSFF  63

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGG---------EPGIARALTQVLSIVTDIP  492
            PS +  P   YK       G+   P   GGGG         + GIARAL+Q+LSIV DIP
Sbjct  64   PSLDP-PEDKYK------NGDRYVPATVGGGGGGGATGCTGDSGIARALSQLLSIVNDIP  116

Query  493  VSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            VSSRKYEVVRSLAER+ID+NL + + AL+EVNRTVL+AAF RTL QLE+A++D G
Sbjct  117  VSSRKYEVVRSLAERIIDENLSENDDALREVNRTVLSAAFARTLSQLEAAMLDQG  171



>ref|XP_002323979.1| hypothetical protein POPTR_0017s08030g [Populus trichocarpa]
 gb|EEF04112.1| hypothetical protein POPTR_0017s08030g [Populus trichocarpa]
Length=386

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 112/173 (65%), Gaps = 7/173 (4%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSA----flfflrll  327
            ME SP  +A  +++ + T++F +ADK L+    K K L+ IR  LV++          L 
Sbjct  4    METSPITIAPMLIRNIATAMFIFADKSLVALAQKHKLLEHIRYLLVTSFLFFLRLLPSLF  63

Query  328  pslfpsfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRK  507
            PSL PS +     + ++  + K  +    +   G G+ GIARALTQ+LSIV DIPVSSRK
Sbjct  64   PSLSPSSDLQDHDNIQY-HHLKPLKTANYLPSSGYGDSGIARALTQLLSIVNDIPVSSRK  122

Query  508  YEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVID--HGG  660
            YE+VRSLAE+++DDN  + N+AL+EVNR VL+AAF RTL QLE+A+++  H G
Sbjct  123  YEIVRSLAEKVVDDNHGENNEALREVNRGVLSAAFSRTLSQLEAAMMEIAHDG  175



>emb|CAN83764.1| hypothetical protein VITISV_022124 [Vitis vinifera]
Length=295

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 115/160 (72%), Gaps = 15/160 (9%)
 Frame = +1

Query  193  VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsfNASPF---  363
            +L+ L TS+F YAD+ L+    KCK L+F+R FL+S FLFFL LLPSLFP    S     
Sbjct  15   LLRNLFTSIFIYADQSLLNLARKCKFLEFLRSFLISTFLFFLHLLPSLFPQNRTSKAPKT  74

Query  364  -QSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERL  540
             QSY           +   A GGGG+ GIARAL+QVLSIV+DIPVSSRKYEVVRSLAERL
Sbjct  75   DQSY-----------VAATAAGGGGDSGIARALSQVLSIVSDIPVSSRKYEVVRSLAERL  123

Query  541  IDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGG  660
            ID+NL +G +AL+EVNRTVL+A+F RTL QLE+A+ +  G
Sbjct  124  IDENLQEGLEALREVNRTVLSASFARTLNQLEAAMAEQRG  163



>ref|XP_002272705.1| PREDICTED: uncharacterized protein LOC100261012 [Vitis vinifera]
Length=375

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 115/160 (72%), Gaps = 15/160 (9%)
 Frame = +1

Query  193  VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsfNASPF---  363
            +L+ L TS+F YAD+ L+    KCK L+F+R FL+S FLFFL LLPSLFP    S     
Sbjct  15   LLRNLFTSIFIYADQSLLNLARKCKFLEFLRSFLISTFLFFLHLLPSLFPQNRTSKAPKT  74

Query  364  -QSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERL  540
             QSY           +   A GGGG+ GIARAL+QVLSIV+DIPVSSRKYEVVRSLAERL
Sbjct  75   DQSY-----------VAATAAGGGGDSGIARALSQVLSIVSDIPVSSRKYEVVRSLAERL  123

Query  541  IDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGG  660
            ID+NL +G +AL+EVNRTVL+A+F RTL QLE+A+ +  G
Sbjct  124  IDENLQEGLEALREVNRTVLSASFARTLNQLEAAMAEQRG  163



>ref|XP_010269304.1| PREDICTED: uncharacterized protein LOC104606004 [Nelumbo nucifera]
Length=377

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 114/170 (67%), Gaps = 6/170 (4%)
 Frame = +1

Query  154  LTMENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllps  333
            +TMENS TAMA  +L+ L+TS+F +ADK L+   ++ K LQFIR  L+   LFF R LPS
Sbjct  1    MTMENSTTAMAPFLLRNLITSIFIFADKSLLNLSERYKLLQFIRYLLIQLLLFFFRFLPS  60

Query  334  lfpsfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYE  513
            +FPS  A    +  F   S   +   P      G+ GIARAL+Q+LSI+ DIPVSSRKYE
Sbjct  61   IFPSLIAK--SAVDFPLKSHHVKREFPTQ----GDSGIARALSQILSIINDIPVSSRKYE  114

Query  514  VVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGE  663
             VR+LAE LID+NL +G ++L++VN++VL+ AF RTL  LE A+ +   E
Sbjct  115  TVRNLAENLIDENLREGCESLRKVNQSVLSTAFARTLCLLERAMSEQERE  164



>gb|KHF99141.1| hypothetical protein F383_18933 [Gossypium arboreum]
Length=392

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 1/166 (1%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MEN P+ ++  +L+++ +S+F YADK  I   +K K  + IR  L+++FLFFLRLL  LF
Sbjct  8    MENLPSTISPLLLRSMASSVFTYADKLFINLAEKFKPFEIIRYVLITSFLFFLRLLSFLF  67

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVV  519
             S      QS+ + FN  +      +   G  + GIARAL+QVLSIV DIPVSSRKY +V
Sbjct  68   LSDLPPKSQSHVYTFNPPKSNDRYLIG-SGVSDSGIARALSQVLSIVNDIPVSSRKYAIV  126

Query  520  RSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            RSLAE LI++N  +  + L+EVNR VL++AF RTL  LE+A+++ G
Sbjct  127  RSLAEGLIEENRREDAEGLREVNRAVLSSAFSRTLSYLEAAMVELG  172



>ref|XP_007199902.1| hypothetical protein PRUPE_ppa006716mg [Prunus persica]
 gb|EMJ01101.1| hypothetical protein PRUPE_ppa006716mg [Prunus persica]
Length=398

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 9/159 (6%)
 Frame = +1

Query  193  VLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsfNASPFQS-  369
            +++ L++S+F +ADK L+    K K LQ IRC LV++FLFFLR LP L PS +  P++  
Sbjct  13   LIRNLISSIFIFADKSLLNLSQKSKLLQLIRCVLVNSFLFFLRFLPPLDPSDDDVPYRKG  72

Query  370  --------YKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRS  525
                    +++ F      A+     GG     I RAL+Q+LS++ DIPVSSRKY+VVRS
Sbjct  73   HNKKSSNIHEYEFQRPSSVAVANTGSGGSTGSAIGRALSQLLSLMNDIPVSSRKYQVVRS  132

Query  526  LAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESA  642
            LAE LI+DN  +G +AL++VNRTVL+AAF RTL QLE+A
Sbjct  133  LAETLIEDNHKEGVEALRQVNRTVLSAAFSRTLGQLEAA  171



>ref|XP_004137277.1| PREDICTED: uncharacterized protein LOC101222931 [Cucumis sativus]
 gb|KGN53714.1| hypothetical protein Csa_4G109030 [Cucumis sativus]
Length=390

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 112/165 (68%), Gaps = 5/165 (3%)
 Frame = +1

Query  163  ENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfp  342
            E SPT +A  +L+ L TSLF +ADK LI    K K LQ I   ++S+FLFFLRLLPSLFP
Sbjct  5    EASPTTLAPLLLRNLATSLFVFADKSLINLSKKYKLLQLIHALIISSFLFFLRLLPSLFP  64

Query  343  sfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVR  522
            S +      Y    + K G        GG G+ G++RALTQ+LSI++ IPVSSRKYEVVR
Sbjct  65   SIHTVSDDCYPLK-SPKDG----SYGTGGSGDLGVSRALTQLLSIISHIPVSSRKYEVVR  119

Query  523  SLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            SLAE+LID+N  +G + L+EVNR VL+ AF R++  +E+ +I+ G
Sbjct  120  SLAEKLIDENHWEGIEELREVNRVVLSTAFDRSIGLIEAGMIERG  164



>ref|XP_009337875.1| PREDICTED: uncharacterized protein LOC103930287 isoform X2 [Pyrus 
x bretschneideri]
Length=402

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 110/179 (61%), Gaps = 14/179 (8%)
 Frame = +1

Query  166  NSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfps  345
            +SPT ++  +L+ L+ S+F +ADK  +    K K LQ +R   V++F+F LRLLP L P+
Sbjct  7    SSPTTVSPLLLRNLVASVFIFADKSFLNLSQKSKLLQLLRYVFVTSFIFLLRLLPPLNPN  66

Query  346  fNASPFQSYKFCFNSKRGEA-------LCPVADGG------GGEPGIARALTQVLSIVTD  486
                P+      FN     +         P + GG      GG+  I RAL+Q+LS+V D
Sbjct  67   NT-QPYHYKPPTFNKSSNHSTTHDHYDYTPASSGGAATITCGGDSAIGRALSQLLSLVND  125

Query  487  IPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGE  663
            IPV+SRKY+VVRSLAE LIDDN  +G +AL++VNRTVL+AAF  TL QLE+A     G+
Sbjct  126  IPVTSRKYQVVRSLAESLIDDNQKEGVEALRQVNRTVLSAAFSTTLSQLEAAAALEQGD  184



>ref|XP_009337874.1| PREDICTED: uncharacterized protein LOC103930287 isoform X1 [Pyrus 
x bretschneideri]
Length=402

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 110/179 (61%), Gaps = 14/179 (8%)
 Frame = +1

Query  166  NSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfps  345
            +SPT ++  +L+ L+ S+F +ADK  +    K K LQ +R   V++F+F LRLLP L P+
Sbjct  7    SSPTTVSPLLLRNLVASVFIFADKSFLNLSQKSKLLQLLRYVFVTSFIFLLRLLPPLNPN  66

Query  346  fNASPFQSYKFCFNSKRGEA-------LCPVADGG------GGEPGIARALTQVLSIVTD  486
                P+      FN     +         P + GG      GG+  I RAL+Q+LS+V D
Sbjct  67   NT-QPYHYKPPTFNKSSNHSTTHDHYDYTPASSGGAATITCGGDSAIGRALSQLLSLVND  125

Query  487  IPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGE  663
            IPV+SRKY+VVRSLAE LIDDN  +G +AL++VNRTVL+AAF  TL QLE+A     G+
Sbjct  126  IPVTSRKYQVVRSLAESLIDDNQKEGVEALRQVNRTVLSAAFSTTLSQLEAAAALEQGD  184



>ref|XP_009344578.1| PREDICTED: uncharacterized protein LOC103936468 [Pyrus x bretschneideri]
Length=398

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 111/177 (63%), Gaps = 16/177 (9%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfp--  342
            SPT ++  +L+  + SLF +ADK  +   +K K LQ +R   V++FLF LR LP L P  
Sbjct  8    SPTTISPLLLRNFIASLFIFADKSFLNLSEKSKLLQLLRYTFVTSFLFLLRFLPPLNPNN  67

Query  343  -------sfNASPFQS--YKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPV  495
                   + NAS   S  Y +   S  G A       GGG+  I RAL+Q+LS+V DIPV
Sbjct  68   NQPYKPPNKNASNHTSDHYDYTPASFSGGATIT----GGGDSAITRALSQLLSLVNDIPV  123

Query  496  SSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLE-SAVIDHGGE  663
            SSRKY+VVRSLAE LIDDN  +G +AL++VN TVL+AAF  TL QLE +A+++  GE
Sbjct  124  SSRKYQVVRSLAENLIDDNHKEGVEALRQVNLTVLSAAFSTTLSQLEAAAILEQQGE  180



>gb|KJB32061.1| hypothetical protein B456_005G221000 [Gossypium raimondii]
Length=392

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 108/164 (66%), Gaps = 1/164 (1%)
 Frame = +1

Query  166  NSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfps  345
            N P+ ++  +L+++ +S+F YADK      +K K  + IR  L+++FLFFLRLL  LF S
Sbjct  10   NLPSTISPLLLRSMASSVFIYADKLFFNLAEKFKPFEIIRYVLITSFLFFLRLLSFLFLS  69

Query  346  fNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRS  525
                  QS+ + FN  +      +   G  + GIARAL+QVLSIV DIPVSSRKY +VRS
Sbjct  70   DLPPKSQSHVYTFNPPKSNGRYLIG-SGVSDSGIARALSQVLSIVNDIPVSSRKYAIVRS  128

Query  526  LAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            LAE LI++N  +  + L+EVNR VL++AF RTL  LE+A+++ G
Sbjct  129  LAEGLIEENRREDAEGLREVNRAVLSSAFSRTLSYLEAAMVELG  172



>ref|XP_010520922.1| PREDICTED: uncharacterized protein LOC104799930 [Tarenaya hassleriana]
Length=371

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsf  348
            S  AMA  +L+ L+ S  F+ADK L+    K + L  +R  LVS FLFFLR LPS+F   
Sbjct  5    SAAAMAPQLLRNLIISALFFADKALLYLPVKWQLLDKLRFLLVSCFLFFLRSLPSVFCP-  63

Query  349  NASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSL  528
            +A   +++KF   +     L P +  GGG+ GIARA++Q+LS + +IPVSSRKYEVVRSL
Sbjct  64   DADSSKAFKFSSKNHESTDLSPTS-AGGGDSGIARAISQLLSSMNEIPVSSRKYEVVRSL  122

Query  529  AERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            AERLID+N  + + +L +VNR VL A+F RTL +LE+AV
Sbjct  123  AERLIDENRGENSASLIDVNRRVLTASFARTLGRLEAAV  161



>ref|XP_004290342.1| PREDICTED: uncharacterized protein LOC101311058 [Fragaria vesca 
subsp. vesca]
Length=392

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 103/163 (63%), Gaps = 3/163 (2%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            ME S +     + + L+TSLF  A+  +     K K L+ IR   +S+FLFFLRLL SL 
Sbjct  2    MEGSSSVTPL-LFRNLITSLFILAETSISSLTQKHKTLELIRYVFISSFLFFLRLLLSLN  60

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGG--GEPGIARALTQVLSIVTDIPVSSRKYE  513
            P    +   S      S+R     P A+ GG   +  IARAL+Q+LSIV DIPVSSRKY+
Sbjct  61   PRSTKNNESSLYEADCSRRNHKFMPAANAGGDDSDTAIARALSQLLSIVNDIPVSSRKYQ  120

Query  514  VVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESA  642
             VRSLAE +I DN  +G +AL++VNRTVL+AAF RTL QLE+A
Sbjct  121  AVRSLAENVIHDNQREGVEALRQVNRTVLSAAFSRTLSQLEAA  163



>gb|KJB77540.1| hypothetical protein B456_012G142500 [Gossypium raimondii]
Length=364

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 105/171 (61%), Gaps = 12/171 (7%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENS T MA  +L+  + S+  YADK L+    K K L+ IR  +V+AFLFFLRL  S  
Sbjct  4    MENSATVMAPLLLRNTVKSVLIYADKSLLNLAGKYKLLEIIRYLIVTAFLFFLRLFLS--  61

Query  340  psfNASPFQSYKFCFNSKRGEALCP-----VADGGGGEPGIARALTQVLSIVTDIPVSSR  504
                  P  +Y     S  G    P     +AD G G+ GI R+L Q+L  V DIPVSS 
Sbjct  62   ----FFP-SNYLHSLKSDDGYTFKPTQSSYIADSGIGDSGIGRSLWQLLVSVNDIPVSST  116

Query  505  KYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            KY +VRSLAERLI+ N  +  +AL+EVNR VL+AAF RT+ ++E+A+I+ G
Sbjct  117  KYGIVRSLAERLIEGNNREDVEALREVNRRVLSAAFSRTICRVEAALIELG  167



>gb|KJB77539.1| hypothetical protein B456_012G142500 [Gossypium raimondii]
Length=374

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 105/171 (61%), Gaps = 12/171 (7%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENS T MA  +L+  + S+  YADK L+    K K L+ IR  +V+AFLFFLRL  S  
Sbjct  4    MENSATVMAPLLLRNTVKSVLIYADKSLLNLAGKYKLLEIIRYLIVTAFLFFLRLFLS--  61

Query  340  psfNASPFQSYKFCFNSKRGEALCP-----VADGGGGEPGIARALTQVLSIVTDIPVSSR  504
                  P  +Y     S  G    P     +AD G G+ GI R+L Q+L  V DIPVSS 
Sbjct  62   ----FFP-SNYLHSLKSDDGYTFKPTQSSYIADSGIGDSGIGRSLWQLLVSVNDIPVSST  116

Query  505  KYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            KY +VRSLAERLI+ N  +  +AL+EVNR VL+AAF RT+ ++E+A+I+ G
Sbjct  117  KYGIVRSLAERLIEGNNREDVEALREVNRRVLSAAFSRTICRVEAALIELG  167



>ref|XP_008348814.1| PREDICTED: uncharacterized protein LOC103411982 [Malus domestica]
Length=401

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 106/170 (62%), Gaps = 14/170 (8%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsf  348
            SPT ++  +L+ L+ S+F +ADK  +    K K LQ +R   V++F+F LRLLPSL P+ 
Sbjct  8    SPTTVSPLLLRNLVASVFIFADKSFLNLSQKSKLLQLLRYLFVTSFIFLLRLLPSLNPN-  66

Query  349  NASPFQSYKFCFNSKRGEA-------LCPVADGG------GGEPGIARALTQVLSIVTDI  489
            N  P+      FN     +         P + G       GG+  I RAL+Q+LS+V DI
Sbjct  67   NTQPYHYKPPTFNKSSNHSTTHDHYDYTPASSGSAXTITSGGDSAIGRALSQLLSLVNDI  126

Query  490  PVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLES  639
            PV+SRKY+VVRSLAE LIDDN  +G +AL++V RTVL+AAF  TL QLE+
Sbjct  127  PVTSRKYQVVRSLAESLIDDNQKEGVEALRQVTRTVLSAAFSTTLSQLEA  176



>ref|XP_008342511.1| PREDICTED: uncharacterized protein LOC103405323 [Malus domestica]
Length=307

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 112/177 (63%), Gaps = 16/177 (9%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfp--  342
            SPT ++  +L+ L+ SLF +ADK  +   +K K LQ +R   V++FLF LR LP L P  
Sbjct  8    SPTTISPLLLRNLIASLFIFADKSFLNLSEKSKLLQLLRYTFVTSFLFLLRFLPPLNPNN  67

Query  343  -------sfNASPFQS--YKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPV  495
                   + NAS   S  Y +  +S            GGG+  IARAL+Q+LS+V DIPV
Sbjct  68   NQPYKPPNKNASDHTSDHYDYTLSS----CGGGATITGGGDSAIARALSQLLSLVNDIPV  123

Query  496  SSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVI-DHGGE  663
            +SRKY+VVRSLAE LIDDN  +G +AL++VNRTVL+AAF  TL QLE+A I +  GE
Sbjct  124  NSRKYQVVRSLAENLIDDNHKEGVEALRQVNRTVLSAAFSTTLSQLEAATILEQQGE  180



>ref|XP_012069136.1| PREDICTED: uncharacterized protein LOC105631579 [Jatropha curcas]
Length=381

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 111/168 (66%), Gaps = 5/168 (3%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            +E+ PTA+A  +L+ L+  +F +ADK LI   +K K L+++R  L++ F F LRLLPS  
Sbjct  4    VESPPTAIASLLLRNLVAPIFIFADKSLINLGEKYKFLEYLRYILMTCFFFLLRLLPSFL  63

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVV  519
            PS N +   +     ++K G  L       G + GIARAL+Q+L+ + DIPVSSRKYE++
Sbjct  64   PSSNPN-LDNNHLTKSTKSGNYLL----SHGSDSGIARALSQILTAINDIPVSSRKYELL  118

Query  520  RSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHGGE  663
            RSLAER+I++N  +  + L+EVN   L+AAF RTL QLE+ V++ G +
Sbjct  119  RSLAERVIEENEKENVEILREVNGKSLSAAFERTLNQLEAGVMELGND  166



>ref|XP_008462861.1| PREDICTED: uncharacterized protein LOC103501143 [Cucumis melo]
Length=394

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = +1

Query  163  ENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfp  342
            E SPT +A  +L+ L TSLF +ADK LI    K K LQ I   ++S+FLFFLRLLPSLFP
Sbjct  5    EASPTTLAPLLLRNLATSLFVFADKSLINLAKKYKILQIIHALIISSFLFFLRLLPSLFP  64

Query  343  sfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVR  522
            S ++     Y      K G         G G+ G++RALTQ+LSI++ +PVSSRKYEVVR
Sbjct  65   SIHSVSDDRYPLK-PPKGGSYGTGGIGSGSGDLGVSRALTQLLSIISHVPVSSRKYEVVR  123

Query  523  SLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            SLAE+LID+N  +G + L+EVNR VL+AAF RT+  +E+ +I+ G
Sbjct  124  SLAEKLIDENHWEGIEELREVNRVVLSAAFDRTIGLIEAGMIERG  168



>ref|XP_011087891.1| PREDICTED: uncharacterized protein LOC105169231 [Sesamum indicum]
Length=476

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 108/167 (65%), Gaps = 8/167 (5%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENS +A+A  +L+  LTS+F  ADK L     K K LQ +R FLVS+FLFFL LLP+ F
Sbjct  1    MENSASAVAPLLLRNFLTSIFILADKSLFSLSQKYKLLQLLRSFLVSSFLFFLSLLPAFF  60

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGG-------EPGIARALTQVLSIVTDIPVS  498
             S N S  + +   FNS R +       G            G++RAL+Q+L I+ DIPVS
Sbjct  61   SSLNPS-LEPHHHSFNSARDDTYSGTGVGTDAAGRGKGGGSGVSRALSQLLLIMNDIPVS  119

Query  499  SRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLES  639
            SRKYEVVRSLAE+LID+NLL  N+AL+EVN  VL+ AF  +L QLE+
Sbjct  120  SRKYEVVRSLAEKLIDENLLQDNRALREVNCAVLSTAFATSLSQLEA  166


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  424  GGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLA  603
            G GG  G++RAL+Q+L I+ DIPVSSRKYEVVRSLAE+LID+NLL  N+AL+EVN  VL+
Sbjct  172  GDGGGSGVSRALSQLLLIMNDIPVSSRKYEVVRSLAEKLIDENLLQDNRALREVNCAVLS  231

Query  604  AAFCRTLKQLES  639
             AF  +L QLE+
Sbjct  232  TAFATSLSQLEA  243



>gb|KJB77538.1| hypothetical protein B456_012G142400 [Gossypium raimondii]
Length=333

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENS   MA  +L+  +TSL  YADK ++V  +K K L+  R  ++++FLFFLRL PS  
Sbjct  4    MENSAVFMAPLLLRNTVTSLLVYADKSILVLAEKYKVLEIFRYLVIASFLFFLRLFPSFS  63

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVV  519
                A       + FNS +  +   V  GG G+ GI RAL+Q+L  V DIPVSS KY +V
Sbjct  64   QFLKADD----DYTFNSTQS-SGYFVGYGGVGDTGIGRALSQLLWSVNDIPVSSSKYGIV  118

Query  520  RSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            RSLAERLI++N  +  +AL+E+NRTVL+AAF RTL  +E+A+++ G
Sbjct  119  RSLAERLIEENNKEDIEALREMNRTVLSAAFSRTLCLVEAAMVELG  164



>gb|KJB77537.1| hypothetical protein B456_012G142400 [Gossypium raimondii]
Length=370

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENS   MA  +L+  +TSL  YADK ++V  +K K L+  R  ++++FLFFLRL PS  
Sbjct  4    MENSAVFMAPLLLRNTVTSLLVYADKSILVLAEKYKVLEIFRYLVIASFLFFLRLFPSFS  63

Query  340  psfNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVV  519
                A       + FNS +  +   V  GG G+ GI RAL+Q+L  V DIPVSS KY +V
Sbjct  64   QFLKADD----DYTFNSTQS-SGYFVGYGGVGDTGIGRALSQLLWSVNDIPVSSSKYGIV  118

Query  520  RSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            RSLAERLI++N  +  +AL+E+NRTVL+AAF RTL  +E+A+++ G
Sbjct  119  RSLAERLIEENNKEDIEALREMNRTVLSAAFSRTLCLVEAAMVELG  164



>ref|XP_010030036.1| PREDICTED: uncharacterized protein LOC104419903 [Eucalyptus grandis]
 gb|KCW56985.1| hypothetical protein EUGRSUZ_I02660 [Eucalyptus grandis]
Length=413

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 113/174 (65%), Gaps = 16/174 (9%)
 Frame = +1

Query  166  NSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfps  345
            NS TA+A  +L+ L+TS F +ADK  +   +K + L+ +R  ++S+FLFFL  LPSLFPS
Sbjct  20   NSLTAIAPLLLRNLVTSAFIFADKSFLSLAEKYRLLELLRYLVLSSFLFFLSFLPSLFPS  79

Query  346  fNASPFQSYKFCFNSKRGEALCPVADGGGGEP------------GIARALTQVLSIVTDI  489
              + P  +      S     L P     GG P            GIARAL+Q+L+IV ++
Sbjct  80   SASPPSPAAPHDGRS----LLRPPKPAAGGGPRAAPPHSAACDSGIARALSQLLAIVNNV  135

Query  490  PVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVID  651
            PVSSRKYE VRSLAERLID+N  +G +AL EVNRTVL+AAF RTL QLE+A+++
Sbjct  136  PVSSRKYEAVRSLAERLIDENQQEGTEALLEVNRTVLSAAFSRTLSQLEAAMVE  189



>ref|XP_010690509.1| PREDICTED: uncharacterized protein LOC104904034 [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 101/175 (58%), Gaps = 19/175 (11%)
 Frame = +1

Query  154  LTMENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllps  333
            + ++NS + + F +L++++T LF  ADK L+    K K LQ +RC  VS FLF L     
Sbjct  3    MIIDNSLSPL-FLLLRSIITPLFMSADKSLLFLSKKSKILQLLRCLFVSVFLFIL-----  56

Query  334  lfpsfNASPFQSYKFCFNSKRG----EALC----PVADGGGGEPGIARALTQVLSIVTDI  489
                 +A    S K   N   G    E L           G +  IARA+ Q+L++V  I
Sbjct  57   -----HAVHSVSSKVVKNGDHGYDHDEQLVNSSGTTMTDRGSDTAIARAIYQLLTLVNSI  111

Query  490  PVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDH  654
              SSRKYEVVRSL E+LID+NL +G++AL++VN  VL+ AF +T+ QLE+ ++D 
Sbjct  112  STSSRKYEVVRSLVEKLIDENLKEGSEALRQVNCVVLSEAFGKTISQLEADLLDQ  166



>ref|XP_009130442.1| PREDICTED: uncharacterized protein LOC103855230 [Brassica rapa]
Length=369

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsf  348
            S +A+   +L+ ++ ++  +AD+ L+      K L+ +R FLV+ FLFFLR +PS+    
Sbjct  5    SSSAVVPQLLRNVIIAVLVFADESLLQISANSKLLEKLRLFLVACFLFFLRSIPSVVSFA  64

Query  349  NASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSL  528
            N +P + Y F    K+ E    + D    E GI RA+ Q+LS + DIPV+SRKYEVVRSL
Sbjct  65   NTNPTRGYTFPEKKKKLE----IGDCAS-ESGIGRAIWQLLSAMNDIPVNSRKYEVVRSL  119

Query  529  AERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            AERLID+N    + AL ++NR VL A+F RTL +LE+AV
Sbjct  120  AERLIDENHGQNSLALFDLNRRVLNASFRRTLGRLEAAV  158



>ref|XP_010094145.1| hypothetical protein L484_017184 [Morus notabilis]
 gb|EXB55278.1| hypothetical protein L484_017184 [Morus notabilis]
Length=302

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 107/177 (60%), Gaps = 18/177 (10%)
 Frame = +1

Query  157  TMENSPTAMAFSVL--KTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllp  330
             ME +  A+  + L  + +++S F YAD  L+    K K LQ  R  +++ FLF LR LP
Sbjct  3    AMELASPALTIAPLLVRNIVSSAFMYADSSLLSLSQKHKLLQHCRSLILTIFLFVLRALP  62

Query  331  slfpsfNASPFQSYKFCFNSKRGE-ALCPVADGG------------GGEPGIARALTQVL  471
            SLFPS +   F    F   SK+ +    P +D G             G+ GIARAL+Q+L
Sbjct  63   SLFPSLD---FDLDSFHKPSKKDDFYYVPTSDDGDGDRIRTASLSFAGDSGIARALSQLL  119

Query  472  SIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESA  642
            SI  +IPVSSRKYEVV  L E++IDDN  +G  AL++VNRTVL+AAF RTL QLE+A
Sbjct  120  SIANEIPVSSRKYEVVWLLVEKIIDDNQKNGAPALRKVNRTVLSAAFARTLCQLEAA  176



>emb|CDY31332.1| BnaA02g34090D [Brassica napus]
Length=369

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 102/159 (64%), Gaps = 5/159 (3%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsf  348
            S +A+   +L+ ++ ++  +AD+ L+      K L+ +R FLV+ FLFFLR +PS+    
Sbjct  5    SSSAVVPQLLRNVIIAVLVFADESLLQISANSKLLEKLRLFLVACFLFFLRSIPSVVSFA  64

Query  349  NASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSL  528
            N +P + Y F    K+ E    + D    E GI RA+ Q+LS + DIPV+SRKYEVVRSL
Sbjct  65   NTNPTRGYTFPEKKKKLE----IGDCAS-ESGIGRAIWQLLSAMNDIPVNSRKYEVVRSL  119

Query  529  AERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            AERLID+N    + A+ ++NR VL A+F RTL +LE+AV
Sbjct  120  AERLIDENHGQNSLAVFDLNRRVLNASFRRTLGRLEAAV  158



>emb|CDY63725.1| BnaC02g48850D [Brassica napus]
Length=371

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsf  348
            S +A+   +L+ ++ ++  +AD+ L+      K L+ +R FLV+ FLFFLR +PS+    
Sbjct  5    SSSAVVPQLLRNVIIAVVVFADESLLQISANSKLLEKLRLFLVACFLFFLRSIPSVVSFP  64

Query  349  NASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSL  528
            N++P + Y F    K+ +    + D    E GI RA+ Q+LS + DIPV+SRKYEVVRSL
Sbjct  65   NSNPTRGYTFPAEKKKKK--LEIGDCAS-ESGIGRAIWQLLSAMNDIPVNSRKYEVVRSL  121

Query  529  AERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            AERLID+N    + AL ++NR VL A+F RTL +LE+AV
Sbjct  122  AERLIDENHGQDSLALFDLNRRVLNASFRRTLGRLEAAV  160



>gb|KHG29062.1| 1,8-cineole synthase, chloroplastic [Gossypium arboreum]
Length=366

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 103/175 (59%), Gaps = 27/175 (15%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            MENS   MA  +L+  +TSL  YADK ++V  +K K L+  R  ++++F           
Sbjct  4    MENSAIFMAPLLLRNTVTSLLVYADKSILVLAEKYKVLEIFRYLVIASF-----------  52

Query  340  psfNASPF---------QSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIP  492
                  PF         QS K   +S +  +   V  GG G+ GI RAL+Q+L  V DIP
Sbjct  53   ------PFFLRLFPSFSQSLKADDDSTQS-SGYFVGYGGVGDSGIGRALSQLLWSVNDIP  105

Query  493  VSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVIDHG  657
            VSS KY +VRSLAE+LI++N  +  +AL+E+NRTVL+AAF RTL  +E+A+++ G
Sbjct  106  VSSSKYGIVRSLAEQLIEENNKEDIEALREMNRTVLSAAFSRTLCLVEAAMLELG  160



>ref|XP_004485586.1| PREDICTED: uncharacterized protein LOC101515692 [Cicer arietinum]
Length=387

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  433  GEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAF  612
             +  I RAL+Q+LS + DIPVSSRKYEVVRSL E++IDDN  DG  +L+EVNR  LAAAF
Sbjct  99   NDTAIGRALSQLLSALNDIPVSSRKYEVVRSLTEKIIDDNHNDGVHSLREVNRVALAAAF  158

Query  613  CRTLKQLESAV  645
             R L+QLE  V
Sbjct  159  GRALRQLEGKV  169



>dbj|BAE71289.1| hypothetical protein [Trifolium pratense]
Length=375

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  433  GEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAF  612
             +  I RAL+Q+LS + DIPVSSRKYEVVRSL E++IDDN LDG  +L+EVNR  L+ AF
Sbjct  89   NDTAIGRALSQLLSALNDIPVSSRKYEVVRSLTEKIIDDNHLDGVHSLREVNRVALSTAF  148

Query  613  CRTLKQLESAV  645
             R L QLE  V
Sbjct  149  GRALNQLEGKV  159



>gb|KDP40903.1| hypothetical protein JCGZ_24902 [Jatropha curcas]
Length=333

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  430  GGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAA  609
            G + GIARAL+Q+L+ + DIPVSSRKYE++RSLAER+I++N  +  + L+EVN   L+AA
Sbjct  41   GSDSGIARALSQILTAINDIPVSSRKYELLRSLAERVIEENEKENVEILREVNGKSLSAA  100

Query  610  FCRTLKQLESAVIDHGGE  663
            F RTL QLE+ V++ G +
Sbjct  101  FERTLNQLEAGVMELGND  118



>ref|NP_568987.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED97858.1| uncharacterized protein AT5G64230 [Arabidopsis thaliana]
Length=379

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 100/160 (63%), Gaps = 1/160 (1%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsf  348
            S  A+   +L+ ++ ++  +AD+ L+      K L+ +R FLV+ FLFFLR LPS+    
Sbjct  5    SSAAVVPQLLRNIIVAVVVFADESLLQISGNSKLLEKLRVFLVTCFLFFLRSLPSIVSFA  64

Query  349  N-ASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRS  525
            N  S   S+   ++SK  +    +      E GI RA+ Q+LS + +IPVSSRKY+VVRS
Sbjct  65   NPNSSVVSFANPYSSKTKKKNKILVINHCEESGIGRAIWQLLSAMNEIPVSSRKYQVVRS  124

Query  526  LAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            LAERLI+DN  + + AL ++NR VL A+F  TL +LE+AV
Sbjct  125  LAERLINDNQGENSVALLDLNRRVLNASFRTTLSRLETAV  164



>dbj|BAB09854.1| unnamed protein product [Arabidopsis thaliana]
Length=403

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 100/160 (63%), Gaps = 1/160 (1%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfpsf  348
            S  A+   +L+ ++ ++  +AD+ L+      K L+ +R FLV+ FLFFLR LPS+    
Sbjct  5    SSAAVVPQLLRNIIVAVVVFADESLLQISGNSKLLEKLRVFLVTCFLFFLRSLPSIVSFA  64

Query  349  N-ASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRS  525
            N  S   S+   ++SK  +    +      E GI RA+ Q+LS + +IPVSSRKY+VVRS
Sbjct  65   NPNSSVVSFANPYSSKTKKKNKILVINHCEESGIGRAIWQLLSAMNEIPVSSRKYQVVRS  124

Query  526  LAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            LAERLI+DN  + + AL ++NR VL A+F  TL +LE+AV
Sbjct  125  LAERLINDNQGENSVALLDLNRRVLNASFRTTLSRLETAV  164



>ref|XP_003593210.1| hypothetical protein MTR_2g008960 [Medicago truncatula]
 gb|AES63461.1| transmembrane protein, putative [Medicago truncatula]
Length=374

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  433  GEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAF  612
             +  I RAL+Q+LS + DIPVSSRKYEVVRSL E++IDDN LDG  +L+EVNR  L++AF
Sbjct  94   NDTAIGRALSQLLSALNDIPVSSRKYEVVRSLTEKIIDDNHLDGVHSLREVNRVALSSAF  153

Query  613  CRTLKQLESAVID  651
             R L QLE  V +
Sbjct  154  GRALGQLEVKVAE  166



>gb|ADE77727.1| unknown [Picea sitchensis]
Length=425

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  424  GGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLA  603
            GG     I RALTQVL++V DIPV+SRKYE  R LA+++I++N   G   LQE+NRT L+
Sbjct  129  GGSSGKAIGRALTQVLTLVNDIPVTSRKYEFARDLADKIIEENAKQGGPTLQEINRTALS  188

Query  604  AAFCRTLKQLESAV  645
            + F RTLK L S++
Sbjct  189  SGFARTLKLLNSSL  202



>ref|XP_010461545.1| PREDICTED: uncharacterized protein LOC104742256 [Camelina sativa]
Length=383

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 7/160 (4%)
 Frame = +1

Query  166  NSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslfps  345
            +S  A+   +L+ ++ ++  +AD+ LI    K K L+ +R FLV A   F          
Sbjct  6    SSAAAVVPQLLRNIIIAVVVFADESLIHVSGKSKLLEKLRMFLV-ACFLFFLRSFPSVVV  64

Query  346  fNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRS  525
              A+P  + +    +K+ + L  ++D    E GI RA+ Q+LS + +IPVSSRKY+VVRS
Sbjct  65   SFANPNPTRRMTTKNKK-KKLEMISDCE--ESGIGRAIWQLLSAMNEIPVSSRKYQVVRS  121

Query  526  LAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            LAERLI++N      AL ++NR VL A+F RTL +LE+AV
Sbjct  122  LAERLIEEN---HGFALFDLNRRVLNASFSRTLSRLEAAV  158



>ref|XP_010939663.1| PREDICTED: uncharacterized protein LOC105058425 [Elaeis guineensis]
Length=388

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 4/76 (5%)
 Frame = +1

Query  412  PVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKA-LQEVN  588
            P ADG       ARAL  VLS+V  +PV+SRKYE+VRSLAER +DDNL  G  A L E+N
Sbjct  98   PAADGTSAP---ARALAHVLSLVARVPVASRKYELVRSLAERFLDDNLRLGAAAGLDELN  154

Query  589  RTVLAAAFCRTLKQLE  636
            R  L+AAFCRTL+ LE
Sbjct  155  RDALSAAFCRTLRLLE  170



>ref|XP_002454249.1| hypothetical protein SORBIDRAFT_04g027520 [Sorghum bicolor]
 gb|EES07225.1| hypothetical protein SORBIDRAFT_04g027520 [Sorghum bicolor]
Length=381

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +1

Query  430  GGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAA  609
             G+    RAL  VLS+ + +PV+SRKYE+VR LAERL+DDN+  G   +  V+RT LA A
Sbjct  104  AGDTCAGRALAHVLSVASRLPVASRKYELVRGLAERLLDDNVRAGGDRVGAVSRTALAGA  163

Query  610  FCRTLKQLESAVIDHGGE  663
            F RTL+QLESA    GGE
Sbjct  164  FSRTLRQLESAA---GGE  178



>gb|KFK28114.1| hypothetical protein AALP_AA8G474500 [Arabis alpina]
Length=367

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +1

Query  355  SPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAE  534
            S  Q +KF    K+ E    + D    + GI RA+ ++LS + +IPV+SRKYEVVR+LAE
Sbjct  58   SSNQPFKFTTEKKKLE----IGDYAS-DSGIGRAIWELLSAMNEIPVNSRKYEVVRTLAE  112

Query  535  RLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            RLI++N  + +  L  +NR VL A+F RTL +LESAV
Sbjct  113  RLIEENHGENSTVLFHLNRRVLNASFNRTLNRLESAV  149



>ref|XP_010484194.1| PREDICTED: uncharacterized protein LOC104762577 [Camelina sativa]
Length=381

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 95/160 (59%), Gaps = 10/160 (6%)
 Frame = +1

Query  169  SPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrll-pslfps  345
            S  A+   +L+ ++ ++  +AD+ LI    K K L+ +R FLV+ FLFFLR     +   
Sbjct  7    SAAAVVPQLLRNIIIAVVIFADESLIHVSGKSKLLEKLRLFLVACFLFFLRSFPSVVVSF  66

Query  346  fNASPFQSYKFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRS  525
             N +P +             L  ++D    E GI RA+ Q+LS + +IPVSSRKY+VVRS
Sbjct  67   ANPNPTKMTTKKKKK----KLQMISDCE--ESGIGRAIWQLLSAMNEIPVSSRKYQVVRS  120

Query  526  LAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            LAERLI++N      AL ++NR VL A+F RTL +LE+AV
Sbjct  121  LAERLIEEN---HGFALFDLNRRVLNASFSRTLSRLEAAV  157



>gb|EEC74030.1| hypothetical protein OsI_08983 [Oryza sativa Indica Group]
Length=304

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 8/90 (9%)
 Frame = +1

Query  394  RGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKA  573
            R +  CP      G   + RAL  VLS+ + +PV+SRKYE+VR LAERL+DDN   G   
Sbjct  23   RADPGCPA-----GASCVGRALAHVLSVASRLPVASRKYELVRGLAERLLDDNARGGGAR  77

Query  574  LQEVNRTVLAAAFCRTLKQLESAVIDHGGE  663
            +  VNR  L+ AF RTL+QL++A    GGE
Sbjct  78   IGAVNRAALSGAFARTLRQLDAAA---GGE  104



>ref|XP_002864888.1| hypothetical protein ARALYDRAFT_496623 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41147.1| hypothetical protein ARALYDRAFT_496623 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  436  EPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFC  615
            E GI RA+ Q+LS + +IPVSSRKY+VVRSLAERLID+N  + + AL ++NR VL A+F 
Sbjct  121  ESGIGRAIWQLLSAMNEIPVSSRKYQVVRSLAERLIDENQGENSIALFDLNRRVLNASFR  180

Query  616  RTLKQLESAV  645
             TL +LE+AV
Sbjct  181  TTLSRLEAAV  190



>ref|XP_006280766.1| hypothetical protein CARUB_v10026735mg [Capsella rubella]
 gb|EOA13664.1| hypothetical protein CARUB_v10026735mg [Capsella rubella]
Length=339

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +1

Query  436  EPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFC  615
            E GI RA+ Q+LS + +IPVSSRKY+VVRSLAERLI++N    + AL ++NR VL A+F 
Sbjct  79   ESGIGRAIWQLLSAMNEIPVSSRKYQVVRSLAERLIEENHAGNSIALFDLNRRVLNASFR  138

Query  616  RTLKQLESA  642
            RTL +LE+A
Sbjct  139  RTLSRLEAA  147



>ref|NP_001048156.1| Os02g0754600 [Oryza sativa Japonica Group]
 dbj|BAD17241.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10070.1| Os02g0754600 [Oryza sativa Japonica Group]
 gb|EEE57829.1| hypothetical protein OsJ_08427 [Oryza sativa Japonica Group]
Length=380

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 8/90 (9%)
 Frame = +1

Query  394  RGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKA  573
            R +  CP      G   + RAL  VLS+ + +PV+SRKYE+VR LAERL+DDN   G   
Sbjct  99   RADPGCPA-----GASCVGRALAHVLSVASRLPVASRKYELVRGLAERLLDDNARGGGAR  153

Query  574  LQEVNRTVLAAAFCRTLKQLESAVIDHGGE  663
            +  VNR  L+ AF RTL+QL++A    GGE
Sbjct  154  IGAVNRAALSGAFARTLRQLDAAA---GGE  180



>ref|XP_004955218.1| PREDICTED: uncharacterized protein LOC101770073 [Setaria italica]
Length=438

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 57/86 (66%), Gaps = 8/86 (9%)
 Frame = +1

Query  412  PVADGG--GGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEV  585
            P A+ G   G+  + RAL  VLS+ + +PV+SRKYE+VR LAERL+DDN+     A   V
Sbjct  159  PRAEPGSPAGDTCVGRALAHVLSVASRLPVASRKYELVRGLAERLLDDNVRARAGA---V  215

Query  586  NRTVLAAAFCRTLKQLESAVIDHGGE  663
            NR  LA AF RTL+QLESA    GGE
Sbjct  216  NRAALAGAFARTLRQLESAA---GGE  238



>ref|XP_010444356.1| PREDICTED: uncharacterized protein LOC104727054 [Camelina sativa]
Length=379

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +1

Query  436  EPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFC  615
            E GI RA+ Q+LS + +IPVSSRKY+VVRSLAERLI++N      AL ++NR VL A+F 
Sbjct  88   ESGIGRAIWQLLSAMNEIPVSSRKYQVVRSLAERLIEEN---HGFALFDLNRRVLNASFS  144

Query  616  RTLKQLESAV  645
            RTL +LE+AV
Sbjct  145  RTLSRLEAAV  154



>gb|ACJ84769.1| unknown [Medicago truncatula]
Length=162

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  433  GEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNR  591
             +  I RAL+Q+LS + DIPVSSRKYEVVRSL E++IDDN LDG  +L+EVNR
Sbjct  94   NDTAIGRALSQLLSALNDIPVSSRKYEVVRSLTEKIIDDNHLDGVHSLREVNR  146



>ref|XP_010937431.1| PREDICTED: uncharacterized protein LOC105056811 isoform X1 [Elaeis 
guineensis]
Length=390

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +1

Query  451  RALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNL-LDGNKALQEVNRTVLAAAFCRTLK  627
            RAL  VLS V+ +PV+SRKYE+VRSLA+RL+DDNL L     L E+NR  L++AF RTL+
Sbjct  105  RALAHVLSTVSRVPVASRKYELVRSLADRLLDDNLRLGAATGLDELNRAALSSAFSRTLQ  164

Query  628  QLE  636
             LE
Sbjct  165  HLE  167



>ref|XP_010937432.1| PREDICTED: uncharacterized protein LOC105056811 isoform X2 [Elaeis 
guineensis]
Length=377

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +1

Query  451  RALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNL-LDGNKALQEVNRTVLAAAFCRTLK  627
            RAL  VLS V+ +PV+SRKYE+VRSLA+RL+DDNL L     L E+NR  L++AF RTL+
Sbjct  105  RALAHVLSTVSRVPVASRKYELVRSLADRLLDDNLRLGAATGLDELNRAALSSAFSRTLQ  164

Query  628  QLE  636
             LE
Sbjct  165  HLE  167



>ref|XP_002963079.1| hypothetical protein SELMODRAFT_404646 [Selaginella moellendorffii]
 gb|EFJ36542.1| hypothetical protein SELMODRAFT_404646 [Selaginella moellendorffii]
Length=440

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  424  GGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLA  603
            GG  +  I RAL+QVL +V DIP SSRKYE  RSLA++++ DN+  G ++L+EVNR  L 
Sbjct  99   GGLAKCAIGRALSQVLELVNDIPASSRKYEFARSLADKMMYDNVEQGGQSLREVNRMALE  158

Query  604  AAFCRTLKQLESAV  645
              F RT+  L S++
Sbjct  159  TGFLRTVYMLASSL  172



>ref|XP_008790884.1| PREDICTED: uncharacterized protein LOC103707937 [Phoenix dactylifera]
Length=393

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = +1

Query  412  PVADGGG-GEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNL-LDGNKALQEV  585
            P AD    G    ARAL  VLS+V  +PV+SRKY++VRSLAER +DDNL L     L E+
Sbjct  99   PAADAATEGTSAPARALAHVLSLVARVPVASRKYDLVRSLAERFLDDNLRLGAGAGLDEL  158

Query  586  NRTVLAAAFCRTLKQLE  636
            N   L+AAF RTL+ LE
Sbjct  159  NHDALSAAFRRTLRLLE  175



>ref|XP_008778096.1| PREDICTED: uncharacterized protein LOC103697933 [Phoenix dactylifera]
Length=390

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +1

Query  451  RALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNL-LDGNKALQEVNRTVLAAAFCRTLK  627
            RAL  VLS V+ +PV+SRKYE+VRSLA+RL+DDNL L     L E+NR  L+AAF RTL+
Sbjct  107  RALAHVLSTVSRVPVASRKYELVRSLADRLLDDNLRLGAATGLNELNRAALSAAFSRTLQ  166

Query  628  QLE  636
             LE
Sbjct  167  CLE  169



>ref|XP_009399671.1| PREDICTED: uncharacterized protein LOC103984006 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 5/77 (6%)
 Frame = +1

Query  397  GEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNL-LDGNKA  573
            G A+ P+ADG        R L++VL  V  +PV+SRKY+ VRSLAER++DDNL   G   
Sbjct  91   GFAVAPLADGSRA----GRGLSRVLFAVAHVPVASRKYDFVRSLAERILDDNLRATGGAD  146

Query  574  LQEVNRTVLAAAFCRTL  624
            LQ +NRT L+AAF RTL
Sbjct  147  LQTLNRTALSAAFARTL  163



>ref|XP_009419802.1| PREDICTED: uncharacterized protein LOC103999707 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 3/63 (5%)
 Frame = +1

Query  451  RALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGN---KALQEVNRTVLAAAFCRT  621
            RAL++VLS V+ +PV+SRKY++VRSLAERL+ DNL   +   +A Q +NR  L+AAF RT
Sbjct  110  RALSRVLSAVSRVPVASRKYDLVRSLAERLLGDNLRYASGEGRAFQVINRAALSAAFART  169

Query  622  LKQ  630
            L++
Sbjct  170  LRR  172



>ref|XP_006394183.1| hypothetical protein EUTSA_v10004757mg [Eutrema salsugineum]
 gb|ESQ31469.1| hypothetical protein EUTSA_v10004757mg [Eutrema salsugineum]
Length=275

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  478  VTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            + +IPV+SRKYEVVRSLAERL+D+N  + + AL ++NR VL A+F RTL +LE+AV
Sbjct  1    MNEIPVTSRKYEVVRSLAERLLDENHGENSTALFDLNRRVLNASFRRTLSRLEAAV  56



>gb|ERN09424.1| hypothetical protein AMTR_s00029p00061100 [Amborella trichopoda]
Length=326

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + RAL+Q+ S++ DIP SSRKY+   S+ ++++++N L G++AL+EVNR  L++AF RT
Sbjct  120  ALERALSQIFSLLNDIPASSRKYQFALSMVDKIVEENALVGSEALREVNRVALSSAFSRT  179

Query  622  LKQLESAV  645
               L S++
Sbjct  180  CALLHSSL  187



>ref|XP_006847843.2| PREDICTED: uncharacterized protein LOC18437576 [Amborella trichopoda]
Length=386

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + RAL+Q+ S++ DIP SSRKY+   S+ ++++++N L G++AL+EVNR  L++AF RT
Sbjct  93   ALERALSQIFSLLNDIPASSRKYQFALSMVDKIVEENALVGSEALREVNRVALSSAFSRT  152

Query  622  LKQLESAV  645
               L S++
Sbjct  153  CALLHSSL  160



>gb|AAK93619.1| unknown protein [Arabidopsis thaliana]
Length=271

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  478  VTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
            + +IPVSSRKY+VVRSLAERLI+DN  + + AL ++NR VL A+F  TL +LE+AV
Sbjct  1    MNEIPVSSRKYQVVRSLAERLINDNQGENSVALLDLNRRVLNASFRTTLSRLETAV  56



>emb|CAN75502.1| hypothetical protein VITISV_034157 [Vitis vinifera]
Length=428

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  427  GGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTV  597
            G  EP I    RAL+ + +++ +IP +SRKY+   ++A+R++D+N  DG+  L  +NRT+
Sbjct  123  GSDEPSIKALGRALSHIFTLLNEIPATSRKYQFAVAMADRIVDENSRDGHVELLHINRTI  182

Query  598  LAAAFCRT  621
            LA+AF RT
Sbjct  183  LASAFART  190



>ref|XP_010034289.1| PREDICTED: uncharacterized protein LOC104423502 [Eucalyptus grandis]
Length=441

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + RAL+ +L+++ DIP SSRKY+   S+A+R++++N  +G++ L E+NR  LA+AF RT
Sbjct  149  ALGRALSHILALLNDIPASSRKYQFAMSMADRILEENAREGHEDLLEINRMALASAFSRT  208

Query  622  LKQLESAV  645
               L S++
Sbjct  209  SSLLYSSL  216



>gb|KCW51322.1| hypothetical protein EUGRSUZ_J00876, partial [Eucalyptus grandis]
Length=432

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + RAL+ +L+++ DIP SSRKY+   S+A+R++++N  +G++ L E+NR  LA+AF RT
Sbjct  140  ALGRALSHILALLNDIPASSRKYQFAMSMADRILEENAREGHEDLLEINRMALASAFSRT  199

Query  622  LKQLESAV  645
               L S++
Sbjct  200  SSLLYSSL  207



>ref|XP_002521651.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40758.1| conserved hypothetical protein [Ricinus communis]
Length=433

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 5/86 (6%)
 Frame = +1

Query  421  DGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVL  600
            DG   E  + RALT  L ++ +IP +SRKY+   ++A++++D N  DG   L EVNR  L
Sbjct  136  DGPSVE-ALGRALTHALGLLNEIPATSRKYQFAMAMADKIMDGNFRDGQAELMEVNRAAL  194

Query  601  AAAFCRTL----KQLESAVIDHGGES  666
            ++AF RTL    + L+  VI    E+
Sbjct  195  SSAFSRTLGLLYRSLQQPVISDQSET  220



>emb|CBI29026.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  427  GGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTV  597
            G  EP I    RAL+ + +++ +IP +SRKY+   ++A+R++D+N  DG+  L  +NRT+
Sbjct  184  GSDEPSIKALGRALSHIFTLLNEIPATSRKYQFAVAMADRIVDENSRDGHVELLHINRTI  243

Query  598  LAAAFCRT  621
            LA+AF RT
Sbjct  244  LASAFART  251



>ref|XP_002270447.1| PREDICTED: uncharacterized protein LOC100240757 [Vitis vinifera]
Length=420

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  427  GGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTV  597
            G  EP I    RAL+ + +++ +IP +SRKY+   ++A+R++D+N  DG+  L  +NRT+
Sbjct  123  GSDEPSIKALGRALSHIFTLLNEIPATSRKYQFAVAMADRIVDENSRDGHVELLHINRTI  182

Query  598  LAAAFCRT  621
            LA+AF RT
Sbjct  183  LASAFART  190



>ref|XP_002980258.1| hypothetical protein SELMODRAFT_112193, partial [Selaginella 
moellendorffii]
 gb|EFJ18518.1| hypothetical protein SELMODRAFT_112193, partial [Selaginella 
moellendorffii]
Length=315

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  463  QVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESA  642
            QVL +V DIP SSRKYE  RSLA++++ DN+  G ++L+EVNR  L   F RT+  L S+
Sbjct  3    QVLELVNDIPASSRKYEFARSLADKMMYDNVEQGGQSLREVNRMALETGFLRTVYMLASS  62

Query  643  V  645
            +
Sbjct  63   L  63



>ref|XP_012072843.1| PREDICTED: uncharacterized protein LOC105634579 [Jatropha curcas]
 gb|KDP37537.1| hypothetical protein JCGZ_05976 [Jatropha curcas]
Length=427

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +1

Query  427  GGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAA  606
            G     + RALT VL+++ +IP +SRKY+   ++A++++D N  +G+  L EVNRT L++
Sbjct  133  GHSVQALGRALTHVLALLNEIPATSRKYQFAMAMADKIMDGNFRNGHIELIEVNRTALSS  192

Query  607  AFCRTLKQLESAV  645
            AF RTL  L  ++
Sbjct  193  AFARTLSLLNRSL  205



>ref|XP_002984405.1| hypothetical protein SELMODRAFT_423623 [Selaginella moellendorffii]
 gb|EFJ14455.1| hypothetical protein SELMODRAFT_423623 [Selaginella moellendorffii]
Length=357

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            I RAL QVL +V DIPV+SRKYE  RSLA+R++ DN   G  AL+E+N   L   F RT+
Sbjct  60   IGRALCQVLDLVIDIPVTSRKYEFARSLADRILADNSRYGGPALKEINIRALEGGFSRTV  119



>ref|XP_008813455.1| PREDICTED: uncharacterized protein LOC103724075 [Phoenix dactylifera]
Length=421

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  427  GGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAA  606
            G     I RAL+ +L I+ D+P +SR YE V + A+R++++N+  G+  L EVNR VLA+
Sbjct  128  GANSTAIGRALSHILLILNDLPFTSRNYEFVLAAADRVLNENVQLGHSELLEVNRAVLAS  187

Query  607  AFCRTLKQLESAV  645
            AF RT + L  A+
Sbjct  188  AFSRTSELLRRAL  200



>ref|XP_002972832.1| hypothetical protein SELMODRAFT_441994 [Selaginella moellendorffii]
 gb|EFJ26053.1| hypothetical protein SELMODRAFT_441994 [Selaginella moellendorffii]
Length=356

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            I RAL QVL +V DIPV+SRKYE  RSLA+R++ DN   G   L+E+N   L   F RT+
Sbjct  60   IGRALCQVLDLVIDIPVTSRKYEFARSLADRILADNSRYGGPVLKEINIRALEGGFSRTV  119



>ref|XP_006853180.2| PREDICTED: uncharacterized protein LOC18442912 [Amborella trichopoda]
Length=379

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = +1

Query  412  PVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNR  591
            PV D       IARAL Q+L I+ ++PVSSRKY+++R LAE+++++N  +      ++NR
Sbjct  100  PVRDSS-----IARALAQILLIMNEMPVSSRKYDMIRGLAEKIVEENAKENCWIFPDINR  154

Query  592  TVLAAAFCRTLKQLE  636
             VL+A+F  TL  L+
Sbjct  155  RVLSASFSHTLLLLQ  169



>ref|XP_009135652.1| PREDICTED: uncharacterized protein LOC103859827 [Brassica rapa]
 emb|CDX82278.1| BnaA03g35430D [Brassica napus]
Length=416

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            + RAL  VL+++ +IPV+SRKY     +AE+++++N L  N  L +VNRT LA++F RT 
Sbjct  118  LGRALCHVLALMNEIPVTSRKYHFTMGMAEKIMEENALSCNAELLDVNRTALASSFARTT  177

Query  625  KQLESAV  645
             +L+ ++
Sbjct  178  ARLQDSL  184



>emb|CDY22946.1| BnaC03g41230D [Brassica napus]
Length=416

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            + RAL  VL+++ +IPV+SRKY     +AE+++++N L  N  L +VNRT LA++F RT 
Sbjct  118  LGRALCHVLALMNEIPVTSRKYHFTMGMAEKIMEENALSCNAELLDVNRTALASSFARTT  177

Query  625  KQLESAV  645
             +L+ ++
Sbjct  178  ARLQDSL  184



>ref|XP_010508223.1| PREDICTED: uncharacterized protein LOC104784823 isoform X2 [Camelina 
sativa]
Length=415

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  94   KYSGSSDLGMMICDRVD----EPSVNSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIM  149

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  150  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  180



>ref|XP_006297645.1| hypothetical protein CARUB_v10013663mg [Capsella rubella]
 gb|EOA30543.1| hypothetical protein CARUB_v10013663mg [Capsella rubella]
Length=458

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPG---IARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP    + RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  137  KYSGSSDLGTMICDGVD----EPSANSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIM  192

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  193  EDNAQSGHLDLLDVNRAALASSFARTTARLQ  223



>ref|XP_002885346.1| hypothetical protein ARALYDRAFT_479510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61605.1| hypothetical protein ARALYDRAFT_479510 [Arabidopsis lyrata subsp. 
lyrata]
Length=416

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  95   KYSGSSDLGMMICDGVD----EPSVNSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIM  150

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  151  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  181



>dbj|BAC43081.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63425.1| At3g19920 [Arabidopsis thaliana]
Length=416

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  95   KYSGSSDLGMMICDGVD----EPSVNSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIM  150

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  151  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  181



>ref|XP_010508216.1| PREDICTED: uncharacterized protein LOC104784823 isoform X1 [Camelina 
sativa]
Length=460

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  139  KYSGSSDLGMMICDRVD----EPSVNSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIM  194

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  195  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  225



>ref|NP_188626.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB01307.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76308.1| uncharacterized protein AT3G19920 [Arabidopsis thaliana]
Length=416

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  95   KYSGSSDLGMMICDGVD----EPSVNSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIM  150

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  151  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  181



>ref|XP_003570616.2| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like 
[Brachypodium distachyon]
Length=1016

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +1

Query  427  GGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAA  606
            G     + RAL  VL +V+ +PV+SRKYE+VR LAERL+DDN+   +     VNR  L+ 
Sbjct  732  GPSSTSVGRALGHVLWVVSRLPVASRKYELVRGLAERLLDDNV---SARAAAVNRAALSG  788

Query  607  AFCRTLKQLE  636
            AF RTL+QLE
Sbjct  789  AFERTLRQLE  798



>ref|XP_010487950.1| PREDICTED: uncharacterized protein LOC104765866 isoform X1 [Camelina 
sativa]
Length=459

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C     G  EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  138  KYSGSSNLGMMIC----DGVDEPSVNSLGRALCHALALMNEIPVTSRKYQFALGMAEKIM  193

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  194  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  224



>ref|XP_010487951.1| PREDICTED: uncharacterized protein LOC104765866 isoform X2 [Camelina 
sativa]
Length=416

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  95   KYSGSSNLGMMICDGVD----EPSVNSLGRALCHALALMNEIPVTSRKYQFALGMAEKIM  150

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  151  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  181



>ref|XP_010466158.1| PREDICTED: uncharacterized protein LOC104746394 isoform X1 [Camelina 
sativa]
Length=459

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C     G  EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  138  KYSGSSDLGMMIC----DGVDEPSVNSLGRALCHALALMNEIPVTSRKYQFALGMAEKIM  193

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  194  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  224



>gb|KHG26415.1| Chaperone DnaJ [Gossypium arboreum]
Length=253

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  427  GGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAA  606
            G     + +ALT VL+++ +IP SSRKY+   ++A+++++DN   G+ A+  VNR  LA+
Sbjct  115  GLAVKALVKALTHVLALLNEIPASSRKYQYTMAMADQIMEDNARHGHSAVLHVNRLALAS  174

Query  607  AFCRT  621
            +F RT
Sbjct  175  SFTRT  179



>ref|XP_010466159.1| PREDICTED: uncharacterized protein LOC104746394 isoform X2 [Camelina 
sativa]
 ref|XP_010466160.1| PREDICTED: uncharacterized protein LOC104746394 isoform X3 [Camelina 
sativa]
Length=416

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLI  543
            K+  +S  G  +C   D    EP +    RAL   L+++ +IPV+SRKY+    +AE+++
Sbjct  95   KYSGSSDLGMMICDGVD----EPSVNSLGRALCHALALMNEIPVTSRKYQFALGMAEKIM  150

Query  544  DDNLLDGNKALQEVNRTVLAAAFCRTLKQLE  636
            +DN   G+  L +VNR  LA++F RT  +L+
Sbjct  151  EDNAQSGHVDLLDVNRAALASSFARTTARLQ  181



>ref|XP_010096783.1| hypothetical protein L484_004764 [Morus notabilis]
 gb|EXB65805.1| hypothetical protein L484_004764 [Morus notabilis]
Length=469

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + RAL+ +L+++ +IP +SRKY+   ++AER++D N   G+  + EVNR  L+++F RT
Sbjct  161  ALGRALSHILALLNEIPATSRKYQFAMAMAERIMDGNARSGHVDMMEVNRMALSSSFERT  220

Query  622  LKQLESAVIDH  654
               L+ ++  H
Sbjct  221  SNLLQRSLEKH  231



>ref|XP_010940354.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=421

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             I R L+ +L I+ ++P +SRKYE V   A+R++ +N+  G+  L EVNR VLA+AF RT
Sbjct  133  AIGRTLSHILVILNELPYTSRKYEFVLGTADRVLTENVQLGHAELLEVNRAVLASAFSRT  192

Query  622  LKQLESAV  645
             + L  A+
Sbjct  193  SELLRRAL  200



>ref|XP_009793569.1| PREDICTED: uncharacterized protein LOC104240425 [Nicotiana sylvestris]
Length=424

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + RALT +L+++ +IP SSRKY+    +A++++D+N   G+  + +VNR  LA+AF RT
Sbjct  136  ALGRALTHILALLNEIPASSRKYQFAMGMADKIVDENTRCGHGEMIQVNRAALASAFART  195



>ref|XP_009590559.1| PREDICTED: uncharacterized protein LOC104087710 [Nicotiana tomentosiformis]
Length=417

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  421  DGGGGEPG--IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRT  594
            D     P   + RALT +L+++ +IP SSRKY+    +A++++D+N   G+  + +VNR 
Sbjct  120  DSNQASPAKALGRALTHILALLNEIPASSRKYQFAMGMADKIVDENTRCGHVEMLQVNRA  179

Query  595  VLAAAFCRT  621
             LA+AF RT
Sbjct  180  ALASAFART  188



>ref|XP_010935667.1| PREDICTED: uncharacterized protein LOC105055529 [Elaeis guineensis]
Length=319

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = +1

Query  427  GGG----EPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRT  594
            GGG       I RAL+ +L I+ ++P +S KYE V ++A+R++ +N+  G+  L EVNR 
Sbjct  111  GGGLRACTTAIGRALSHILVILNELPSTSTKYEFVLAMADRIVTENVQLGHGELLEVNRA  170

Query  595  VLAAAFCRT  621
            VLA+ F RT
Sbjct  171  VLASGFSRT  179



>gb|KFK39313.1| hypothetical protein AALP_AA3G228700 [Arabis alpina]
Length=451

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  427  GGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTV  597
            G  EP +    RAL  VL+++ +IPV+SRKY+   ++AE++++DN    N  L +VNR  
Sbjct  143  GVDEPSVNSLGRALCHVLALMNEIPVTSRKYQFAMNMAEKIMEDNAESCNVDLLDVNRAA  202

Query  598  LAAAFCRTLKQLESAV  645
            LA++F RT  +L+ ++
Sbjct  203  LASSFARTAARLQDSL  218



>gb|KFK39314.1| hypothetical protein AALP_AA3G228700 [Arabis alpina]
Length=413

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +1

Query  427  GGGEPGI---ARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTV  597
            G  EP +    RAL  VL+++ +IPV+SRKY+   ++AE++++DN    N  L +VNR  
Sbjct  105  GVDEPSVNSLGRALCHVLALMNEIPVTSRKYQFAMNMAEKIMEDNAESCNVDLLDVNRAA  164

Query  598  LAAAFCRTLKQLESAV  645
            LA++F RT  +L+ ++
Sbjct  165  LASSFARTAARLQDSL  180



>ref|XP_010688666.1| PREDICTED: uncharacterized protein LOC104902557 [Beta vulgaris 
subsp. vulgaris]
Length=521

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = +1

Query  424  GGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLA  603
             G     + RAL+ +L+++ ++P +SRKYE   ++A+RL+D+N  DG   L  VNR  L+
Sbjct  213  AGQSIEALTRALSHILALLNELPATSRKYEFAIAMADRLLDENTRDGKAELFHVNRIALS  272

Query  604  AAF----CRTLKQLESAVIDHGGES  666
            +AF     R  + L +A   H  E+
Sbjct  273  SAFECTINRLHRTLNNAAKAHANEA  297



>ref|XP_004143698.1| PREDICTED: uncharacterized protein LOC101206051 [Cucumis sativus]
 gb|KGN50446.1| hypothetical protein Csa_5G175700 [Cucumis sativus]
Length=459

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  424  GGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLA  603
            G      + RAL+Q+L+I+ ++PVS +KY+   ++AE+++++N   G   L +VNR  L+
Sbjct  154  GASSVKPLTRALSQILAILNEMPVSCQKYQFTMAMAEKIMEENARSGQIELLQVNRAALS  213

Query  604  AAFCRTLKQL  633
            AAF RT   L
Sbjct  214  AAFARTSSSL  223



>gb|KJB31863.1| hypothetical protein B456_005G211600 [Gossypium raimondii]
Length=424

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  427  GGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAA  606
            G     + +ALT VL+++ +IP SSRKY+   ++A+++++DN   G+ AL  VNR  LA+
Sbjct  130  GLAVKALVKALTHVLALLNEIPASSRKYQYTMAMADQIMEDNARHGHSALLHVNRLALAS  189

Query  607  AFCR  618
            +F R
Sbjct  190  SFTR  193



>ref|XP_011459749.1| PREDICTED: uncharacterized protein LOC101309613 [Fragaria vesca 
subsp. vesca]
Length=375

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 88/188 (47%), Gaps = 50/188 (27%)
 Frame = +1

Query  160  MENSPTAMAFSVLKTLLTSLFFYADKPLIVFVDKCKHLQFIRCFLVSAflfflrllpslf  339
            M+ S +++   + + L+TSLF  A   +  +  K K L+ IR   +S+FLFFLRLL SL 
Sbjct  1    MKESSSSITPLLFRNLVTSLFILAVTSISSWTQKHKALELIRYVFISSFLFFLRLLLSLN  60

Query  340  --psfNASPFQSYKFCFNSK---RG------EALCPVAD-----GGGGEPGIARALTQVL  471
               + N     S  + +N K   +G      +   P A+     G G +  IARAL+Q+L
Sbjct  61   PRSTKNIESLYSTLYDYNDKPPKKGSIDQINQKYMPAANSGDEGGNGSDTAIARALSQLL  120

Query  472  SIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTLKQLESAVI-  648
            SIV DIPVSSRK                             VL+ A  RTL QLE+A I 
Sbjct  121  SIVNDIPVSSRK-----------------------------VLSEALSRTLNQLEAAAIF  151

Query  649  ----DHGG  660
                 HGG
Sbjct  152  EQQQHHGG  159



>ref|XP_008445882.1| PREDICTED: uncharacterized protein LOC103488768 [Cucumis melo]
Length=459

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
            + RAL+Q+L+I+ ++P S +KY+   ++AE+++++N   G   L +VNR  L+AAF RT
Sbjct  163  LTRALSQILAILNEMPASCQKYQFTMAMAEKIMEENARSGQIELLQVNRAALSAAFART  221



>ref|XP_006406441.1| hypothetical protein EUTSA_v10022300mg [Eutrema salsugineum]
 gb|ESQ47894.1| hypothetical protein EUTSA_v10022300mg [Eutrema salsugineum]
Length=418

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            + RAL   L+++ +IP++SRKY+    +AE++++DN    N  L +VNR  LA++F RT 
Sbjct  119  LGRALCHALALMNEIPITSRKYQFTMGMAEKIMEDNAQSCNVELLDVNRAALASSFARTT  178

Query  625  KQLESAV  645
             +L+ ++
Sbjct  179  ARLQDSL  185



>ref|XP_010541857.1| PREDICTED: uncharacterized protein LOC104815236 [Tarenaya hassleriana]
Length=453

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = +1

Query  415  VADGGG-GEP---GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQE  582
            V DG G  EP    + RAL+ VL ++ +IP +S KY+   ++AE+++++N    + AL  
Sbjct  141  VIDGDGVDEPYVRSLERALSHVLGLMNEIPATSGKYQFAMAMAEKIMEENARSHHVALLN  200

Query  583  VNRTVLAAAFCRTLKQLES  639
            VNR  LA++F RT  +L++
Sbjct  201  VNRRALASSFARTSARLQA  219



>emb|CDY25358.1| BnaA05g19260D [Brassica napus]
Length=413

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            + RAL   L+++ +IPV+SRKY+    +AE+++++N    N  L +VNR  LA++F RT 
Sbjct  115  LGRALCHALALMNEIPVTSRKYQFAMGMAEKIMEENAQSCNVELLDVNRVALASSFARTT  174

Query  625  KQLESAV  645
             +L  ++
Sbjct  175  TRLHDSL  181



>ref|XP_009145731.1| PREDICTED: uncharacterized protein LOC103869408 isoform X1 [Brassica 
rapa]
Length=454

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            + RAL   L+++ +IPV+SRKY+    +AE+++++N    N  L +VNR  LA++F RT 
Sbjct  156  LGRALCHALALMNEIPVTSRKYQFAMGMAEKIMEENAQSCNVELLDVNRVALASSFARTT  215

Query  625  KQLESAV  645
             +L  ++
Sbjct  216  ARLHDSL  222



>ref|XP_009145732.1| PREDICTED: uncharacterized protein LOC103869408 isoform X2 [Brassica 
rapa]
Length=413

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            + RAL   L+++ +IPV+SRKY+    +AE+++++N    N  L +VNR  LA++F RT 
Sbjct  115  LGRALCHALALMNEIPVTSRKYQFAMGMAEKIMEENAQSCNVELLDVNRVALASSFARTT  174

Query  625  KQLESAV  645
             +L  ++
Sbjct  175  ARLHDSL  181



>ref|XP_004231494.1| PREDICTED: uncharacterized protein LOC101263358 [Solanum lycopersicum]
Length=427

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + RALT +L+++ +IP SSRKY+    +A ++ID+N   G+  + +VN + LA+AF RT
Sbjct  121  ALGRALTHILALLNEIPASSRKYQFALGMANKIIDENTKCGHLEMLQVNCSALASAFART  180



>ref|XP_006345317.1| PREDICTED: uncharacterized protein LOC102606286 [Solanum tuberosum]
Length=454

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +1

Query  421  DGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVL  600
            D  GG  G    + Q+L+++ +IP SSRKY+    +A+++I++N   G+  + +VNR+ L
Sbjct  145  DNQGGWTG---NIFQILALLNEIPASSRKYQFAMGMADKIIEENTKCGHLEMLQVNRSAL  201

Query  601  AAAFCRTLKQLESAV  645
            A+AF RT   L S++
Sbjct  202  ASAFTRTSGLLYSSL  216



>emb|CDY24594.1| BnaC05g32780D [Brassica napus]
Length=407

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +1

Query  373  KFCFNSKRGEALCPVADGGGGEPGIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDN  552
            K+  ++  G  +C  AD       + RAL   L+++ +IPV+SRKY+    +AE+++++N
Sbjct  86   KYSGSADLGTMVCDGADVPSVN-SLGRALCHALALMNEIPVTSRKYQFAMGMAEKIMEEN  144

Query  553  LLDGNKALQEVNRTVLAAAFCRTLKQLESAV  645
                N  L ++NR  LA++F RT  +L  ++
Sbjct  145  ARSCNVELLDLNRVALASSFARTTTRLHDSL  175



>ref|XP_006484584.1| PREDICTED: uncharacterized protein LOC102623953 [Citrus sinensis]
 gb|KDO52703.1| hypothetical protein CISIN_1g013787mg [Citrus sinensis]
Length=436

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + R+LT +L+++ +IP +S KY    ++AER+++ N    +  L +VNR  L++AF RT
Sbjct  140  ALGRSLTHILALLNEIPAASSKYLFAMTMAERIMEGNARHDHIELLQVNRAALSSAFART  199



>ref|XP_006437611.1| hypothetical protein CICLE_v10033897mg [Citrus clementina]
 gb|ESR50851.1| hypothetical protein CICLE_v10033897mg [Citrus clementina]
Length=434

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  442  GIARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRT  621
             + R+LT +L+++ +IP +S KY    ++AER+++ N    +  L +VNR  L++AF RT
Sbjct  138  ALGRSLTHILALLNEIPAASSKYLFAMTMAERIMEGNARHDHIELLQVNRAALSSAFART  197



>ref|XP_001768702.1| predicted protein [Physcomitrella patens]
 gb|EDQ66434.1| predicted protein [Physcomitrella patens]
Length=377

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  445  IARALTQVLSIVTDIPVSSRKYEVVRSLAERLIDDNLLDGNKALQEVNRTVLAAAFCRTL  624
            I RAL+ VL++V D+P SS KY  ++ L +R++++N ++G K    +N+  L   F RT+
Sbjct  75   IGRALSHVLTLVNDVPSSSSKYAFLQDLTDRVVEENKVEGVK-YDAINQAALQKGFARTI  133

Query  625  KQL  633
              L
Sbjct  134  NLL  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1350961752362