BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10552

Length=1062
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB16792.1|  hypothetical protein B456_002G248000                    422   2e-138   Gossypium raimondii
gb|AER12109.1|  PAL                                                     422   2e-138   Gossypium hirsutum [American cotton]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             421   6e-138   Sesamum indicum [beniseed]
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        420   1e-137   Solanum tuberosum [potatoes]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        420   1e-137   Nicotiana sylvestris
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             421   1e-137   Gossypium arboreum [tree cotton]
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     419   2e-137   Nicotiana sylvestris
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        419   4e-137   
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    413   1e-136   Rhizophora mangle
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            404   2e-136   Vitis vinifera
gb|AGH13333.1|  phenylalanine ammonia-lyase                             416   3e-136   Rhus chinensis
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             416   6e-136   Sesamum indicum [beniseed]
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     416   7e-136   Nicotiana tomentosiformis
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          416   7e-136   Cynara cardunculus var. scolymus [artichoke]
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     416   7e-136   Nicotiana tomentosiformis
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             416   9e-136   Gossypium arboreum [tree cotton]
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        415   1e-135   Cucumis melo [Oriental melon]
emb|CBI31445.3|  unnamed protein product                                410   2e-135   Vitis vinifera
gb|KJB36583.1|  hypothetical protein B456_006G166000                    414   3e-135   Gossypium raimondii
gb|AGY49231.1|  phenylalanine ammonia lyase                             414   4e-135   Ricinus communis
gb|AAV98199.1|  phenylalanine ammonialyase 1                            414   5e-135   Petunia x hybrida [garden petunia]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       413   5e-135   Nicotiana tabacum [American tobacco]
ref|XP_007027354.1|  PHE ammonia lyase 1                                414   5e-135   Theobroma cacao [chocolate]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             413   7e-135   Hibiscus cannabinus [bimli-jute]
emb|CAL91170.1|  phenylalanine ammonia-lyase 3                          397   7e-135   Cynara cardunculus var. scolymus [artichoke]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              413   8e-135   Ricinus communis
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   412   1e-134   Ipomoea nil [qian niu]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       411   1e-134   Helianthus annuus
gb|KJB62426.1|  hypothetical protein B456_009G416300                    412   1e-134   Gossypium raimondii
ref|XP_012082374.1|  PREDICTED: phenylalanine ammonia-lyase             412   1e-134   Jatropha curcas
ref|XP_012082376.1|  PREDICTED: phenylalanine ammonia-lyase-like        412   1e-134   Jatropha curcas
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        412   1e-134   
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    412   1e-134   Solanum lycopersicum
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             412   2e-134   Nelumbo nucifera [Indian lotus]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       412   2e-134   Populus trichocarpa [western balsam poplar]
gb|AEC11891.1|  PAL1                                                    411   3e-134   Petunia exserta
gb|AIB06732.1|  phenylalanine ammonia lyase                             410   5e-134   Mangifera indica
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         411   5e-134   Jatropha curcas
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           411   5e-134   Rhizophora mangle
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          411   6e-134   Vitis vinifera
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             410   6e-134   Plectranthus scutellarioides
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           410   9e-134   Populus tomentosa [Chinese white poplar]
gb|KJB46525.1|  hypothetical protein B456_007G373600                    410   9e-134   Gossypium raimondii
emb|CAN77065.1|  hypothetical protein VITISV_009233                     410   1e-133   Vitis vinifera
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         410   1e-133   Populus trichocarpa [western balsam poplar]
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    410   1e-133   Solanum lycopersicum
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             410   1e-133   Gossypium arboreum [tree cotton]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             410   1e-133   Nicotiana sylvestris
emb|CDO99754.1|  unnamed protein product                                408   1e-133   Coffea canephora [robusta coffee]
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       409   2e-133   Digitalis lanata [Grecian foxglove]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             410   2e-133   
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             409   2e-133   Gossypium arboreum [tree cotton]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           409   2e-133   Nicotiana attenuata
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             409   2e-133   Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       409   3e-133   Nicotiana tabacum [American tobacco]
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        408   5e-133   Cucumis melo [Oriental melon]
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           408   6e-133   Coffea arabica [arabica coffee]
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             408   7e-133   Cucumis melo [Oriental melon]
gb|AFP49806.1|  phenylalanine ammonialyase 1                            408   7e-133   Coffea arabica [arabica coffee]
emb|CBI26455.3|  unnamed protein product                                407   7e-133   Vitis vinifera
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             408   7e-133   Vitis vinifera
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             408   8e-133   Populus euphratica
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             407   9e-133   Vitis vinifera
ref|XP_012093279.1|  PREDICTED: phenylalanine ammonia-lyase G2B         407   1e-132   Jatropha curcas
gb|ABD73282.1|  phenylalanine ammonia-lyase                             407   1e-132   Salvia miltiorrhiza [Chinese salvia]
gb|ABR14606.1|  phenylalanine ammonia-lyase                             407   1e-132   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011653013.1|  PREDICTED: phenylalanine ammonia-lyase-like        405   1e-132   Cucumis sativus [cucumbers]
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        407   2e-132   Vitis vinifera
ref|XP_011657651.1|  PREDICTED: phenylalanine ammonia-lyase             407   2e-132   Cucumis sativus [cucumbers]
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        407   2e-132   Vitis vinifera
gb|ACS71953.1|  phenylalanine ammonia-lyase                             407   2e-132   Euphorbia pulcherrima
ref|XP_004143356.2|  PREDICTED: phenylalanine ammonia-lyase-like        407   2e-132   Cucumis sativus [cucumbers]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             406   2e-132   Vitis vinifera
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           406   2e-132   Platycodon grandiflorus [balloon-flower]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              406   2e-132   Vitis vinifera
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 406   2e-132   Manihot esculenta [manioc]
dbj|BAA95629.1|  phenylalanine ammonia lyase                            406   2e-132   Catharanthus roseus [chatas]
ref|XP_004152155.2|  PREDICTED: phenylalanine ammonia-lyase-like        402   3e-132   Cucumis sativus [cucumbers]
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   406   3e-132   Lactuca sativa [cultivated lettuce]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             406   3e-132   Vitis vinifera
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      406   3e-132   
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            406   3e-132   Melissa officinalis [sweet balm]
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        406   3e-132   Cucumis melo [Oriental melon]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             406   3e-132   Vitis vinifera
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             406   3e-132   Vitis vinifera
gb|ACF94716.1|  phenylalanine ammonia lyase                             406   3e-132   Robinia pseudoacacia [black locust]
gb|AFK43896.1|  unknown                                                 394   4e-132   Medicago truncatula
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        406   4e-132   Vitis vinifera
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    406   4e-132   
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        405   5e-132   Vitis vinifera
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             405   5e-132   Nelumbo nucifera [Indian lotus]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      405   7e-132   Cucumis melo [Oriental melon]
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 405   7e-132   Coffea canephora [robusta coffee]
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    405   7e-132   Solanum tuberosum [potatoes]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             405   9e-132   Solanum tuberosum [potatoes]
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        405   1e-131   Cucumis sativus [cucumbers]
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    404   1e-131   
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    404   1e-131   Capsicum annuum
gb|AIA66448.1|  PAL1                                                    404   2e-131   Capsicum annuum
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      404   2e-131   
gb|ACM44926.1|  phenylalanine ammonia-lyase                             404   2e-131   Euphorbia pulcherrima
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            404   2e-131   Eucalyptus robusta [swamp messmate]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   404   2e-131   Rehmannia glutinosa [Chinese foxglove]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             403   3e-131   Vitis vinifera
ref|XP_011654322.1|  PREDICTED: phenylalanine ammonia-lyase-like        395   3e-131   Cucumis sativus [cucumbers]
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    404   4e-131   
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            404   5e-131   Gynura bicolor
gb|ADO64252.1|  PAL                                                     403   5e-131   Epimedium sagittatum
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 402   6e-131   Manihot esculenta [manioc]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             403   6e-131   Solanum lycopersicum
gb|ACM62741.1|  phenylalanine ammonia-lyase                             403   6e-131   Garcinia mangostana [mangosteen]
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             403   7e-131   Populus tomentosa [Chinese white poplar]
gb|AJO53272.1|  phenylalanine ammonia-lyase                             402   8e-131   Pogostemon cablin
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      402   1e-130   
emb|CDY66761.1|  BnaCnng52250D                                          396   1e-130   Brassica napus [oilseed rape]
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1           402   1e-130   Cucumis sativus [cucumbers]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         402   1e-130   Populus trichocarpa [western balsam poplar]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             402   1e-130   Perilla frutescens [beefsteak-mint]
gb|AER58180.1|  phenylalanine ammonia lyase                             402   1e-130   Cucumis sativus [cucumbers]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             402   1e-130   Scutellaria viscidula [zhan mao huang qin]
gb|AEE81750.1|  phenylalanine ammonia lyase                             402   2e-130   Morus alba var. multicaulis
gb|ABD42947.1|  phenylalanine ammonia lyase                             402   2e-130   Acacia auriculiformis x Acacia mangium
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           402   2e-130   Astragalus membranaceus
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           402   2e-130   Nicotiana attenuata
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           401   2e-130   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        401   2e-130   
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           401   2e-130   Manihot esculenta [manioc]
gb|AFP49807.1|  phenylalanine ammonialyase 4                            401   2e-130   Coffea arabica [arabica coffee]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        401   3e-130   Populus euphratica
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     401   3e-130   Petroselinum crispum
gb|AJO53274.1|  phenylalanine ammonia-lyase                             401   3e-130   Pogostemon cablin
gb|AIA24411.1|  phenylalanine ammonia-lyase                             401   3e-130   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            391   3e-130   Phaseolus vulgaris [French bean]
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           401   4e-130   Ageratina adenophora
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           400   4e-130   Coffea canephora [robusta coffee]
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        400   5e-130   Cucumis melo [Oriental melon]
gb|AAR31107.1|  phenylalanine ammonia-lyase                             400   5e-130   Quercus suber [cork oak]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       400   7e-130   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             400   8e-130   Nicotiana tomentosiformis
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        400   8e-130   Solanum tuberosum [potatoes]
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        400   8e-130   Morus notabilis
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           400   8e-130   Coffea canephora [robusta coffee]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           400   9e-130   Scutellaria baicalensis [Baikal skullcap]
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        400   9e-130   Cucumis melo [Oriental melon]
gb|ABN79671.2|  phenylalanine ammonia-lyase                             400   9e-130   Rudbeckia hirta
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        400   1e-129   Solanum tuberosum [potatoes]
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            400   1e-129   Vigna radiata [mung bean]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       399   1e-129   Camellia sinensis [black tea]
gb|AID16077.1|  phenylalanine ammonium lyase                            400   1e-129   Morus alba
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     399   1e-129   Glycine max [soybeans]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             399   1e-129   Populus tomentosa [Chinese white poplar]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             399   1e-129   Nicotiana sylvestris
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        399   1e-129   Eucalyptus grandis [rose gum]
gb|AEH02821.1|  phenylalanine ammonia lyase                             399   2e-129   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     399   2e-129   Petroselinum crispum
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   399   2e-129   Agastache rugosa
gb|AEX32790.1|  phenylalanine ammonia-lyase                             399   2e-129   Vitis vinifera
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    399   2e-129   Lithospermum erythrorhizon
gb|ACE95170.1|  phenylalanine ammonia-lyase                             399   2e-129   Populus tomentosa [Chinese white poplar]
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        399   3e-129   Cucumis melo [Oriental melon]
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              399   3e-129   Ricinus communis
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           400   3e-129   Salvia miltiorrhiza [Chinese salvia]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             398   3e-129   Trifolium pratense [peavine clover]
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   398   3e-129   Trifolium pratense [peavine clover]
gb|ACT32033.1|  phenylalanine ammonia-lyase                             398   4e-129   Glycine soja [wild soybean]
gb|AIY26016.1|  PAL                                                     398   6e-129   Jasminum sambac [Arabian jasmine]
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   398   6e-129   Populus tremuloides
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             397   6e-129   Olea europaea
gb|ACC63889.1|  phenylalanine ammonia-lyase                             397   6e-129   Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             397   6e-129   Populus szechuanica
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         397   6e-129   Populus trichocarpa [western balsam poplar]
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           397   9e-129   Tarenaya hassleriana [spider flower]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           397   1e-128   Coffea arabica [arabica coffee]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   397   1e-128   Populus tremuloides
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    397   2e-128   
gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           396   2e-128   Ipomoea purpurea
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 397   2e-128   Rubus idaeus [European raspberry]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         396   2e-128   Populus trichocarpa [western balsam poplar]
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     396   2e-128   Eucalyptus grandis [rose gum]
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             396   2e-128   Eucalyptus grandis [rose gum]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             396   2e-128   Gossypium arboreum [tree cotton]
gb|KJB73539.1|  hypothetical protein B456_011G238400                    396   2e-128   Gossypium raimondii
gb|AJO53273.1|  phenylalanine ammonia-lyase                             396   3e-128   Pogostemon cablin
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            396   3e-128   Lactuca sativa [cultivated lettuce]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            396   3e-128   Populus sieboldii x Populus grandidentata
gb|AHY94892.1|  phenylalanine ammonia lyase                             395   3e-128   Prunella vulgaris
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        396   3e-128   Solanum tuberosum [potatoes]
gb|AIL23235.1|  phenylalanine ammonia-lyase                             396   4e-128   Astragalus chrysochlorus
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             395   4e-128   Camellia japonica [common camellia]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          395   4e-128   Populus euphratica
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        396   4e-128   Cicer arietinum [garbanzo]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        395   4e-128   Medicago truncatula
gb|AJT59582.1|  phenylalanine ammonia lyase                             396   5e-128   Boehmeria nivea [Chinese silk-plant]
gb|ADI40166.1|  phenylalanine ammonia-lyase                             395   5e-128   Morus alba
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             395   6e-128   Citrus clementina [clementine]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            395   6e-128   Daucus carota [carrots]
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       386   6e-128   Cucumis sativus [cucumbers]
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    395   7e-128   
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       395   8e-128   Trifolium subterraneum
gb|ACR15762.1|  phenylalanine ammonia-lyase                             395   8e-128   Litchi chinensis [litchi]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   395   8e-128   Citrus sinensis [apfelsine]
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             395   9e-128   Astragalus membranaceus
gb|AHA42445.1|  phenylalanine ammonia lyase                             388   1e-127   Cannabis sativa
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           394   1e-127   Glycine soja [wild soybean]
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                396   1e-127   Erythranthe guttata [common monkey flower]
gb|ACT21093.1|  phenylalanine ammonia-lyase                             394   2e-127   Camellia oleifera [abura-tsubaki]
gb|AJW77399.1|  phenylalanine ammonia-lyase                             394   2e-127   Angelica sinensis [Chinese angelica]
gb|AAX22053.1|  phenylalanine ammonia-lyase                             394   2e-127   Brassica napus [oilseed rape]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      394   2e-127   
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      394   3e-127   Glycine max [soybeans]
gb|AGU91428.1|  phenylalanine ammonia-lyase                             393   3e-127   Chrysanthemum boreale
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     394   3e-127   Petroselinum crispum
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         393   3e-127   Populus euphratica
gb|AAQ74878.1|  phenylalanine ammonia lyase                             393   3e-127   Populus trichocarpa x Populus deltoides
gb|AFF60415.1|  phenylalanine ammonia lyase                             391   3e-127   Pyrus pyrifolia [sha li]
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      394   3e-127   Tarenaya hassleriana [spider flower]
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            393   3e-127   Daucus carota [carrots]
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    393   4e-127   
gb|ABL14039.1|  phenylalanine ammonia lyase                             378   4e-127   Astragalus mongholicus
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    393   4e-127   Populus sieboldii x Populus grandidentata
gb|ADY02661.1|  phenylalanine ammonia lyase                             392   5e-127   Parrya nudicaulis
gb|ADA81868.1|  phenylalanine ammonia-lyase                             393   5e-127   Brassica rapa subsp. chinensis [bok-choy]
gb|AAX84839.1|  phenylalanine ammonia-lyase                             393   5e-127   Astragalus mongholicus
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      393   6e-127   Brassica rapa
gb|AAZ29734.1|  phenylalanine ammonia lyase                             393   7e-127   Trifolium pratense [peavine clover]
gb|ADY02660.1|  phenylalanine ammonia lyase                             392   8e-127   Parrya nudicaulis
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             392   8e-127   
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    392   9e-127   Solanum lycopersicum
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        392   9e-127   Cicer arietinum [garbanzo]
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    392   1e-126   Solanum tuberosum [potatoes]
gb|ADY02662.1|  phenylalanine ammonia lyase                             391   1e-126   Parrya nudicaulis
gb|AAZ29732.1|  phenylalanine ammonia lyase                             392   1e-126   Trifolium pratense [peavine clover]
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           392   1e-126   Brassica rapa
emb|CDX76219.1|  BnaA04g04830D                                          385   1e-126   
prf||2006271A  Phe ammonia lyase                                        392   1e-126
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        391   1e-126   Cucumis melo [Oriental melon]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    391   1e-126   Lithospermum erythrorhizon
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       392   2e-126   Citrus limon [lemon]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     392   2e-126   Solanum tuberosum [potatoes]
gb|AAZ29735.1|  phenylalanine ammonia lyase                             391   2e-126   Trifolium pratense [peavine clover]
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           390   3e-126   Platycodon grandiflorus [balloon-flower]
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             391   3e-126   Vitis vinifera
gb|AAX22055.1|  phenylalanine ammonia-lyase                             391   4e-126   Brassica napus [oilseed rape]
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             390   4e-126   Citrus clementina [clementine]
emb|CAN61378.1|  hypothetical protein VITISV_032212                     389   5e-126   Vitis vinifera
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           390   5e-126   Tarenaya hassleriana [spider flower]
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                390   6e-126   Medicago truncatula
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            390   6e-126   Brassica oleracea var. botrytis [cauliflower]
gb|AAW78932.1|  phenylalanine-ammonia lyase                             390   8e-126   Rhodiola sachalinensis
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             390   8e-126   Eucalyptus grandis [rose gum]
gb|AAA34179.2|  phenylalanine ammonia lyase                             389   8e-126   Solanum lycopersicum
gb|AFU90757.1|  phenylalanine ammonia-lyase                             390   9e-126   Epimedium sagittatum
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           390   1e-125   
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        389   1e-125   Citrus sinensis [apfelsine]
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             389   1e-125   Eucalyptus grandis [rose gum]
prf||2001451A  Phe ammonia lyase                                        389   1e-125
gb|AGL50914.1|  phenylalanine ammonia lyase                             389   1e-125   Pyrus communis
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             389   1e-125   Phaseolus vulgaris [French bean]
gb|AFP24940.1|  phenylalanine ammonia lyase                             389   1e-125   Prunus salicina [Japanese plum]
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                389   1e-125   Medicago truncatula
gb|AEJ88223.1|  phenylalanine ammonia lyase                             389   1e-125   Prunus persica
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       389   1e-125   Pisum sativum [garden pea]
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    389   1e-125   Petroselinum crispum
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           389   1e-125   Fragaria vesca subsp. vesca
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     389   2e-125   Prunus avium [gean]
gb|ABF50788.1|  phenylalanine ammonia-lyase                             389   2e-125   Isatis tinctoria [woad]
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     388   2e-125   Daucus carota [carrots]
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             389   3e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        388   3e-125   Eucalyptus grandis [rose gum]
gb|AFI71896.1|  phenylalanine ammonia-lyase                             388   3e-125   Paeonia lactiflora [common garden peony]
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             388   4e-125   Citrus clementina [clementine]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             388   4e-125   Phaseolus vulgaris [French bean]
gb|ABC69917.1|  phenylalanine ammonia-lyase                             388   4e-125   Brassica napus [oilseed rape]
gb|AHA42443.1|  phenylalanine ammonia lyase                             387   4e-125   Cannabis sativa
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             389   4e-125   
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             387   6e-125   Populus tomentosa [Chinese white poplar]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             387   6e-125   Prunus persica
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           387   7e-125   Prunus mume [ume]
gb|AFG30054.1|  phenylalanine ammonialyase                              387   7e-125   Malus hybrid cultivar
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          386   1e-124   
gb|ABL14040.1|  phenylalanine ammonia lyase                             372   1e-124   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        387   1e-124   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   387   1e-124   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             386   2e-124   
gb|ABC69916.1|  phenylalanine ammonia-lyase                             386   2e-124   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        386   2e-124   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           386   2e-124   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    386   2e-124   
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                386   2e-124   
gb|ACA30407.1|  phenylalanine ammonia-lyase                             386   2e-124   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       386   3e-124   
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            385   3e-124   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    386   3e-124   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        385   3e-124   
gb|AGL81344.1|  phenylalanine ammonia lyase                             385   4e-124   
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           385   4e-124   
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           385   4e-124   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            385   5e-124   
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           385   5e-124   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             385   6e-124   
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           385   7e-124   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      385   7e-124   
gb|AEA72280.1|  phenylalanine ammonia-lyase                             384   8e-124   
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            384   8e-124   
ref|XP_004143260.2|  PREDICTED: phenylalanine ammonia-lyase-like        384   9e-124   
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    384   1e-123   
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             384   1e-123   
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         384   1e-123   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      384   1e-123   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    384   1e-123   
gb|AAC18870.1|  phenylalanine ammonia lyase                             384   1e-123   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    384   1e-123   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    384   2e-123   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    384   2e-123   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      384   2e-123   
gb|ABB70117.2|  phenylalanine ammonia lyase                             384   2e-123   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    383   2e-123   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         383   3e-123   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      383   3e-123   
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    383   3e-123   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             383   4e-123   
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      383   5e-123   
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             382   6e-123   
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           382   6e-123   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            382   8e-123   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           382   8e-123   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             382   9e-123   
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     378   1e-122   
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           382   1e-122   
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 381   1e-122   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      381   2e-122   
gb|ABE03772.1|  phenylalanine ammonia-lyase                             381   2e-122   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      381   2e-122   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             381   2e-122   
gb|AGE10590.1|  phenylalanine amononia-lyase                            380   2e-122   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             380   3e-122   
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            380   3e-122   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             380   3e-122   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            379   4e-122   
gb|AGE10589.1|  phenylalanine amononia-lyase                            379   7e-122   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             379   8e-122   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              379   9e-122   
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             379   1e-121   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 379   1e-121   
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        380   1e-121   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             378   2e-121   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             379   2e-121   
gb|AKA60049.1|  phenylalanine ammonia-lyase                             378   3e-121   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             378   3e-121   
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      378   3e-121   
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            378   3e-121   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        377   3e-121   
gb|AAC18871.1|  phenylalanine ammonia lyase                             378   4e-121   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             376   2e-120   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             377   2e-120   
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       375   2e-120   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             375   2e-120   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            375   2e-120   
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    375   2e-120   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         375   3e-120   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        375   4e-120   
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             375   4e-120   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             375   4e-120   
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            374   4e-120   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      374   5e-120   
gb|AAU08174.1|  phenylalanine ammonia-lyase                             375   5e-120   
gb|ADD12041.1|  phenylalanine ammonia lyase                             374   6e-120   
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    374   7e-120   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    374   8e-120   
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        374   1e-119   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             371   1e-119   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       374   1e-119   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    374   1e-119   
dbj|BAF96940.1|  phenylalanine ammonia lyase                            363   2e-119   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           373   3e-119   
emb|CDY00922.1|  BnaC05g42780D                                          372   4e-119   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             371   4e-119   
gb|ACG56647.1|  phenylalanine ammonia lyase                             372   5e-119   
gb|AIZ76766.1|  PAL2                                                    363   5e-119   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             371   5e-119   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             372   6e-119   
gb|ACG56648.1|  phenylalanine ammonia lyase                             372   7e-119   
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        372   8e-119   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             371   9e-119   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      371   1e-118   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                370   1e-118   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             370   2e-118   
ref|XP_007016787.1|  PHE ammonia lyase 1                                370   2e-118   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           370   4e-118   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             370   4e-118   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             369   5e-118   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           369   1e-117   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             368   2e-117   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           368   2e-117   
emb|CDY08611.1|  BnaA05g28470D                                          368   2e-117   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        367   3e-117   
gb|AGE10591.1|  phenylalanine amononia-lyase                            366   5e-117   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           367   6e-117   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          366   9e-117   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    367   1e-116   
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       365   1e-116   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             365   2e-116   
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           363   2e-116   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            365   2e-116   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             365   2e-116   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        363   8e-116   
gb|AIC66437.1|  phenylalanine ammonia lyase                             363   8e-116   
gb|KJB46526.1|  hypothetical protein B456_007G373700                    362   1e-115   
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             363   1e-115   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             362   2e-115   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    361   4e-115   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase G4          362   6e-115   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             361   8e-115   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        361   9e-115   
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           359   1e-114   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        359   5e-114   
emb|CAB97358.1|  phenylalanine ammonia-lyase                            344   1e-113   
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        358   1e-113   
emb|CAA89007.1|  phenylalanine ammonia-lyase                            353   1e-113   
gb|ACZ36441.1|  phenylalanine ammonialyase                              358   1e-113   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   2e-113   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   2e-113   
emb|CDP20698.1|  unnamed protein product                                356   3e-113   
ref|XP_008456500.1|  PREDICTED: phenylalanine ammonia-lyase G4          357   4e-113   
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        357   4e-113   
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             356   5e-113   
emb|CDX78161.1|  BnaA09g33560D                                          349   7e-113   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            356   8e-113   
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        356   1e-112   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             355   2e-112   
emb|CDX73567.1|  BnaC08g24360D                                          348   3e-112   
emb|CDX67566.1|  BnaA07g16060D                                          348   3e-112   
gb|ADT63058.1|  phenylalanine ammonia-lyase                             354   4e-112   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            354   5e-112   
ref|XP_002454199.1|  hypothetical protein SORBIDRAFT_04g026520          354   5e-112   
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        353   1e-111   
gb|EMT28136.1|  Phenylalanine ammonia-lyase                             353   2e-111   
ref|NP_001047482.1|  Os02g0626400                                       353   2e-111   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             352   2e-111   
gb|ACR10243.1|  phenylalanine ammonia-lyase                             350   2e-111   
dbj|BAJ88975.1|  predicted protein                                      352   3e-111   
emb|CDY18463.1|  BnaA04g21240D                                          337   3e-111   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             351   4e-111   
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    351   4e-111   
ref|NP_001055608.1|  Os05g0427400                                       352   4e-111   
ref|NP_001147922.1|  phenylalanine ammonia-lyase                        351   5e-111   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            352   7e-111   
ref|XP_004976241.1|  PREDICTED: phenylalanine ammonia-lyase-like        350   1e-110   
gb|AGZ95689.1|  phenylalanine ammonia-lyase                             350   1e-110   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        350   2e-110   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            349   2e-110   
ref|XP_003575400.1|  PREDICTED: phenylalanine ammonia-lyase-like        350   2e-110   
ref|XP_003618076.1|  Phenylalanine ammonia-lyase                        349   3e-110   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            348   3e-110   
gb|ACM47229.1|  phenylalanine ammonia-lyase                             349   4e-110   
gb|ACM45574.1|  phenylalanine ammonia-lyase                             349   4e-110   
gb|ACN35880.1|  unknown                                                 349   4e-110   
ref|NP_001151482.1|  phenylalanine ammonia-lyase                        349   5e-110   
ref|XP_002452479.1|  hypothetical protein SORBIDRAFT_04g026560          348   7e-110   
gb|ACF86361.1|  unknown                                                 348   8e-110   
gb|ACM45589.1|  phenylalanine ammonia-lyase                             348   8e-110   
ref|XP_002454200.1|  hypothetical protein SORBIDRAFT_04g026530          348   9e-110   
ref|NP_001053326.1|  Os04g0518400                                       348   9e-110   
ref|XP_004953156.1|  PREDICTED: phenylalanine ammonia-lyase-like        348   1e-109   
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        347   1e-109   
ref|XP_004953155.1|  PREDICTED: phenylalanine ammonia-lyase-like        347   2e-109   
gb|AGA84059.1|  phenylalanine ammonia lyase                             347   2e-109   
gb|ACM45590.1|  phenylalanine ammonia-lyase                             347   2e-109   
ref|NP_001047483.2|  Os02g0626600                                       347   2e-109   
gb|EAY86765.1|  hypothetical protein OsI_08145                          347   2e-109   
ref|XP_009140249.1|  PREDICTED: phenylalanine ammonia-lyase 3           347   2e-109   
gb|EMT28135.1|  Phenylalanine ammonia-lyase                             347   3e-109   
gb|ACM16588.1|  phenylalanine ammonia-lyase                             347   3e-109   
ref|XP_003575365.1|  PREDICTED: phenylalanine ammonia-lyase             346   6e-109   
gb|EPS66416.1|  phenylalanine ammonia-lyase                             346   6e-109   
sp|A2X7F7.1|PAL2_ORYSI  RecName: Full=Phenylalanine ammonia-lyase       346   6e-109   
gb|ACN62413.1|  phenylalanine ammonia-lyase                             346   6e-109   
ref|NP_001047484.1|  Os02g0627100                                       346   7e-109   
gb|EMT07187.1|  Phenylalanine ammonia-lyase                             350   7e-109   
ref|XP_002871081.1|  phenyl alanine ammonia-lyase 3                     345   8e-109   
gb|ACM45573.1|  phenylalanine ammonia-lyase                             345   8e-109   
ref|XP_002448194.1|  hypothetical protein SORBIDRAFT_06g022750          344   1e-108   
gb|AAR24505.1|  phenylalanine ammonia-lyase                             345   1e-108   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       345   1e-108   
ref|XP_006647544.1|  PREDICTED: phenylalanine ammonia-lyase-like        345   1e-108   
dbj|BAJ85603.1|  predicted protein                                      345   1e-108   
ref|XP_003518580.1|  PREDICTED: phenylalanine ammonia-lyase class...    344   2e-108   
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             344   3e-108   
gb|ACM41719.1|  phenylalanine ammonia-lyase                             344   3e-108   
gb|EMT03788.1|  Phenylalanine ammonia-lyase                             344   3e-108   
dbj|BAJ87394.1|  predicted protein                                      343   4e-108   
dbj|BAJ87596.1|  predicted protein                                      343   6e-108   
ref|XP_004491627.1|  PREDICTED: phenylalanine ammonia-lyase class...    343   6e-108   
gb|AFW72411.1|  phenylalanine ammonia-lyase                             343   6e-108   
emb|CDY15917.1|  BnaA04g11940D                                          342   8e-108   
ref|XP_003575404.1|  PREDICTED: phenylalanine ammonia-lyase-like        343   1e-107   
gb|EMT29849.1|  Phenylalanine ammonia-lyase                             342   1e-107   
gb|KEH39353.1|  phenylalanine ammonia-lyase-like protein                342   2e-107   
gb|EMT07759.1|  Phenylalanine ammonia-lyase                             342   2e-107   
sp|Q43210.1|PALY_WHEAT  RecName: Full=Phenylalanine ammonia-lyase       342   2e-107   



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 233/276 (84%), Gaps = 2/276 (1%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             SNGH   FC           DPLNW  AAE+LKGSHLDEVKRMV E+RK  VKLGGETLT
Sbjct  10    SNGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLT  69

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             I+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT
Sbjct  70    ISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRT  127

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQGAALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  128   KQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  187

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE+LDAEEAFR AG
Sbjct  188   TKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAG  247

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I+SGFF LQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  248   IDSGFFVLQPKEGLALVNGTAVGSGLASMVLFEANI  283



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   422 bits (1085),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 220/276 (80%), Positives = 233/276 (84%), Gaps = 2/276 (1%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             SNGH   FC           DPLNW  AAE+LKGSHLDEVKRMV E+RK  VKLGGETLT
Sbjct  10    SNGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLT  69

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             I+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT
Sbjct  70    ISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRT  127

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQGAALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  128   KQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  187

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE+LDAEEAFR AG
Sbjct  188   TKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAG  247

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I+SGFF LQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  248   IDSGFFVLQPKEGLALVNGTAVGSGLASMVLFEANI  283



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   421 bits (1082),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 216/273 (79%), Positives = 235/273 (86%), Gaps = 8/273 (3%)
 Frame = +2

Query  242   HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             H++GFCV++++      DPLNW AAAEALKGSHLDEVKRMVEE+RK  VKLGGETLTI+Q
Sbjct  10    HSNGFCVQKQK------DPLNWGAAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLTISQ  63

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             VAA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  64    VAAIASRDNA--VAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  121

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
              ALQKELIRFLNAGIFG G ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITK 
Sbjct  122   GALQKELIRFLNAGIFGQGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  181

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGEAL+AEEAF+ AG+  
Sbjct  182   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNAEEAFKLAGVVG  241

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA + LYEANI
Sbjct  242   GFFELQPKEGLALVNGTAVGSGLASIALYEANI  274



>ref|XP_006345786.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=707

 Score =   420 bits (1079),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 223/281 (79%), Positives = 242/281 (86%), Gaps = 16/281 (6%)
 Frame = +2

Query  236   NGHAHG------FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  397
             NG+++G      FCV+         DPLNWN +A+AL+GSHLDEVK+MVEEYRK  V+LG
Sbjct  5     NGNSNGTHDDQVFCVK---------DPLNWNMSADALRGSHLDEVKKMVEEYRKPVVRLG  55

Query  398   GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             GETLT+AQVAA+AAQ GT +V V+LSEAARAGVKASSDWVM GM NGTDSYGVTTGFGAT
Sbjct  56    GETLTVAQVAAIAAQSGT-DVTVQLSEAARAGVKASSDWVMEGMRNGTDSYGVTTGFGAT  114

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTKQGAALQKELIRFLNAG+FGNG ESCH L HS TRA MLVRINTLLQGYSGIRFE
Sbjct  115   SHRRTKQGAALQKELIRFLNAGVFGNGTESCHMLPHSTTRAAMLVRINTLLQGYSGIRFE  174

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGRTNSKA GPNGE LDA  A
Sbjct  175   ILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRTNSKATGPNGELLDAVNA  234

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             F+RAGIESGFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  235   FQRAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  275



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   420 bits (1080),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 219/284 (77%), Positives = 238/284 (84%), Gaps = 5/284 (2%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             ME  NG  +   +  FC+    +     DPLNWN AA AL GSHLDEVK+MVEE+RK  V
Sbjct  1     MEYANGDCNGHSSQEFCI----KGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAV  56

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             +LGGETLT+AQVAA+A + GT EVKVELSE ARAGVKASSDWVM GM  GTDSYGVTTGF
Sbjct  57    RLGGETLTVAQVAAIAGRSGT-EVKVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGF  115

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQGAALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGI
Sbjct  116   GATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGI  175

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITKLLN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GP+GE LDA
Sbjct  176   RFEILEAITKLLNSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPDGELLDA  235

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              ++F+RAGIE+GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  236   VQSFQRAGIETGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  279



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   421 bits (1081),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 222/287 (77%), Positives = 236/287 (82%), Gaps = 6/287 (2%)
 Frame = +2

Query  212   ENGNGII----SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRK  379
             +NG  I     SNGH   FC           DPLNW  AAE+LKGSHLDEVKRMV E+RK
Sbjct  6     QNGTSITQNGTSNGHLQSFCSATNGGVGVVVDPLNWGVAAESLKGSHLDEVKRMVAEFRK  65

Query  380   ATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVT  559
               VKLGGETLTI+QVAA+A +     VKVELSE A AGVKAS+DWV+ GM  GTDSYGVT
Sbjct  66    PLVKLGGETLTISQVAAIATRDLG--VKVELSEDAMAGVKASADWVLDGMNKGTDSYGVT  123

Query  560   TGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGY  739
             TGFGATSHRRTKQGAALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGY
Sbjct  124   TGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGY  183

Query  740   SGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEA  919
             SGIRFEILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE+
Sbjct  184   SGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGES  243

Query  920   LDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             LDAEEAFR AGI+SGFF LQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  244   LDAEEAFRVAGIDSGFFVLQPKEGLALVNGTAVGSGLASMVLFEANI  290



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   419 bits (1078),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 223/286 (78%), Positives = 242/286 (85%), Gaps = 8/286 (3%)
 Frame = +2

Query  209   MENGNGIISNGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  382
             ME  NG   NGH  +  FC+    +     DPLNWN AA+ALKGSHLDEVK+MVEE+RK 
Sbjct  1     MEYANGN-CNGHNASQEFCI----KGHEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKP  55

Query  383   TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  562
              V+LGGETLTI QVAA+A + GT EV VEL+EAARAGVKASSDWV+ GM+NGTDSYGVTT
Sbjct  56    VVRLGGETLTIGQVAAIAGRSGT-EVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTT  114

Query  563   GFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYS  742
             GFGATSHRRTKQGAALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYS
Sbjct  115   GFGATSHRRTKQGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYS  174

Query  743   GIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEAL  922
             GIRFEILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE L
Sbjct  175   GIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELL  234

Query  923   DAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             DA +AF+ AGI++GFFELQPKE LAM NGTA GS LA MVL+EANI
Sbjct  235   DAVKAFQWAGIDTGFFELQPKEGLAMVNGTAVGSGLASMVLFEANI  280



>ref|XP_004239660.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=709

 Score =   419 bits (1076),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 221/278 (79%), Positives = 240/278 (86%), Gaps = 8/278 (3%)
 Frame = +2

Query  236   NGHAHG---FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             NG+++G   FCV    +A    DPLNWN +A+ALKGSHLD VK+MVEEYRK  V+LGGET
Sbjct  5     NGNSNGDQVFCV----KAQQQQDPLNWNVSADALKGSHLDAVKKMVEEYRKPVVRLGGET  60

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LT+AQVAA+AAQ G  +V V+LSEAARAGVKASSDWVM GM NGTDSYGVTTGFGATSHR
Sbjct  61    LTVAQVAAIAAQSGK-DVTVQLSEAARAGVKASSDWVMEGMRNGTDSYGVTTGFGATSHR  119

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQGAALQKELIRFLNAG+FG G ESCHTL HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  120   RTKQGAALQKELIRFLNAGVFGKGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  179

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE LDA  AF++
Sbjct  180   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLDAINAFQQ  239

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGIESGFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  240   AGIESGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  277



>gb|ABI93975.1| putative phenylalanine ammonia-lyase, partial [Rhizophora mangle]
Length=579

 Score =   413 bits (1062),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 212/275 (77%), Positives = 233/275 (85%), Gaps = 5/275 (2%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C  +  R    HDPLNW  AAE+LKGSHLDEVKRMV EYRK  VKLGGETLTI
Sbjct  11    NGSLDSLCTTKPPR----HDPLNWGVAAESLKGSHLDEVKRMVAEYRKHVVKLGGETLTI  66

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVAA++    +  + VEL+E+ARAGVKASSDWVM GM  GTDSYGVTTGFGATSHRRTK
Sbjct  67    AQVAAISRGVDS-GITVELAESARAGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTK  125

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG+ALQ+ELIRFLNAGIFG+G +SCHTL H+ TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  126   QGSALQRELIRFLNAGIFGHGTDSCHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAIT  185

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GP+G++L+A EAFR AGI
Sbjct  186   KLLNHNITPCLPLRGTITASGDLIPLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGI  245

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             ESGFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  246   ESGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  280



>dbj|BAA31258.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=319

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELI+FLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIKFLNAGIFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA +VL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASVVLFETNV  272



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   416 bits (1070),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 212/269 (79%), Positives = 226/269 (84%), Gaps = 2/269 (1%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FC E +     + DPLNWN AAE+LKGSHLDEVKRMVEE RK  VKLGGETLTI QV A+
Sbjct  3     FCHENRNGGLCTSDPLNWNFAAESLKGSHLDEVKRMVEESRKPVVKLGGETLTIGQVTAI  62

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A       ++VELSEAAR GV+ASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  63    ANHDSG--LRVELSEAARPGVQASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQ  120

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRF+ILEAITK LNHN
Sbjct  121   KELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHN  180

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNG+ LDA EAF+ AGI SGFFE
Sbjct  181   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQVLDASEAFQLAGITSGFFE  240

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   LQPKEGLALVNGTAVGSGLASMVLFEANV  269



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   416 bits (1068),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 214/273 (78%), Positives = 231/273 (85%), Gaps = 9/273 (3%)
 Frame = +2

Query  242   HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             H++GFCV+QK       DPLNW  AAEALKGSHLDEVK+MV E+RK  VKLGGETLTI+Q
Sbjct  10    HSNGFCVQQK-------DPLNWGVAAEALKGSHLDEVKKMVAEFRKPVVKLGGETLTISQ  62

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             VAA+AA+     V VEL+EAAR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63    VAAIAARDNG--VAVELAEAARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
              ALQKELIRFLNAGIFGN  ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITK 
Sbjct  121   GALQKELIRFLNAGIFGNATESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  180

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGEAL+A+EAF+ AG+  
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNADEAFKLAGVHG  240

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA + LYEAN+
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIALYEANV  273



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   416 bits (1068),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 221/285 (78%), Positives = 238/285 (84%), Gaps = 7/285 (2%)
 Frame = +2

Query  209   MENGNGIISNGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKAT  385
             ME  NG   NGH+    C+    +     DPLNWN AA AL GSHLDEVK+MVEE+RK  
Sbjct  1     MEYTNGD-CNGHSDQELCI----KGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPA  55

Query  386   VKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTG  565
             V+LGGETLT+AQVAA+A + GT EV VELSE ARAGVKASSDWVM GM  GTDSYGVTTG
Sbjct  56    VRLGGETLTVAQVAAIAGRSGT-EVTVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTG  114

Query  566   FGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSG  745
             FGATSHRRTKQGAALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSG
Sbjct  115   FGATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSG  174

Query  746   IRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALD  925
             IRFEILEAITKLLN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GP+GE LD
Sbjct  175   IRFEILEAITKLLNSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPDGELLD  234

Query  926   AEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             A +AF+RAGIE+GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  235   AVQAFQRAGIETGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  279



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   416 bits (1068),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 234/284 (82%), Gaps = 9/284 (3%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MEN NG + NG A  FC+ +        DPLNW  AAEA+ GSHLDEVKRMV E+RK  V
Sbjct  1     MENNNGHV-NGVATDFCINK--------DPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVV  51

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             KLGGETLT++QVA +AA G +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  52    KLGGETLTVSQVAGIAAAGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGF  111

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGI
Sbjct  112   GATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGI  171

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LN N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+A
Sbjct  172   RFEILEAITKFLNTNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEILNA  231

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             E+AF  AG+  GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  232   EKAFSLAGVSGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  275



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   416 bits (1068),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 222/287 (77%), Positives = 242/287 (84%), Gaps = 9/287 (3%)
 Frame = +2

Query  209   MENGNGIISNGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRK  379
             ME  NG   NGH   +   C+    + +   DPLNWN AA+ALKGSHLDEVK+MVEE+RK
Sbjct  1     MEYANGN-CNGHNNASQELCI----KGNEQQDPLNWNMAADALKGSHLDEVKKMVEEFRK  55

Query  380   ATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVT  559
               V+LGGETLTIAQVAA+A + GT EV VEL+EAARAGVKASSDWV+ GM+NGTDSYGVT
Sbjct  56    PVVQLGGETLTIAQVAAIAGRSGT-EVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVT  114

Query  560   TGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGY  739
             TGFGATSHRRTKQGAALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGY
Sbjct  115   TGFGATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGY  174

Query  740   SGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEA  919
             SGIRFEILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA G NGE 
Sbjct  175   SGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGANGEL  234

Query  920   LDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             LDA  AF+ AGI++GFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  235   LDAVMAFQLAGIDTGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  281



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   416 bits (1068),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 220/282 (78%), Positives = 234/282 (83%), Gaps = 7/282 (2%)
 Frame = +2

Query  227   IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             I  NGH  G    FC   K  A  + DPLNW  AAE+LKGSHLDEVKRMV EYR   VKL
Sbjct  4     ITQNGHHKGSLESFCTASKG-AGGAIDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLVKL  62

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTI+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGA
Sbjct  63    GGETLTISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQGAALQKELIRFLNAGIFG+G ESCHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  121   TSHRRTKQGAALQKELIRFLNAGIFGHGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  180

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE LDAEE
Sbjct  181   EILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAEE  240

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AFR AGI+SGFF LQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  241   AFRVAGIDSGFFVLQPKEGLALVNGTAVGSGMASMVLFEANI  282



>ref|XP_008449236.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=705

 Score =   415 bits (1066),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 213/260 (82%), Positives = 228/260 (88%), Gaps = 2/260 (1%)
 Frame = +2

Query  281   SSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV  460
             S +HDPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V
Sbjct  10    SFTHDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDI--DV  67

Query  461   KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNA  640
              VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNA
Sbjct  68    TVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNA  127

Query  641   GIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  820
             GIFGNG ES HTL+ S TRA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG
Sbjct  128   GIFGNGVESSHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  187

Query  821   TITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAM  1000
             TITASGDL PLSYI GL+TGR NSKAVGPN E+LDA EAF+RAGI SGFFELQPKE LA+
Sbjct  188   TITASGDLVPLSYIAGLLTGRPNSKAVGPNEESLDANEAFQRAGIPSGFFELQPKEGLAL  247

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS LA +VL+EANI
Sbjct  248   VNGTAVGSGLASIVLFEANI  267



>emb|CBI31445.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 216/286 (76%), Positives = 237/286 (83%), Gaps = 5/286 (2%)
 Frame = +2

Query  209   MENGNGIISNGHA--HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  382
             + NGN   +NG A    FC+      +++ DPLNWN AAE+LKGSHLDEVKRMVEEYR+ 
Sbjct  3     LSNGNHCHTNGKASIESFCMGDTGTKAAA-DPLNWNMAAESLKGSHLDEVKRMVEEYRRQ  61

Query  383   TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  562
              V+LGGETLTI+QVAAVA++     V VELSE AR GVKASSDWVM  M NGTDSYGVTT
Sbjct  62    VVQLGGETLTISQVAAVASRDTG--VTVELSEEAREGVKASSDWVMDSMNNGTDSYGVTT  119

Query  563   GFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYS  742
             GFGATSHRRTKQG ALQ ELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYS
Sbjct  120   GFGATSHRRTKQGGALQMELIRFLNAGIFGNGTESCHTLPHSATRASMLVRINTLLQGYS  179

Query  743   GIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEAL  922
             GIRFEILEAITKL+NHNITPCLPLRGTI+ASGDL PLSYI GL+ GR++ KAVGPNGE L
Sbjct  180   GIRFEILEAITKLINHNITPCLPLRGTISASGDLVPLSYIAGLLLGRSSCKAVGPNGEPL  239

Query  923   DAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AEEAFR AGI+ GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  240   SAEEAFRVAGIKGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  285



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   414 bits (1064),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 219/282 (78%), Positives = 234/282 (83%), Gaps = 7/282 (2%)
 Frame = +2

Query  227   IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             I  NGH  G    FC   K  A  + DPLNW  AAE+LKGSHLDEVKRMV EYR   VKL
Sbjct  4     ITQNGHHKGSLESFCTASKG-AGGAVDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLVKL  62

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTI+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGA
Sbjct  63    GGETLTISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQGAALQKELIRFLNAG+FG+G ESCHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  121   TSHRRTKQGAALQKELIRFLNAGVFGHGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  180

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE LDAEE
Sbjct  181   EILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAEE  240

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AFR AGI+SGFF LQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  241   AFRVAGIDSGFFVLQPKEGLALVNGTAVGSGMASMVLFEANI  282



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   414 bits (1063),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 235/283 (83%), Gaps = 12/283 (4%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENG+    N     FC       ++  DPL+W  AAE++KGSHLDEVK+MV EYRK  VK
Sbjct  6     ENGS---KNDSLESFC-------NTGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVK  55

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLT+AQVAA+A+      VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  56    LGGETLTVAQVAAIASHDCG--VKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFG  113

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIR
Sbjct  114   ATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIR  173

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE++DA 
Sbjct  174   FEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESMDAL  233

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAFR AGIESGFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  234   EAFRLAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  276



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   414 bits (1063),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 217/276 (79%), Positives = 239/276 (87%), Gaps = 5/276 (2%)
 Frame = +2

Query  236   NGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             NGHA    CV   +      DPLNWN AA+ALKGSHLDEVKRMV+E+RK  V+LGGETLT
Sbjct  9     NGHASQDICV---KGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLGGETLT  65

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             +AQVAA+A+Q GT +V V+LSEA+RAGVKASSDWV+ GM NGTDSYGVTTGFGATSHRRT
Sbjct  66    VAQVAAIASQSGT-DVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATSHRRT  124

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             K+GAALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  125   KEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  184

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE LDA +AF+RAG
Sbjct  185   TKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLDAVKAFQRAG  244

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I++GFFELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  245   IDTGFFELQPKEGLALVNGTAVGSGLASMVLFDANI  280



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   413 bits (1062),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 232/280 (83%), Gaps = 9/280 (3%)
 Frame = +2

Query  224   GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             G+  NGH    FCV+         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3     GVAQNGHQEMDFCVKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55    ETLTVAQVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATS  114

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTK G ALQKELIRFLNAG+FGNG ESCHTL  S TRA MLVRINTLLQGYSGIRFEI
Sbjct  115   HRRTKNGGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEI  174

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE L+AEEAF
Sbjct  175   LEAITKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLNAEEAF  234

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             R AG+ SGFFELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  235   RVAGVNSGFFELQPKEGLALVNGTAVGSGLASMVLFDANI  274



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   414 bits (1063),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 231/276 (84%), Gaps = 3/276 (1%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSH-DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             NG    FC         +  DPLNW A AE+LKGSHLDEVKRMV EYRK +VKLGGETLT
Sbjct  11    NGSLESFCTTASTATKGAVVDPLNWGATAESLKGSHLDEVKRMVAEYRKPSVKLGGETLT  70

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             I+QVAA+A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT
Sbjct  71    ISQVAAIATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRT  128

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQGAALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  129   KQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  188

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE+LDA+EAF  AG
Sbjct  189   TKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGESLDAQEAFCVAG  248

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I++GFF LQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  249   IDTGFFVLQPKEGLALVNGTAVGSGLASMVLFEANI  284



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   413 bits (1062),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 212/256 (83%), Positives = 224/256 (88%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAE+LKGSHLDEVKRMV EYR+  VKLGGETLTI+QVAA+A +     VKVEL
Sbjct  24    DPLNWGVAAESLKGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLG--VKVEL  81

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRT QGAALQKELIRFLNAGIFG
Sbjct  82    SEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTNQGAALQKELIRFLNAGIFG  141

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNH ITPCLPLRGTITA
Sbjct  142   NGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHGITPCLPLRGTITA  201

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNGE LDA+EAFR AGI+SGFF LQPKE LA+ NGT
Sbjct  202   SGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFRLAGIDSGFFVLQPKESLALVNGT  261

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA MVL+EANI
Sbjct  262   AVGSGLASMVLFEANI  277



>emb|CAL91170.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=264

 Score =   397 bits (1020),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 209/273 (77%), Positives = 225/273 (82%), Gaps = 10/273 (4%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MEN NG + NG A  FC+ +        DPLNW  AAEA+ GSHLDEVKRMV E+RK  V
Sbjct  1     MENNNGHV-NGVATDFCINK--------DPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVV  51

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             KLGGETLT++QVA +AA G +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  52    KLGGETLTVSQVAGIAAAGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGF  111

Query  569   GATSHRRTKQGAALQKELIR-FLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSG  745
             GATSHRRTKQG ALQKELIR FLNAGIFGNG+ESCHTL HS TRA MLVRINTLLQGYSG
Sbjct  112   GATSHRRTKQGGALQKELIRRFLNAGIFGNGSESCHTLPHSATRAAMLVRINTLLQGYSG  171

Query  746   IRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALD  925
             IRFEILEAITK LN N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+
Sbjct  172   IRFEILEAITKFLNTNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEILN  231

Query  926   AEEAFRRAGIESGFFELQPKERLAMANGTADGS  1024
             AE+AF  AG+  GFFELQPKE LA+ NGTA GS
Sbjct  232   AEKAFSLAGVSGGFFELQPKEGLALVNGTAVGS  264



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   413 bits (1061),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 234/283 (83%), Gaps = 12/283 (4%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENG+    N     FC       +   DPL+W  AAE++KGSHLDEVK+MV EYRK  VK
Sbjct  6     ENGS---KNDSLESFC-------NMGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVK  55

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLT+AQVAA+A+      VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  56    LGGETLTVAQVAAIASHDCG--VKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFG  113

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIR
Sbjct  114   ATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIR  173

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE++DA 
Sbjct  174   FEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESMDAL  233

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAFR AGIESGFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  234   EAFRLAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  276



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 231/276 (84%), Gaps = 10/276 (4%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             +NGH +GFCV+         DPLNW  AA++L+GSHLDEVK MV E+RK  VKLGGETLT
Sbjct  8     NNGHQNGFCVKV--------DPLNWEVAADSLRGSHLDEVKVMVAEFRKPAVKLGGETLT  59

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             +AQVAA+A++     V VELSE +RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  60    VAQVAAIASRDNA--VTVELSEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  117

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  118   KQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  177

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLNHNITPCLPLRGTITASGDL PLSYI GLITGR NSKAVGPNGE L+AEEA R AG
Sbjct  178   TKLLNHNITPCLPLRGTITASGDLVPLSYIAGLITGRPNSKAVGPNGETLNAEEALRLAG  237

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +  GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  238   VNGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  273



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   411 bits (1057),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 233/284 (82%), Gaps = 11/284 (4%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MENG  +  NG A+GFC++         DPLNW  AAEAL GSHLDEVK+MV E+RK  V
Sbjct  1     MENGTHV--NGSANGFCIK---------DPLNWGVAAEALTGSHLDEVKKMVGEFRKPVV  49

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             KLGGETLT++QVA ++A G    VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  50    KLGGETLTVSQVAGISAAGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGF  109

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTK G ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGI
Sbjct  110   GATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  169

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L+A
Sbjct  170   RFEILEAITKFLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEVLNA  229

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             E AF +AG+E GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  230   ESAFAQAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  273



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 212/269 (79%), Positives = 228/269 (85%), Gaps = 2/269 (1%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FC           DPLNW  AA++L+GSHLDEVKRMV EYR++ VKLGGETLTI+QVAA+
Sbjct  17    FCTTTTTAKGGVVDPLNWGVAAKSLQGSHLDEVKRMVAEYRRSLVKLGGETLTISQVAAI  76

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRTKQGAALQ
Sbjct  77    ATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQ  134

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  135   KELIRFLNAGIFGNGIESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  194

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             +TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE LDA+EAF  AGI+SGFF 
Sbjct  195   VTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFHVAGIDSGFFV  254

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  255   LQPKEGLALVNGTAVGSGLASMVLFEANI  283



>ref|XP_012082374.1| PREDICTED: phenylalanine ammonia-lyase [Jatropha curcas]
 gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 214/282 (76%), Positives = 236/282 (84%), Gaps = 14/282 (5%)
 Frame = +2

Query  227   IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             II NGH +G     C+        + DPL+W  AAE++KGSHLDEVK+MV EYRK  VKL
Sbjct  4     IIGNGHQNGSLEGLCI--------TRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKL  55

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLT+AQVAA+A+      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  56    GGETLTVAQVAAIASHDAG--VKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGA  113

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQGAALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  114   TSHRRTKQGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRF  173

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GP+GE+LDA E
Sbjct  174   EILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPSGESLDAVE  233

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AFR A I+SGFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  234   AFRLADIDSGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  275



>ref|XP_012082376.1| PREDICTED: phenylalanine ammonia-lyase-like [Jatropha curcas]
Length=713

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 214/282 (76%), Positives = 236/282 (84%), Gaps = 14/282 (5%)
 Frame = +2

Query  227   IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             II NGH +G     C+        + DPL+W  AAE++KGSHLDEVK+MV EYRK  VKL
Sbjct  4     IIGNGHQNGSLEGLCI--------TRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKL  55

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLT+AQVAA+A+     +VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  56    GGETLTVAQVAAIASHDA--DVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGA  113

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQGAALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  114   TSHRRTKQGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRF  173

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GP GE+LDA E
Sbjct  174   EILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPTGESLDAVE  233

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF  AGI+SGFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  234   AFCLAGIDSGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  275



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 209/279 (75%), Positives = 236/279 (85%), Gaps = 1/279 (0%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5     IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  407   LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65    LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  125   RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  184

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAFR
Sbjct  185   EAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFR  244

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+ SGFFELQPKE LA+ NGTA GS +A MVL+E+NI
Sbjct  245   VAGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNI  283



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 209/279 (75%), Positives = 236/279 (85%), Gaps = 1/279 (0%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5     IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  407   LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65    LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  125   RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  184

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAFR
Sbjct  185   EAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFR  244

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+ SGFFELQPKE LA+ NGTA GS +A MVL+E+NI
Sbjct  245   VAGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNI  283



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   412 bits (1059),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 230/282 (82%), Gaps = 13/282 (5%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGNG   NG    FCV+Q        DPLNW  AAE+LKGSHLDEVKRMV+EYRK  VKL
Sbjct  9     NGNG---NGSIKSFCVQQ--------DPLNWQMAAESLKGSHLDEVKRMVQEYRKPVVKL  57

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTI+QVAA+A       VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  58    GGETLTISQVAAIATHDAG--VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGA  115

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  116   TSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  175

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITK LN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G  L+A E
Sbjct  176   EILEAITKFLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGHILNASE  235

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF  AG+  GFFELQPKE LA+ NGTA GS LA MVL+E NI
Sbjct  236   AFNLAGVNDGFFELQPKEGLALVNGTAVGSGLASMVLFETNI  277



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/275 (77%), Positives = 229/275 (83%), Gaps = 8/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     CV Q+       DPL+W  AAEA+KGSHLDEVKRMV +YRK  VKLGGETLTI
Sbjct  11    NGSLESLCVNQR-------DPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGETLTI  63

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  64    AQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  122

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  123   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  182

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             +LLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GP GE LDA EAF+ AGI
Sbjct  183   RLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAAGI  242

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             ESGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  243   ESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  277



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   411 bits (1057),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 239/276 (87%), Gaps = 5/276 (2%)
 Frame = +2

Query  236   NGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             NGHA    CV   +      DPLNWN AA+ALKGSHLDEVKRMV+E+RK  V+LGGETLT
Sbjct  9     NGHASQDICV---KGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLGGETLT  65

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             +AQVAA+A+Q GT +V V+LSEA+RAGVKASSDWV+ GM NGTDSYGVTTGFGATSHRRT
Sbjct  66    VAQVAAIASQSGT-DVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATSHRRT  124

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             K+GAALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  125   KEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  184

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE L+A +AF+RAG
Sbjct  185   TKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLNAVKAFQRAG  244

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I++GFFELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  245   IDTGFFELQPKEGLALVNGTAVGSGLASMVLFDANI  280



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   410 bits (1055),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 227/269 (84%), Gaps = 2/269 (1%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FC + +     + DPLNWN AAE+LKGSHLDEVKRMVEE+RK  VKLGGETLTI QV A+
Sbjct  3     FCHDNRNGGLCTSDPLNWNFAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIGQVTAI  62

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A+      V+VELSE ARAGV+ASSDWVM  M+NGTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  63    ASHDSG--VRVELSETARAGVQASSDWVMESMKNGTDSYGVTTGFGATSHRRTKQGGALQ  120

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFG+G ESCHTL HS TRA MLVRINTLLQGYSGIRF+ILEAITK LNHN
Sbjct  121   KELIRFLNAGIFGSGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHN  180

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNG+ L+A  AF+ AGI SGFFE
Sbjct  181   ITPCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPNGQVLNASAAFQLAGISSGFFE  240

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA  VL+EANI
Sbjct  241   LQPKEGLALVNGTAVGSGLASTVLFEANI  269



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   411 bits (1056),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 214/282 (76%), Positives = 235/282 (83%), Gaps = 14/282 (5%)
 Frame = +2

Query  227   IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             II NGH +G     C+        + DPL+W  AAE++KGSHLDEVK+MV EYRK  VKL
Sbjct  4     IIGNGHQNGSLEGLCI--------TRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKL  55

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLT+AQVAA+A+      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  56    GGETLTVAQVAAIASHDAG--VKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGA  113

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQGAALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  114   TSHRRTKQGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRF  173

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GP GE+LDA E
Sbjct  174   EILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPTGESLDAVE  233

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF  AGI+SGFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  234   AFCLAGIDSGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  275



>gb|AAW51923.2| phenylalanine ammonia-lyase 2 [Rhizophora mangle]
Length=723

 Score =   411 bits (1056),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 212/275 (77%), Positives = 233/275 (85%), Gaps = 5/275 (2%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C  +  R    HDPLNW  AAE+LKGSHLDEVKRMV EYRK  VKLGGETLTI
Sbjct  11    NGSLDSLCTTKPPR----HDPLNWGVAAESLKGSHLDEVKRMVAEYRKHVVKLGGETLTI  66

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVAA++    +  + VEL+E+ARAGVKASSDWVM GM  GTDSYGVTTGFGATSHRRTK
Sbjct  67    AQVAAISRGVDS-GITVELAESARAGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTK  125

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG+ALQ+ELIRFLNAGIFG+G +SCHTL H+ TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  126   QGSALQRELIRFLNAGIFGHGTDSCHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAIT  185

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GP+G++L+A EAFR AGI
Sbjct  186   KLLNHNITPCLPLRGTITASGDLIPLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGI  245

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             ESGFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  246   ESGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  280



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   411 bits (1056),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 216/286 (76%), Positives = 237/286 (83%), Gaps = 5/286 (2%)
 Frame = +2

Query  209   MENGNGIISNGHA--HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  382
             + NGN   +NG A    FC+      +++ DPLNWN AAE+LKGSHLDEVKRMVEEYR+ 
Sbjct  3     LSNGNHCHTNGKASIESFCMGDTGTKAAA-DPLNWNMAAESLKGSHLDEVKRMVEEYRRQ  61

Query  383   TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  562
              V+LGGETLTI+QVAAVA++     V VELSE AR GVKASSDWVM  M NGTDSYGVTT
Sbjct  62    VVQLGGETLTISQVAAVASRDTG--VTVELSEEAREGVKASSDWVMDSMNNGTDSYGVTT  119

Query  563   GFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYS  742
             GFGATSHRRTKQG ALQ ELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYS
Sbjct  120   GFGATSHRRTKQGGALQMELIRFLNAGIFGNGTESCHTLPHSATRASMLVRINTLLQGYS  179

Query  743   GIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEAL  922
             GIRFEILEAITKL+NHNITPCLPLRGTI+ASGDL PLSYI GL+ GR++ KAVGPNGE L
Sbjct  180   GIRFEILEAITKLINHNITPCLPLRGTISASGDLVPLSYIAGLLLGRSSCKAVGPNGEPL  239

Query  923   DAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AEEAFR AGI+ GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  240   SAEEAFRVAGIKGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  285



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   410 bits (1055),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 216/276 (78%), Positives = 232/276 (84%), Gaps = 10/276 (4%)
 Frame = +2

Query  236   NGH-AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             NGH ++GFCV+Q       +DPLNW AAAEAL+GSHLDEVK+MVEE+RK  VKLGGETLT
Sbjct  7     NGHQSNGFCVKQ-------NDPLNWAAAAEALQGSHLDEVKKMVEEFRKPAVKLGGETLT  59

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             IAQVAA+AA+     V VELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  60    IAQVAAIAARDNA--VAVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRT  117

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQG ALQ ELIRFLNAGIFG G E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  118   KQGGALQTELIRFLNAGIFGKGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  177

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G  L+AEEAF+ AG
Sbjct  178   TKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGSELNAEEAFKLAG  237

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +  GFFELQPKE LA+ NGTA GS LA + LYEANI
Sbjct  238   VSGGFFELQPKEGLALVNGTAVGSGLASIALYEANI  273



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   410 bits (1054),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 212/282 (75%), Positives = 233/282 (83%), Gaps = 12/282 (4%)
 Frame = +2

Query  227   IISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             +  NGH +G     C+ Q        DPL+W  AAEA+KGSHLDEVKRMV +YRK  VKL
Sbjct  4     VTKNGHQNGSLESLCINQL-------DPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKL  56

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTIAQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGA
Sbjct  57    GGETLTIAQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGA  115

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  116   TSHRRTKQGGALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRF  175

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA GP+GE LDA E
Sbjct  176   EILEAITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPSGEVLDAVE  235

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF+ AGIESGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  236   AFKTAGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  277



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   410 bits (1054),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 234/280 (84%), Gaps = 3/280 (1%)
 Frame = +2

Query  224   GIISNGHAHGFCVEQKRRASS-SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
              I  NG    FC      +++ + DPLNW   AE+LKGSHLDEVKRMV EYRK  VKLGG
Sbjct  3     AITQNGSLDSFCTTTANGSTAFAADPLNWGVVAESLKGSHLDEVKRMVMEYRKPLVKLGG  62

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLTI+QVAA+AA      VKVELS+ ARA VKAS+DWV+ GM  GTDSYGVTTGFGATS
Sbjct  63    ETLTISQVAAIAAHDSG--VKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTKQGAALQKELIRFLNAGIFGNG ESC+TL HS TRA MLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G++L+AEEAF
Sbjct  181   LEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLNAEEAF  240

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             R AGI+SGFF LQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   RVAGIDSGFFMLQPKEGLALVNGTAVGSGLASMVLFEANV  280



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 208/256 (81%), Positives = 223/256 (87%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEALKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+A +    +V VEL
Sbjct  16    DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREX--DVSVEL  73

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  74    SETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  133

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT+TA
Sbjct  134   NGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTA  193

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFELQPKE LA+ NGT
Sbjct  194   SGDLVPLSYIXGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGT  253

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA MVL+E N+
Sbjct  254   AVGSGLASMVLFETNV  269



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/275 (77%), Positives = 228/275 (83%), Gaps = 8/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     CV Q        DPL+W  AAEA+KGSHLDEVKRMV +YRK  VKLGGETLTI
Sbjct  11    NGSLESLCVNQL-------DPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGETLTI  63

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  64    AQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  122

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  123   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  182

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             +LLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GP GE LDA EAF+ AGI
Sbjct  183   RLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAAGI  242

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             ESGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  243   ESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  277



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 208/279 (75%), Positives = 235/279 (84%), Gaps = 1/279 (0%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5     IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  407   LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65    LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  125   RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  184

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEE FR
Sbjct  185   EAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEERFR  244

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+ SGFFELQPKE LA+ NGTA GS +A MVL+E+NI
Sbjct  245   VAGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNI  283



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 234/280 (84%), Gaps = 3/280 (1%)
 Frame = +2

Query  224   GIISNGHAHGFCVEQKRRASS-SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
              I  NG    FC      +++ + DPLNW   AE+LKGSHLDEVKRMV EYRK  VKLGG
Sbjct  3     AITQNGSFDSFCTTTANGSTAFAADPLNWGIVAESLKGSHLDEVKRMVMEYRKPLVKLGG  62

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLTI+QVAA+AA      VKVELS+ ARA VKAS+DWV+ GM  GTDSYGVTTGFGATS
Sbjct  63    ETLTISQVAAIAAHDSG--VKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTKQGAALQKELIRFLNAGIFGNG ESC+TL HS TRA MLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G++L+AEEAF
Sbjct  181   LEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLNAEEAF  240

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             R AGI+SGFF LQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   RVAGIDSGFFMLQPKEGLALVNGTAVGSGLASMVLFEANV  280



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 213/280 (76%), Positives = 231/280 (83%), Gaps = 9/280 (3%)
 Frame = +2

Query  224   GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             G+  NGH    FCV+         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3     GVAQNGHQEMDFCVKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55    ETLTVAQVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATS  114

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTK G ALQKELIRFLNAG+FGNG ESCHTL  S TRA MLVRINTLLQGYSGIRFEI
Sbjct  115   HRRTKNGGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEI  174

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE L+AEEAF
Sbjct  175   LEAITKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLNAEEAF  234

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
               AG+ SGFFELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  235   GVAGVNSGFFELQPKEGLALVNGTAVGSGLASMVLFDANI  274



>emb|CDO99754.1| unnamed protein product [Coffea canephora]
Length=660

 Score =   408 bits (1048),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 237/282 (84%), Gaps = 7/282 (2%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5     NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTIAQVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59    GGETLTIAQVAAIAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  118   TSHRRTKQGGALQEELIRFLNAGIFGNGTETCHTLPHSATRASMLVRINTLLQGYSGIRF  177

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G+ ++A E
Sbjct  178   EILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPDGKFVNATE  237

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF  AGI++GFFELQ KE LA+ NGTA GS LA MVL+EANI
Sbjct  238   AFSLAGIDTGFFELQAKEGLALVNGTAVGSALASMVLFEANI  279



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 236/282 (84%), Gaps = 12/282 (4%)
 Frame = +2

Query  224   GIISNGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  397
              ++ NGH   +GFCV+Q       +DPLNW AAAE LKGSHLDEVKRMVEE+RK  VKLG
Sbjct  3     AVVENGHHGNNGFCVKQ-------NDPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLG  55

Query  398   GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             GETLTI+QVAA+AA+    EV V+L+E++RAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  56    GETLTISQVAAIAARDN--EVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGAT  113

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTKQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFE
Sbjct  114   SHRRTKQGGALQKELIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFE  173

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILE ITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE+L+AE+A
Sbjct  174   ILETITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAEQA  233

Query  938   FRRAGIESG-FFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             F+ AG  SG FFELQPKE LA+ NGTA GS LA + LYEANI
Sbjct  234   FKLAGANSGLFFELQPKEGLALVNGTAVGSGLASIALYEANI  275



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/279 (75%), Positives = 235/279 (84%), Gaps = 1/279 (0%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5     IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  407   LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             LT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  65    LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSH  124

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  125   RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  184

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF 
Sbjct  185   EAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFH  244

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+ SGFFELQPKE LA+ NGTA GS +A MVL+E+NI
Sbjct  245   VAGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNI  283



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 212/269 (79%), Positives = 225/269 (84%), Gaps = 2/269 (1%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FC           DPLNW  AAE+L+GSHLDEVKRMV EYR+  VKLGGETLTI+QVAA+
Sbjct  17    FCTTTTAAKGGVVDPLNWGVAAESLQGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAI  76

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A +     VKVELSE ARAGVKAS+DWV+ GM  GTDSYGVTTGFGATSHRRTKQGAALQ
Sbjct  77    ATRDLG--VKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQ  134

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  135   KELIRFLNAGIFGNGIESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  194

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             +TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPN E LDA+EAF  AGI SGFF 
Sbjct  195   VTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNEEPLDAQEAFHVAGINSGFFV  254

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  255   LQPKEGLALVNGTAVGSGLASMVLFEANI  283



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   409 bits (1051),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 229/280 (82%), Gaps = 9/280 (3%)
 Frame = +2

Query  224   GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             G+  NGH    FCV+         DPLNW  AA++LKGSHLDEVK MV EYRK  VKLGG
Sbjct  3     GVAQNGHQEMDFCVKV--------DPLNWEMAADSLKGSHLDEVKIMVAEYRKPVVKLGG  54

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLT+AQVAA+AA+     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55    ETLTVAQVAAIAAKDNAKTVTVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATS  114

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTK G ALQKELIRFLNAG+FGNG ESCHTL  S TRA MLVRINTLLQGYSGIRFEI
Sbjct  115   HRRTKNGGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEI  174

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF
Sbjct  175   LEAITKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAF  234

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             R AG+  GFFELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  235   RVAGVNGGFFELQPKEGLALVNGTAVGSGLASMVLFDANI  274



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   409 bits (1051),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 212/280 (76%), Positives = 231/280 (83%), Gaps = 9/280 (3%)
 Frame = +2

Query  224   GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             G+  NGH    FC++         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3     GVAQNGHQEMDFCMKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55    ETLTVAQVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATS  114

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTK G ALQKELIRFLNAG+FGNG ESCHTL  S TRA MLVRINTLLQGYSGIRFEI
Sbjct  115   HRRTKNGGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEI  174

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF
Sbjct  175   LEAITKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAF  234

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             R AG+  GFFELQPKE LA+ NGTA GS LA MVL++AN+
Sbjct  235   RVAGVNGGFFELQPKEGLALVNGTAVGSGLASMVLFDANV  274



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 212/280 (76%), Positives = 231/280 (83%), Gaps = 9/280 (3%)
 Frame = +2

Query  224   GIISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             G+  NGH    FC++         DPLNW  AA++LKGSHLDEVK+MV E+RK  VKLGG
Sbjct  3     GVAQNGHQEMDFCMKV--------DPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGG  54

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLT+AQVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  55    ETLTVAQVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATS  114

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTK G ALQKELIRFLNAG+FGNG ESCHTL  S TRA MLVRINTLLQGYSGIRFEI
Sbjct  115   HRRTKNGGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEI  174

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF
Sbjct  175   LEAITKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAF  234

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             R AG+  GFFELQPKE LA+ NGTA GS LA MVL++AN+
Sbjct  235   RVAGVNGGFFELQPKEGLALVNGTAVGSGLASMVLFDANV  274



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   408 bits (1049),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 213/277 (77%), Positives = 231/277 (83%), Gaps = 12/277 (4%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSH--DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             NG    FC        +SH  DPLNW  AAEALKGSHLDEVKRMV+EYR+  VKLGGETL
Sbjct  13    NGSMESFC--------TSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETL  64

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TI+QVAA+A +    +V V+L+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  65    TISQVAAIATRDS--DVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  122

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNGAES HTL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  123   TKQGGALQKELIRFLNAGIFGNGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  182

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             IT LLN N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDAE AF++A
Sbjct  183   ITNLLNENVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQA  242

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GI SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  243   GIPSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  279



>gb|AEL21616.1| phenylalanine ammonia lyase 1 [Coffea arabica]
Length=717

 Score =   408 bits (1049),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 237/282 (84%), Gaps = 7/282 (2%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5     NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTIAQVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59    GGETLTIAQVAAIAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  118   TSHRRTKQGGALQEELIRFLNAGIFGNGTETCHTLPHSATRASMLVRINTLLQGYSGIRF  177

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G+ ++A E
Sbjct  178   EILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPDGKFVNATE  237

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF  AGI++GFFELQ KE LA+ NGTA GS LA MVL+EANI
Sbjct  238   AFSLAGIDTGFFELQAKEGLALVNGTAVGSALASMVLFEANI  279



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   408 bits (1048),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 210/256 (82%), Positives = 226/256 (88%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEALKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V VEL
Sbjct  17    DPLNWGVAAEALKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDT--DVIVEL  74

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  75    SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  134

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +GAES HTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITA
Sbjct  135   SGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITA  194

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA+GPNGE  DA+EAF++AGI SGFFELQPKE LA+ NGT
Sbjct  195   SGDLVPLSYIAGLLTGRPNSKAIGPNGENFDAKEAFQQAGIPSGFFELQPKEGLALVNGT  254

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  255   AVGSGLASIVLFEANI  270



>gb|AFP49806.1| phenylalanine ammonialyase 1 [Coffea arabica]
Length=717

 Score =   408 bits (1048),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 237/282 (84%), Gaps = 7/282 (2%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5     NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTIAQVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59    GGETLTIAQVAAIAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  118   TSHRRTKQGGALQEELIRFLNAGIFGNGTETCHTLPHSATRASMLVRINTLLQGYSGIRF  177

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G+ ++A E
Sbjct  178   EILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPDGKFVNATE  237

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF  AGI++GFFELQ KE LA+ NGTA GS LA MVL+EANI
Sbjct  238   AFSLAGIDTGFFELQAKEGLALVNGTAVGSALASMVLFEANI  279



>emb|CBI26455.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   407 bits (1045),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  39    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  89

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  90    AGREG--DVSVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  147

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  148   KELIRFLNAGIFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  207

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  208   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  267

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  268   LQPKEGLALVNGTAVGSGLASMVLFETNV  296



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   408 bits (1048),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPLVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVSVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYISGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   408 bits (1048),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 211/278 (76%), Positives = 232/278 (83%), Gaps = 4/278 (1%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             +  NG+ +G     +   S+  DPL+W  AAEA+KGSHLDEVKRMV +YRK+ VKLGGET
Sbjct  4     VTKNGYQNG---SLESLCSNQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKSVVKLGGET  60

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVA++A    T +VKVELSE+AR GVKASSDWVM  M+ GTDSYGVTTGFGATSHR
Sbjct  61    LTIAQVASIAGHD-TGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHR  119

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  120   RTKQGGALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  179

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GP GE LDA EAF  
Sbjct  180   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFEA  239

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGIESGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  240   AGIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  277



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   407 bits (1047),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 207/256 (81%), Positives = 223/256 (87%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEALKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+A +    +V VEL
Sbjct  19    DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREE--DVSVEL  76

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  77    SETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  136

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ESCHTL +S TRA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT+TA
Sbjct  137   NGTESCHTLPYSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTA  196

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFELQPKE LA+ NGT
Sbjct  197   SGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGT  256

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA MVL+E N+
Sbjct  257   AVGSGLASMVLFETNV  272



>ref|XP_012093279.1| PREDICTED: phenylalanine ammonia-lyase G2B [Jatropha curcas]
 gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 209/274 (76%), Positives = 225/274 (82%), Gaps = 7/274 (3%)
 Frame = +2

Query  254   FCVEQKRRASSS-----HDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIa  418
             FC +     + S      DPLNW A AE+LKGSHLDEVKRM+ EYRK  VKLGGETLTIA
Sbjct  3     FCQQTPNNGNGSPGFNVSDPLNWGAVAESLKGSHLDEVKRMINEYRKPVVKLGGETLTIA  62

Query  419   qvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQ  598
             QV A+A +     VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQ
Sbjct  63    QVTAIANRDAG--VKVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  599   GAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITK  778
             G ALQ+ELIRFLNAGIFGNG E+CH L HS TRA MLVRINTLLQGYSGIRFEILEAITK
Sbjct  121   GGALQRELIRFLNAGIFGNGTETCHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  779   LLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIE  958
              +NHNITPCLPLRGTITASGDL PLSYI GL+ GR NSK+VGPNGE+LD  EAF  AGI+
Sbjct  181   FINHNITPCLPLRGTITASGDLVPLSYIAGLLIGRPNSKSVGPNGESLDPSEAFELAGID  240

Query  959   SGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             SGFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   SGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  274



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/278 (77%), Positives = 235/278 (85%), Gaps = 12/278 (4%)
 Frame = +2

Query  236   NGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             NGH   ++GFCV+Q       +DPLNW AAAE+LKGSHLDEVKRMVEE+RK  VKLGGET
Sbjct  5     NGHHEESNGFCVKQ-------NDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGET  57

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTI+QVAA+AA+     V VEL+E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  58    LTISQVAAIAAKDNA--VAVELAESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHR  115

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  116   RTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILE  175

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF+ 
Sbjct  176   AITKFLNENITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKL  235

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AG++ GFFELQPKE LA+ NGTA GS LA + L++ANI
Sbjct  236   AGVKGGFFELQPKEGLALVNGTAVGSGLASIALFDANI  273



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/278 (77%), Positives = 234/278 (84%), Gaps = 12/278 (4%)
 Frame = +2

Query  236   NGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             NGH   ++GFCV+Q       +DPLNW AAAE+LKGSHLDEVKRMVEE+RK  VKLGGET
Sbjct  5     NGHHEESNGFCVKQ-------NDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGET  57

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTI+QVAA+AA+     V VEL E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  58    LTISQVAAIAAKDNA--VAVELVESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHR  115

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  116   RTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILE  175

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF+ 
Sbjct  176   AITKFLNENITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKL  235

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AG++ GFFELQPKE LA+ NGTA GS LA + L++ANI
Sbjct  236   AGVKGGFFELQPKEGLALVNGTAVGSGLASIALFDANI  273



>ref|XP_011653013.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   405 bits (1040),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 208/275 (76%), Positives = 230/275 (84%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG    FC       SS  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGG+TLTI
Sbjct  10    NGSMESFC-------SSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63    SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGNG+ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGGALQKELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  181   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  275



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVNVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>ref|XP_011657651.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis sativus]
 gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/256 (82%), Positives = 226/256 (88%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V VEL
Sbjct  17    DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDS--DVIVEL  74

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  75    SESARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  134

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +GAES HTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITA
Sbjct  135   SGAESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITA  194

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNGE+ DA+EAF++AGI SGFFELQPKE LA+ NGT
Sbjct  195   SGDLVPLSYIAGLLTGRPNSKAVGPNGESFDAKEAFQQAGIPSGFFELQPKEGLALVNGT  254

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  255   AVGSGLASIVLFEANI  270



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVSVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 234/275 (85%), Gaps = 2/275 (1%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG  +  C + +  +  SHDPL+W  AAE++KGSHLDEVKRMV E+RK  VKLGGETLT+
Sbjct  11    NGSLNSLCTDSE--SIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGETLTV  68

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVAA+AA  G+  ++VEL+E+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTK
Sbjct  69    AQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  128

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+ H L HS T+A M+VRINTLLQGYSGIRFEILEAIT
Sbjct  129   QGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMIVRINTLLQGYSGIRFEILEAIT  188

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN NITPCLPLRGTITASGDL PLSYI GL+TGR+NSKA GPNGE+LDA++AF  AGI
Sbjct  189   KLLNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKATGPNGESLDAQQAFSEAGI  248

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SG FELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  249   DSGLFELQPKEGLALVNGTAVGSGLASMVLFDANI  283



>ref|XP_004143356.2| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 212/277 (77%), Positives = 230/277 (83%), Gaps = 12/277 (4%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSH--DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             NG    FC        +SH  DPLNW  AAEALKGSHLDEVKRMV+EYR+  VKLGGETL
Sbjct  13    NGSMESFC--------TSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETL  64

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TI+QVAA+A +    +V V+L+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  65    TISQVAAIATRDN--DVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  122

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNGAES HTL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  123   TKQGGALQKELIRFLNAGIFGNGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  182

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             IT LLN N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDAE AF++A
Sbjct  183   ITNLLNENVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQA  242

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GI S FFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  243   GIPSSFFELQPKEGLALVNGTAVGSGLASIVLFEANI  279



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVSVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 213/278 (77%), Positives = 231/278 (83%), Gaps = 13/278 (5%)
 Frame = +2

Query  233   SNGHAH--GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             SNGH+   GFCVE         DPLNW  AAE LKGSHLDEVK+MVEE+RK  V+LGG+T
Sbjct  4     SNGHSKNGGFCVE---------DPLNWGKAAEGLKGSHLDEVKKMVEEFRKPVVQLGGKT  54

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVAA+A       VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  55    LTIAQVAAIATHDSG--VKVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  112

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTK+G ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  113   RTKEGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRASMLVRINTLLQGYSGIRFEILE  172

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AIT+ LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G++L A EAF  
Sbjct  173   AITEFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGQSLTAAEAFEL  232

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AG+ SGFFELQPKE LA+ NGTA GS +A +VL+EANI
Sbjct  233   AGLSSGFFELQPKEGLALVNGTAVGSGMASVVLFEANI  270



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/278 (76%), Positives = 234/278 (84%), Gaps = 7/278 (3%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I  NGH +G          ++ DPLNW  AAE++ GSHLDEVK+MV E+RK  VKLGGET
Sbjct  4     ISQNGHQNG----SLDSLCTARDPLNWGLAAESMSGSHLDEVKKMVAEFRKPLVKLGGET  59

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LT+AQVAA+A + G   ++VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  60    LTVAQVAAIARESG---LQVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHR  116

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQ+ELIRFLNAGIFGN  ESCHTL+HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  117   RTKQGGALQRELIRFLNAGIFGNKTESCHTLSHSATRAAMLVRINTLLQGYSGIRFEILE  176

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE+LDA++AF  
Sbjct  177   AITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAQQAFHS  236

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGI+SGFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  237   AGIDSGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  274



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 212/280 (76%), Positives = 230/280 (82%), Gaps = 10/280 (4%)
 Frame = +2

Query  221   NGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             NG I+NG    FC++         DPLNW  AA++LKGSHLDEVKRMV E+RK  VKLGG
Sbjct  9     NGHINNGEVLDFCLK---------DPLNWGMAADSLKGSHLDEVKRMVAEFRKPVVKLGG  59

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLTI+QVAA+AA+     VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  60    ETLTISQVAAIAARDYN-AVKVELSEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATS  118

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTKQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEI
Sbjct  119   HRRTKQGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEI  178

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE ++ E+AF
Sbjct  179   LEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEIVNPEQAF  238

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             + AG+  G FELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  239   KMAGVNDGLFELQPKEGLALVNGTAVGSGMASMVLFEANI  278



>ref|XP_004152155.2| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   402 bits (1034),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 229/275 (83%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C       SS  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGG+TLTI
Sbjct  10    NGSMESLC-------SSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63    SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGNG+ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGGALQKELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  181   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  275



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/284 (74%), Positives = 232/284 (82%), Gaps = 11/284 (4%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MENGN +  NG  +  C++         DPLNW  AAEAL GSHLDEVK+MV E+RK  V
Sbjct  1     MENGNHV--NGVVNELCIK---------DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVV  49

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             KLGGETLT++QVA +AA   +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  50    KLGGETLTVSQVAGIAAANDSDTVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGF  109

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQKELIRFLNAGIFGNG E+ HTL HS TRA M+VRINTLLQGYSGI
Sbjct  110   GATSHRRTKQGGALQKELIRFLNAGIFGNGTETSHTLPHSATRAAMIVRINTLLQGYSGI  169

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L+A
Sbjct  170   RFEILEAITKFLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEVLNA  229

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             E+AF  AG+E GFFELQPKE LA+ NGTA GS +A MVL++AN+
Sbjct  230   EKAFAAAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFDANV  273



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVSVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGI+SGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIQSGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 215/282 (76%), Positives = 231/282 (82%), Gaps = 17/282 (6%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGNG      + GFC+          DPLNW A+AE+LKGSHLDEVKRMVEE+RK  V+L
Sbjct  11    NGNG------SPGFCIT---------DPLNWGASAESLKGSHLDEVKRMVEEFRKPVVRL  55

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTIAQVAA+A +     VKVELSEAAR  VKASSDWVM GM  GTDSYGVTTGFGA
Sbjct  56    GGETLTIAQVAAIANRDAG--VKVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGA  113

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQGAALQKELIRFLNAG+FG G ESCHTL H+ TRA MLVRINTLLQGYSGIRF
Sbjct  114   TSHRRTKQGAALQKELIRFLNAGVFGQGTESCHTLPHTATRAAMLVRINTLLQGYSGIRF  173

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GEAL+  E
Sbjct  174   EILEAITKLLNVNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEALNPTE  233

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF RAGI  GFFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  234   AFSRAGINGGFFELQPKEGLALVNGTAVGSGLASLVLFEANV  275



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   406 bits (1043),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 213/277 (77%), Positives = 233/277 (84%), Gaps = 11/277 (4%)
 Frame = +2

Query  236   NGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             NGH  ++GFCV+Q       +DPLNW AAAE+LKGSHLDEVKRMVEE+RK  VKLGGETL
Sbjct  4     NGHHDSNGFCVKQ-------NDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETL  56

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  57    TISQVAAIAAKDNA--VAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  114

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNG E+ HTL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  115   TKQGGALQKELIRFLNAGIFGNGTETNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  174

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L AE+AF+ A
Sbjct  175   ITKFLNQNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLTAEQAFKLA  234

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             G+  GFFELQPKE LA+ NGTA GS LA + L+EANI
Sbjct  235   GVNGGFFELQPKEGLALVNGTAVGSGLASIALFEANI  271



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 208/256 (81%), Positives = 227/256 (89%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AA++LKGSHLDEVKRMVEEYR+  VKLGGETLTI+QVAA+A +    +V VEL
Sbjct  20    DPLNWGLAADSLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDT--DVIVEL  77

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  78    SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  137

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +GAES H L HS TRA MLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITA
Sbjct  138   SGAESNHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITA  197

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA+GPNGE+LDA+EAF++AGI SGFFELQPKE LA+ NGT
Sbjct  198   SGDLVPLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGFFELQPKEGLALVNGT  257

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  258   AVGSGLASIVLFEANI  273



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   406 bits (1043),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   406 bits (1043),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 225/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGVAAEELKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A +    +V VELSEAAR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK+G ALQ
Sbjct  66    AGREE--DVTVELSEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG +SCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGTDSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITP LPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPSLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFEANV  272



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 211/281 (75%), Positives = 236/281 (84%), Gaps = 9/281 (3%)
 Frame = +2

Query  230   ISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  397
             +SNG+        C++     ++S DPLNW  AAE++KGSHLDEVKRMVEEYR   V++G
Sbjct  6     VSNGYHQSQNGSLCLKSN---NTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIG  62

Query  398   GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             GETLTI+QVAA+A +    +V +ELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGAT
Sbjct  63    GETLTISQVAAIATRDQ--DVSLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  120

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTKQG ALQKELIRFLNAGIFGNGA SCHTL HS TRA MLVRINTLLQGYSGIRFE
Sbjct  121   SHRRTKQGGALQKELIRFLNAGIFGNGAVSCHTLPHSATRAAMLVRINTLLQGYSGIRFE  180

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EA
Sbjct  181   ILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEA  240

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             F+ AGI S FFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   FQLAGINSEFFELQPKEGLALVNGTAVGSGLASIVLFEANI  281



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   394 bits (1013),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 210/278 (76%), Positives = 231/278 (83%), Gaps = 8/278 (3%)
 Frame = +2

Query  230   ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4     ITNGHVEATFCLSK-----NGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  59    LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHR  116

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  117   RTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILE  176

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF+ 
Sbjct  177   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQL  236

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGI S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  237   AGIGSDFFELQPKEGLALVNGTAVGSGLASIVLFEANV  274



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 206/256 (80%), Positives = 222/256 (87%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEALKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+A +    +V VEL
Sbjct  19    DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREE--DVSVEL  76

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  77    SETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  136

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT+TA
Sbjct  137   NGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTA  196

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+ GR NSKAVGP+G+ ++AEEAF+ AGIESGFFELQPKE LA+ NGT
Sbjct  197   SGDLVPLSYIAGLLIGRPNSKAVGPSGDVVNAEEAFKMAGIESGFFELQPKEGLALVNGT  256

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA MVL+E N+
Sbjct  257   AVGSGLASMVLFETNV  272



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 234/279 (84%), Gaps = 1/279 (0%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+ NGH +G  ++  +++ + +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5     IVQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGET  64

Query  407   LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             LTIAQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFG TSH
Sbjct  65    LTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSH  124

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRT  G+ALQK+LIRFLNAG+ GNG ES HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  125   RRTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  184

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAFR
Sbjct  185   EAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFR  244

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+ SGFFELQPKE LA+ NGTA GS +A MVL+E+NI
Sbjct  245   VAGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNI  283



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   405 bits (1042),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 226/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   405 bits (1042),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 213/283 (75%), Positives = 230/283 (81%), Gaps = 13/283 (5%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             EN NG   NG    FC++Q        DPLNW  AAE+LKGSHLDEVKRMV+E+RK  V+
Sbjct  6     ENCNG---NGSLKSFCIQQ--------DPLNWEKAAESLKGSHLDEVKRMVQEFRKPVVR  54

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGG+TLTI+QVAA+A       VKV LSE+ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  55    LGGQTLTISQVAAIATHDAG--VKVVLSESARAGVKASSDWVMESMNKGTDSYGVTTGFG  112

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIR
Sbjct  113   ATSHRRTKQGGALQKELIRFLNAGIFGNGVESCHTLPHSATRAAMLVRINTLLQGYSGIR  172

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEAITKLLN NITPCLPLRGTITASGDL PLSYI GL+TGR NS AVGP+G+ L+A 
Sbjct  173   FEILEAITKLLNSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSVAVGPDGQNLNAA  232

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAF  AGI  GFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  233   EAFSLAGINGGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  275



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   405 bits (1041),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 209/277 (75%), Positives = 240/277 (87%), Gaps = 6/277 (2%)
 Frame = +2

Query  236   NGHAHG--FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +G+ +G  FC+    R++S++DPLNW AAAE+LKGSHL+EVKRMVEEYR+  VKLGGETL
Sbjct  4     SGYQNGVEFCI--GARSNSNNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETL  61

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TI+QVAA+A++     V VELSE+AR GV+ASS WVM  M  GTDSYGVTTGFGATSHRR
Sbjct  62    TISQVAAIASRDSG--VVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRR  119

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TK+G ALQ+ELIRFLNAG+FG G ES HTL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  120   TKEGGALQRELIRFLNAGVFGRGTESSHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEA  179

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR+NSKA+GPNGE+LDA+EAF++A
Sbjct  180   ITKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQA  239

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GI SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  240   GIPSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  276



>gb|AAN32866.1|AF460203_1 phenylalanine ammonia-lyase 1 [Coffea canephora]
 gb|AAZ04477.1| phenylalanine ammonia-lyase [Coffea canephora]
 gb|AEO92027.1| phenylalanine ammonia-lyase 1 [Coffea canephora]
Length=717

 Score =   405 bits (1041),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 217/282 (77%), Positives = 237/282 (84%), Gaps = 7/282 (2%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGNG   N  A  FC +   RA  + DPLNWNAAAE+LKGSHLDEVKRMV+E+R+  V+L
Sbjct  5     NGNG---NDLAETFCTQ---RAGPAPDPLNWNAAAESLKGSHLDEVKRMVDEFRRPLVRL  58

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTIAQVAAVAA      VKVELSE ARAGVKASSDWVM  M  GTDSYG+TTGFGA
Sbjct  59    GGETLTIAQVAAVAASSDA-AVKVELSEGARAGVKASSDWVMESMRKGTDSYGITTGFGA  117

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQ+ELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  118   TSHRRTKQGGALQEELIRFLNAGIFGNGTETCHTLPHSATRASMLVRINTLLQGYSGIRF  177

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G+ ++A E
Sbjct  178   EILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIVGLLTGRPNSKAVGPDGKFVNATE  237

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF  AGI++GFFELQ KE LA+ NGTA GS LA MVL+EANI
Sbjct  238   AFSLAGIDTGFFELQAKEGLALVNGTAVGSALASMVLFEANI  279



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   405 bits (1042),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 206/278 (74%), Positives = 233/278 (84%), Gaps = 3/278 (1%)
 Frame = +2

Query  236   NGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             NGH +G  V  E  +++ + HDPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGGETL
Sbjct  4     NGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETL  63

Query  410   TIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             T+AQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  64    TVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHR  123

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  124   RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  183

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKL+N NITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGPNGE LDA+EAFR 
Sbjct  184   AITKLINSNITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLDADEAFRV  243

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AG+  GFFELQPKE LA+ NGTA GS +A +VLY++NI
Sbjct  244   AGVSGGFFELQPKEGLALVNGTAVGSGMASIVLYDSNI  281



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   405 bits (1041),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 209/281 (74%), Positives = 233/281 (83%), Gaps = 3/281 (1%)
 Frame = +2

Query  227   IISNGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             I  NGH +G  V  E  +++ +  DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGG
Sbjct  4     IAQNGHVNGEVVAMELCKKSINVDDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGG  63

Query  401   ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             ETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  64    ETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGAT  123

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFE
Sbjct  124   SHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFE  183

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEA
Sbjct  184   ILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEA  243

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FR AG+  GFFELQPKE LA+ NGTA GS +A MVL+++NI
Sbjct  244   FRVAGVTGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNI  284



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 210/275 (76%), Positives = 231/275 (84%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C+        S+DPLNW  AAE+LKGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10    NGSVESLCI-------GSNDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VELSE++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK
Sbjct  63    SQVAAIATRDT--DVIVELSESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFG+GAES HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGGALQKELIRFLNAGIFGSGAESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE + A+EAF++A I
Sbjct  181   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGERITAKEAFQQADI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   PSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  275



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   404 bits (1039),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 214/277 (77%), Positives = 231/277 (83%), Gaps = 7/277 (3%)
 Frame = +2

Query  233   SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +NGH +G FC+     ++   DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4     TNGHQNGSFCLS----STKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETL  59

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  60    TIAQVAAVAGHDHG--VTVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  117

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  118   TKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  177

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+A+EAF  A
Sbjct  178   ITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELA  237

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              I S FFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  238   SINSEFFELQPKEGLALVNGTAVGSGLASMVLFEANI  274



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   404 bits (1039),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/260 (79%), Positives = 224/260 (86%), Gaps = 1/260 (0%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaq-ggTPEV  460
             S HDPLNW  AAE+LKGSHLDEVK+MV+E+RK  VKLGGETLT+AQVA++A     T  V
Sbjct  20    SIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADNKTCGV  79

Query  461   KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNA  640
             KVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIRFLNA
Sbjct  80    KVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNA  139

Query  641   GIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  820
             G+FGNG  SCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKL+N NITPCLPLRG
Sbjct  140   GVFGNGTGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRG  199

Query  821   TITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAM  1000
             TITASGDL PLSYI GL+TGR N+KAVGPNGE L+AEEAFR AG+  GFFELQPKE LA+
Sbjct  200   TITASGDLVPLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQPKEGLAL  259

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS +A MVL+E+NI
Sbjct  260   VNGTAVGSGMASMVLFESNI  279



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 206/260 (79%), Positives = 224/260 (86%), Gaps = 1/260 (0%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaq-ggTPEV  460
             S HDPLNW  AAE+LKGSHLDEVK+MV+E+RK  VKLGGETLT+AQVA++A     T  V
Sbjct  20    SIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADNKTCGV  79

Query  461   KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNA  640
             KVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIRFLNA
Sbjct  80    KVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNA  139

Query  641   GIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  820
             G+FGNG  SCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKL+N NITPCLPLRG
Sbjct  140   GVFGNGTGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRG  199

Query  821   TITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAM  1000
             TITASGDL PLSYI GL+TGR N+KAVGPNGE L+AEEAFR AG+  GFFELQPKE LA+
Sbjct  200   TITASGDLVPLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQPKEGLAL  259

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS +A MVL+E+NI
Sbjct  260   VNGTAVGSGMASMVLFESNI  279



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 215/277 (78%), Positives = 231/277 (83%), Gaps = 6/277 (2%)
 Frame = +2

Query  233   SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +NGH +G FC+     A  S DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4     TNGHQNGSFCLST---AKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETL  60

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  61    TIAQVAAVAGHDHG--VAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  118

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  119   TKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  178

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF  A
Sbjct  179   ITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELA  238

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              I S FFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  239   SINSEFFELQPKEGLALVNGTAVGSGLASMVLFEANI  275



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 233/275 (85%), Gaps = 2/275 (1%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG  +  C + +  +  SHDPL+W  AAE++KGSHLDEVKRMV E+RK  VKLGGETLT+
Sbjct  11    NGSLNSLCTDSE--SIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGETLTV  68

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVAA+AA  G+  ++VEL+E+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTK
Sbjct  69    AQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  128

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+ H L HS T+A M+VRINTLLQGYSGIRFEILEAIT
Sbjct  129   QGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMIVRINTLLQGYSGIRFEILEAIT  188

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN NITPCLPLRGTITASGDL PLSYI GL+TGR+NSKA GPNGE+LDA++AF  AGI
Sbjct  189   KLLNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKATGPNGESLDAQQAFSEAGI  248

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SG FELQPKE LA+ NGTA GS  A MVL++ANI
Sbjct  249   DSGLFELQPKEGLALVNGTAVGSGSASMVLFDANI  283



>dbj|BAL49995.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
 dbj|BAL63070.1| phenylalanine ammonia-lyase [Eucalyptus robusta]
Length=715

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 217/281 (77%), Positives = 232/281 (83%), Gaps = 13/281 (5%)
 Frame = +2

Query  218   GNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  397
             GNG+      HG C    R A    DPLNW AAA AL GSHLDEVKRMVEEYR+  V+LG
Sbjct  10    GNGL------HGLCATGSRHA----DPLNWGAAAAALTGSHLDEVKRMVEEYRRPAVRLG  59

Query  398   GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             GE+LTIAQVAAVA+Q G   V VELSEAAR  VKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  60    GESLTIAQVAAVASQEG---VGVELSEAARPRVKASSDWVMESMNKGTDSYGVTTGFGAT  116

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL  S TRA MLVR+NTLLQGYSGIRFE
Sbjct  117   SHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPQSSTRAAMLVRVNTLLQGYSGIRFE  176

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G++LDA EA
Sbjct  177   ILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLDAVEA  236

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FR AGI++GFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  237   FRLAGIDTGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  277



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   404 bits (1037),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 218/284 (77%), Positives = 234/284 (82%), Gaps = 14/284 (5%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MENG+      H++G CVE  R      DPLNW AAAE+LKGSHLDEVKRMVEE+RK  V
Sbjct  1     MENGHH-----HSNGLCVETTR------DPLNWVAAAESLKGSHLDEVKRMVEEFRKPAV  49

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             KLGGE+LTIAQVAA+AA+     V VEL+E ARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  50    KLGGESLTIAQVAAIAARDNA--VAVELAETARAGVKASSDWVMESMNKGTDSYGVTTGF  107

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQKELIRFLNAGIFGNG ES H L HS TRA MLVRINTLLQGYSGI
Sbjct  108   GATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHALPHSATRAAMLVRINTLLQGYSGI  167

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEA+TK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGEAL+A
Sbjct  168   RFEILEALTKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNA  227

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              EAF  AG+ SGFFELQPKE LA+ NGTA GS LA + LY+ANI
Sbjct  228   GEAFSLAGV-SGFFELQPKEGLALVNGTAVGSGLASIALYDANI  270



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   403 bits (1036),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 225/269 (84%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVQLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGVKASSDWVM  M+ G DSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVSVELSETARAGVKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIR LNAGIFGNG ESCHTL HS TRA MLVRIN+LLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRVLNAGIFGNGRESCHTLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE  A+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGFALVNGTAVGSGLASMVLFETNV  272



>ref|XP_011654322.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=453

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 204/273 (75%), Positives = 226/273 (83%), Gaps = 9/273 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C       ++  DPLNW  AAE++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10    NGSVETLC-------NTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63    SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGNG+ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGGALQKELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  181   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFTQAGI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEA  1054
             +SGFFELQPKE LA+ NGTA GS LA +VL+E 
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASIVLFEV  273



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   404 bits (1037),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 207/281 (74%), Positives = 233/281 (83%), Gaps = 3/281 (1%)
 Frame = +2

Query  227   IISNGHAHGFCVEQK--RRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             I+ NGHA+G  V     +++   +DPLNW  AAE+L+GSHLDEVK+MV+E+RK  VKLGG
Sbjct  4     IVPNGHANGKVVAMDLCKKSIIVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGG  63

Query  401   ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             ETLTIAQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFG T
Sbjct  64    ETLTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDT  123

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRT  G+ALQK+LIRFLNAG+ GNG ES HTL HS TRA MLVRINTLLQGYSGIRFE
Sbjct  124   SHRRTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFE  183

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEA
Sbjct  184   ILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEA  243

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FR AG+ SGFFELQPKE LA+ NGTA GS +A MVL+E+NI
Sbjct  244   FRVAGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNI  284



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   404 bits (1037),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 204/273 (75%), Positives = 226/273 (83%), Gaps = 9/273 (3%)
 Frame = +2

Query  242   HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             H H  C++         D LNW  AAEAL GSHLDEVK+MV E+R   VK+GGETLT++Q
Sbjct  25    HVHDLCIK---------DTLNWGVAAEALTGSHLDEVKKMVAEFRNPVVKIGGETLTVSQ  75

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             VA +AA   +  VKVELSEAARAGVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTKQG
Sbjct  76    VAGIAAASDSSTVKVELSEAARAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQG  135

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
              ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAITK 
Sbjct  136   GALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  195

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LN+N+TPCLPLRGTITASGDL PLSYI GL+TGR+NSKAVGP GE L+AE+AF +AG+E 
Sbjct  196   LNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAVGPTGEILNAEQAFAKAGVEG  255

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  256   GFFELQPKEGLALVNGTAVGSGMASMVLFEANV  288



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   403 bits (1035),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 204/256 (80%), Positives = 223/256 (87%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNWN AAE++KGSHLDEVKRMVEEYRK  V+LGGE+LTI+QVAA+A+      V VEL
Sbjct  17    DPLNWNMAAESMKGSHLDEVKRMVEEYRKGVVRLGGESLTISQVAAIASHDQG--VMVEL  74

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             +E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAG+FG
Sbjct  75    NESSRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGVFG  134

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG E+ HTL HS TRA MLVRINTLLQGYSGIRFEILEAITK LNHNITPCLPLRGTITA
Sbjct  135   NGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITA  194

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGP GE L+A+EAF  AGI++GFFELQPKE LA+ NGT
Sbjct  195   SGDLVPLSYIAGLLTGRPNSKAVGPKGEPLNAQEAFTLAGIDTGFFELQPKEGLALVNGT  254

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA MVL+EANI
Sbjct  255   AVGSGLASMVLFEANI  270



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   402 bits (1033),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 227/272 (83%), Gaps = 5/272 (2%)
 Frame = +2

Query  254   FCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  424
             FC      AS   SS DPLNW  AAE+LKGSHLDEVKRMV+EYRK  V+LGGETLTIAQV
Sbjct  3     FCEAHNVTASPGFSSADPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQV  62

Query  425   aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  604
              A+A       VKVELSE ARAGVKASSDWV+  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  63    TAIANHDSG--VKVELSEEARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGG  120

Query  605   ALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLL  784
             ALQ+ELIRFLNAGIFGNG ESCHTL+H+ TRA MLVRINTLLQGYSGIRFEILEAITK +
Sbjct  121   ALQRELIRFLNAGIFGNGQESCHTLSHTATRAAMLVRINTLLQGYSGIRFEILEAITKFI  180

Query  785   NHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESG  964
             N+N+TP LPLRGTITASGDL PLSYI GL+TGR NSK++GPNGE+LDA EAF+ AGI  G
Sbjct  181   NNNVTPRLPLRGTITASGDLVPLSYIAGLLTGRPNSKSLGPNGESLDAAEAFKLAGINGG  240

Query  965   FFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   FFELQPKEGLALVNGTAVGSGLASMVLFEANV  272



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   403 bits (1035),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 206/279 (74%), Positives = 228/279 (82%), Gaps = 8/279 (3%)
 Frame = +2

Query  224   GIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  403
             G+I+      FC++         DPLNW  AAE+L+GSHLDEVK+MV E+RK  VKLGGE
Sbjct  3     GVINGQQDLDFCIKV--------DPLNWEMAAESLRGSHLDEVKKMVAEFRKPVVKLGGE  54

Query  404   TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             TLT+AQVA+VAA+     VKVEL E ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  55    TLTVAQVASVAAKVNVENVKVELCEDARAGVKASSDWVMESMSKGTDSYGVTTGFGATSH  114

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQKELIRFLNAG+FGNG ESCHTL  S TRA MLVRINTLLQGYSGIRFEIL
Sbjct  115   RRTKNGGALQKELIRFLNAGVFGNGTESCHTLPQSSTRAAMLVRINTLLQGYSGIRFEIL  174

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+NHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF 
Sbjct  175   EAITKLINHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFH  234

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+  GFFELQPKE LA+ NGTA GS LA +VL++AN+
Sbjct  235   VAGVNGGFFELQPKEGLALVNGTAVGSGLASIVLFDANV  273



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   403 bits (1035),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 214/279 (77%), Positives = 232/279 (83%), Gaps = 4/279 (1%)
 Frame = +2

Query  227   IISNGH-AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  403
             I  NGH  +G C+      +S  DPLNW   AE+LKGSHL+EVKRMVEEYRK  VKLGGE
Sbjct  5     ITQNGHHMNGLCMNGSAHVNS--DPLNWGYLAESLKGSHLEEVKRMVEEYRKPLVKLGGE  62

Query  404   TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             TLTIAQVAAVA       VKVEL+E+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSH
Sbjct  63    TLTIAQVAAVAGGFEA-GVKVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSH  121

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTKQGAALQKELIRFLNAGIFGNG E+ HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  122   RRTKQGAALQKELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  181

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EA+TK LN+NITPCLPLRGTITASGDL PLSYI GL+TGR+N+KAVGPNG+ L+AEEAF 
Sbjct  182   EALTKFLNYNITPCLPLRGTITASGDLVPLSYIAGLLTGRSNAKAVGPNGQTLNAEEAFS  241

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+   FFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  242   LAGVGYQFFELQPKEGLALVNGTAVGSGLASMVLFEANI  280



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   403 bits (1035),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 226/275 (82%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG +   C ++        DPL+W  AAEA+KGSHLDEVKRMV EYRK  V L G+TLTI
Sbjct  11    NGSSESLCTQR--------DPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    +  VKVELSE+AR  VKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  63    AQVASIAGHDAS-NVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  121

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  122   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  181

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE LDA EAF+ AGI
Sbjct  182   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGI  241

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  242   DSGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  276



>gb|AJO53272.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   402 bits (1034),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 230/284 (81%), Gaps = 11/284 (4%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MENGN    NG   G CV+ +       DPLNWNAAAEAL+GSHLDEVKRMVEE+RK  V
Sbjct  1     MENGN----NGD--GLCVQSRNDVV---DPLNWNAAAEALRGSHLDEVKRMVEEFRKPVV  51

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             +LGGETLTI QVAAVA +     V VEL+E AR GVKASSDWVM  M NGTDSYGVTTGF
Sbjct  52    RLGGETLTIGQVAAVATREAA--VTVELTETAREGVKASSDWVMESMNNGTDSYGVTTGF  109

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQKELIRFLNAGIFGN  ES H L HS TRA MLVRINTLLQGYSGI
Sbjct  110   GATSHRRTKQGGALQKELIRFLNAGIFGNNTESSHMLPHSTTRASMLVRINTLLQGYSGI  169

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFE+LEAITK LNHNITPC+PLRG+ITASGDL PLSYI G++ GR NSKAVGPNGE +  
Sbjct  170   RFEVLEAITKFLNHNITPCIPLRGSITASGDLVPLSYIAGVLLGRANSKAVGPNGEVIGP  229

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             ++AF RAGI SGFFELQPKE LA+ NGTA GS LA +VL++ANI
Sbjct  230   DQAFARAGINSGFFELQPKEGLALVNGTAVGSGLASIVLFDANI  273



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   402 bits (1034),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 214/278 (77%), Positives = 232/278 (83%), Gaps = 6/278 (2%)
 Frame = +2

Query  230   ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+NG  +G FC+   + +S   DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGET
Sbjct  6     ITNGSQNGSFCLSTTKGSS---DPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGET  62

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHR
Sbjct  63    LTIAQVAAVAGHDLG--VAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHR  120

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  121   RTKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILE  180

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF  
Sbjct  181   AITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFEL  240

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             A I S FFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  241   ASINSEFFELQPKEGLALVNGTAVGSGLASMVLFEANI  278



>emb|CDY66761.1| BnaCnng52250D [Brassica napus]
Length=519

 Score =   396 bits (1017),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 204/267 (76%), Positives = 226/267 (85%), Gaps = 2/267 (1%)
 Frame = +2

Query  260   VEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaa  439
             V +K + + + DPLNW AAAE +KGSHLDEVKRMVE+YRK  V LGGETLTI QVAA++ 
Sbjct  22    VVEKTKVTVAADPLNWGAAAEQMKGSHLDEVKRMVEDYRKPVVNLGGETLTIGQVAAISN  81

Query  440   qggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKE  619
              GG   VKVEL+EA+RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK GAALQ E
Sbjct  82    VGGG--VKVELAEASRAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGAALQTE  139

Query  620   LIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  799
             LIRFLNAGIFGN  E+CHTL  S TRA MLVR+NTLLQGYSGIRFEILEAIT LLNHNI+
Sbjct  140   LIRFLNAGIFGNTKETCHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNIS  199

Query  800   PCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQ  979
             P LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE+L AEEAF++AGI SGFF+LQ
Sbjct  200   PSLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGESLTAEEAFKKAGITSGFFDLQ  259

Query  980   PKERLAMANGTADGSRLACMVLYEANI  1060
             PKE LA+ NGTA GS +A MVL+EAN+
Sbjct  260   PKEGLALVNGTAVGSGMASMVLFEANV  286



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1 [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/276 (75%), Positives = 236/276 (86%), Gaps = 6/276 (2%)
 Frame = +2

Query  239   GHAHG--FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             GH +G  FC+    R + ++DPLNW AAAE+LKGSHL+EVKRMVEEYR+  VKLGGETLT
Sbjct  5     GHQNGVEFCI--GGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             I+QVAA+A++     V VELSE+AR GV+ASS WVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  63    ISQVAAIASRDSG--VVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRT  120

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             K+G ALQ+ELIRFLNAG+FGNG ES HTL H  TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  121   KEGGALQRELIRFLNAGVFGNGTESSHTLPHLATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR+NSKA+GPNGE+LDA+EAF++A 
Sbjct  181   TKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQAS  240

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   IPSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  276



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 226/275 (82%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG +   C ++        DPL+W  AAEA+KGSHLDEVKRMV EYRK  V L G+TLTI
Sbjct  11    NGSSESLCTQR--------DPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    +  VKVELSE+AR  VKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  63    AQVASIAGHDAS-NVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  121

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  122   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  181

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE LDA EAF+ AGI
Sbjct  182   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGI  241

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  242   DSGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  276



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   402 bits (1032),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/257 (81%), Positives = 222/257 (86%), Gaps = 2/257 (1%)
 Frame = +2

Query  290   HDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVE  469
             +DPLNW  AAE+LKG HLDEVKRMVEE+RK  VKLGGETLTI+QVAA+AA+     V VE
Sbjct  19    NDPLNWVMAAESLKGIHLDEVKRMVEEFRKPVVKLGGETLTISQVAAIAARDNA--VAVE  76

Query  470   LSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIF  649
             L+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIF
Sbjct  77    LAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIF  136

Query  650   GNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTIT  829
             GNG ES HTL HS TRA MLVRINTLLQGYSGIRFEI+EAITK LNHNITPCLPLRGTIT
Sbjct  137   GNGTESNHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNITPCLPLRGTIT  196

Query  830   ASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANG  1009
             ASGDL PLSYI GL+TGR NSKAVGPNGE+L AEEAF+ AG+  GFFELQPKE LA+ NG
Sbjct  197   ASGDLVPLSYIAGLLTGRPNSKAVGPNGESLSAEEAFKLAGVSGGFFELQPKEGLALVNG  256

Query  1010  TADGSRLACMVLYEANI  1060
             TA GS LA + LYEANI
Sbjct  257   TAVGSGLASIALYEANI  273



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 229/275 (83%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C       SS  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGG+TLTI
Sbjct  10    NGSMESLC-------SSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63    SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGNG+ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGGALQKELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  181   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  275



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   402 bits (1032),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/272 (76%), Positives = 226/272 (83%), Gaps = 9/272 (3%)
 Frame = +2

Query  245   AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  424
             ++GFCV+         DPLNW AAAEALKGSHLDEVKRMVEE+R   VK+GGE LTIAQV
Sbjct  11    SNGFCVQLS-------DPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTIAQV  63

Query  425   aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  604
             AA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  64    AAIASRDNA--VAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  121

Query  605   ALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLL  784
             ALQKELIRFLNAGIFG G E CHTL H+ TRA MLVRINTLLQGYSGIRFEILEA+TK L
Sbjct  122   ALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKFL  181

Query  785   NHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESG  964
             NHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L+AEEAF+ AG+  G
Sbjct  182   NHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSGG  241

Query  965   FFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FFELQPKE LA+ NGTA GS LA + LYEAN+
Sbjct  242   FFELQPKEGLALVNGTAVGSGLASIALYEANV  273



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 212/282 (75%), Positives = 233/282 (83%), Gaps = 4/282 (1%)
 Frame = +2

Query  221   NGIISNGHA-HGFCVEQKRRAS-SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NG + NG +  G C          S D LNW AAAEA+KGSHL+EVK+MVEEYRK  V L
Sbjct  9     NGHVKNGVSLEGICTSNGSNGGIVSGDALNWGAAAEAMKGSHLEEVKKMVEEYRKPAVNL  68

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTI+QVAA+A+Q     VKVELSEAAR GVKASSDWVM  M+ GTDSYGVTTGFGA
Sbjct  69    GGETLTISQVAAIASQDSG--VKVELSEAAREGVKASSDWVMESMDKGTDSYGVTTGFGA  126

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL H+ TRA +LVRINTLLQGYSGIRF
Sbjct  127   TSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHTTTRAALLVRINTLLQGYSGIRF  186

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEA+TKLLN N+TPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGPNGE+L A +
Sbjct  187   EILEAMTKLLNSNVTPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQ  246

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF+ AGI SGFFELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  247   AFKVAGINSGFFELQPKEGLALVNGTAVGSGLASMVLFDANI  288



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 227/272 (83%), Gaps = 5/272 (2%)
 Frame = +2

Query  245   AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  424
             A  FC+     A+   DPLNW  AAE+LKGSHLDEVKRMVEE+RK  V+LGGETLTI+QV
Sbjct  11    ADSFCLSGGVAAA---DPLNWGVAAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTISQV  67

Query  425   aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  604
             AA+AA      VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQGA
Sbjct  68    AAIAAHDQG--VKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGA  125

Query  605   ALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLL  784
             ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITK L
Sbjct  126   ALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  185

Query  785   NHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESG  964
             NHNITPCLPLRGTIT SGDL PLSYI GL+TGR NSKAVG +GE L  +EAF+ AGI+S 
Sbjct  186   NHNITPCLPLRGTITTSGDLVPLSYIAGLLTGRPNSKAVGTSGELLTPKEAFQLAGIDSD  245

Query  965   FFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FF LQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  246   FFGLQPKEGLALVNGTAVGSGLASMVLFEANI  277



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 209/278 (75%), Positives = 232/278 (83%), Gaps = 3/278 (1%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I +N +   FC+  K    ++ DPLNW  AAE++KGSHLDEVKRMVEEYR   V+LGGET
Sbjct  6     ITNNFNGGSFCL--KNSTINASDPLNWGVAAESMKGSHLDEVKRMVEEYRTPVVRLGGET  63

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTI+QVAA+A       V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  64    LTISQVAAIAGAYDD-GVRVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  122

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES HTL  + TRA MLVRINTLLQGYSGIRFEILE
Sbjct  123   RTKQGGALQKELIRFLNAGIFGNGTESSHTLPQTATRAAMLVRINTLLQGYSGIRFEILE  182

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF+ 
Sbjct  183   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFQL  242

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGI  GFFELQPKE LA+ NGTA GS LA +VL++ANI
Sbjct  243   AGINDGFFELQPKEGLALVNGTAVGSALASIVLFDANI  280



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/277 (75%), Positives = 232/277 (84%), Gaps = 1/277 (0%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             SNGH +G    +  + SS+ DPLNW  A+E+L+GSHLDEVK+MV E+RK  VKLGGETLT
Sbjct  3     SNGHVNGGEDFELCKKSSATDPLNWEMASESLRGSHLDEVKKMVSEFRKPMVKLGGETLT  62

Query  413   IaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             +AQVAA+A +  +   VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  63    VAQVAAIAVRDKSANGVKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRR  122

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TK G ALQKELIRFLNAG+FGNG E+ HTL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  123   TKNGGALQKELIRFLNAGVFGNGTETNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  182

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAFR A
Sbjct  183   ITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVA  242

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             G+  GFFELQPKE LA+ NGTA GS +A MVL+++NI
Sbjct  243   GVNGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNI  279



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/272 (76%), Positives = 226/272 (83%), Gaps = 9/272 (3%)
 Frame = +2

Query  245   AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  424
             ++GFCV+         DPLNW AAAEALKGSHLDEVKRMVEE+R   VK+GGE LTIAQV
Sbjct  11    SNGFCVQLS-------DPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTIAQV  63

Query  425   aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  604
             AA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  64    AAIASRDNA--VAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  121

Query  605   ALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLL  784
             ALQKELIRFLNAGIFG G E CHTL H+ TRA MLVRINTLLQGYSGIRFEILEA+TK L
Sbjct  122   ALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKFL  181

Query  785   NHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESG  964
             NHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L+AEEAF+ AG+  G
Sbjct  182   NHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSGG  241

Query  965   FFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FFELQPKE LA+ NGTA GS LA + LYEAN+
Sbjct  242   FFELQPKEGLALVNGTAVGSGLASIALYEANV  273



>ref|XP_010112228.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC32937.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=696

 Score =   401 bits (1030),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/286 (73%), Positives = 225/286 (79%), Gaps = 22/286 (8%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVE---QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKA  382
             EN N  I NG    FC+          +  DPLNW AAAE+LKGSHLDEVKRMV EYRKA
Sbjct  6     ENSN--IGNG---SFCISGSTTNNHGGNHADPLNWGAAAESLKGSHLDEVKRMVNEYRKA  60

Query  383   TVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTT  562
              V+LGGETLTI+              +VEL+E ARAGVKASSDWVM  M NGTDSYGVTT
Sbjct  61    VVRLGGETLTIS--------------QVELAEVARAGVKASSDWVMESMNNGTDSYGVTT  106

Query  563   GFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYS  742
             GFGATSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL  S TRA MLVRINTLLQGYS
Sbjct  107   GFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPRSATRAAMLVRINTLLQGYS  166

Query  743   GIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEAL  922
             GIRFEILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L
Sbjct  167   GIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGELL  226

Query  923   DAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
                EAF++A IE+ FFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  227   TPTEAFKQAQIETDFFELQPKEGLALVNGTAVGSGLASVVLFEANI  272



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 227/272 (83%), Gaps = 5/272 (2%)
 Frame = +2

Query  254   FCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqv  424
             FC      AS   SS DPLNW  AAE+LKGSHLDEVKRMV+EYRK  V+LGGETLTIAQV
Sbjct  3     FCEAHNVTASPGFSSADPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQV  62

Query  425   aavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGA  604
              A+A       VKVELSE ARAGVKASSDWV+  M  GTDSYGVTTGFGATSHRRTKQG 
Sbjct  63    TAIANHDSG--VKVELSEEARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGG  120

Query  605   ALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLL  784
             ALQ+ELIRFLNAGIFGNG ESCHTL+H+ TRA MLVRINTLLQGYSGIRFEILEAITK +
Sbjct  121   ALQRELIRFLNAGIFGNGQESCHTLSHTATRAAMLVRINTLLQGYSGIRFEILEAITKFI  180

Query  785   NHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESG  964
             N+N+TP LPLRGTITASGDL PLSYI GL+TGR NSK++GPNGE+LDA EAF+ AGI  G
Sbjct  181   NNNVTPRLPLRGTITASGDLVPLSYIAGLLTGRPNSKSLGPNGESLDAAEAFKLAGINGG  240

Query  965   FFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   FFELQPKEGLALVNGTAVGSGLASMVLFEANV  272



>gb|AFP49807.1| phenylalanine ammonialyase 4 [Coffea arabica]
Length=713

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 213/283 (75%), Positives = 233/283 (82%), Gaps = 12/283 (4%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENGN      H++ FCV+         DPLNWNAAAE+LKGSHLDEVK+MV EYRK  VK
Sbjct  6     ENGNV----HHSNRFCVQD--------DPLNWNAAAESLKGSHLDEVKKMVREYRKPLVK  53

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLT+AQVAAVAA        VEL E+A+AGVKASS+WV+  M NGTDSYGVTTGFG
Sbjct  54    LGGETLTVAQVAAVAAVHAGGGTVVELCESAKAGVKASSEWVVESMNNGTDSYGVTTGFG  113

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQ ELIRFLNAGIFGNGAES HTL HS TRA MLVRINTLLQGYSGIR
Sbjct  114   ATSHRRTKQGTALQTELIRFLNAGIFGNGAESGHTLPHSATRAAMLVRINTLLQGYSGIR  173

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEA+T+LLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NS+ VGPNG +LDA 
Sbjct  174   FEILEALTRLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSRCVGPNGRSLDAT  233

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAF+ AG+ SGFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  234   EAFQIAGMNSGFFELQPKEGLALVNGTAVGSGLASMVLFEANL  276



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 226/275 (82%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG +   C ++        DPL+W  AAEA+KGSHLDEVKRMV EYRK  V L G+ LTI
Sbjct  11    NGSSESLCTQR--------DPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    + +VKVELSE+AR  VKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  63    AQVASIAGHDAS-DVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  121

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  122   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  181

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE LDA EAF+ AGI
Sbjct  182   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGI  241

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  242   DSGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  276



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 215/288 (75%), Positives = 236/288 (82%), Gaps = 14/288 (5%)
 Frame = +2

Query  209   MENGNGIISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYR  376
             MENGNG I+NGH +G    FC++       + DPL W  AAEA+ GSHLDEVK+MV EYR
Sbjct  1     MENGNGAITNGHVNGNGMDFCMK-------TEDPLYWGIAAEAMTGSHLDEVKKMVAEYR  53

Query  377   KATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGV  556
             K  VKLGGETLTI+QVAA++A+ G+  V VELSEAARAGVKASSDWVM  M  GTDSYGV
Sbjct  54    KPVVKLGGETLTISQVAAISARDGS-GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGV  112

Query  557   TTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQG  736
             TTGFGATSHRRTKQG ALQKELIRFLNAGIFGNG++  +TL HS TRA MLVRINTLLQG
Sbjct  113   TTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGSD--NTLPHSATRAAMLVRINTLLQG  170

Query  737   YSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGE  916
             YSGIRFEILEAITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G 
Sbjct  171   YSGIRFEILEAITKFLNQNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGV  230

Query  917   ALDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              L  EEAF+ AG+E GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  231   ILSPEEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  278



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 213/283 (75%), Positives = 232/283 (82%), Gaps = 11/283 (4%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENG+    NG  +GFCV+      +  DPLNW AAAEALKGSHL+EVKRMVEE+RK  VK
Sbjct  6     ENGH---RNGAVNGFCVK------AQGDPLNWGAAAEALKGSHLEEVKRMVEEFRKPVVK  56

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGE+LTI+QVAA+AA+     V VEL+E ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  57    LGGESLTISQVAAIAARDNA--VAVELAEPARAGVKASSDWVMESMNKGTDSYGVTTGFG  114

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQKELIR LNAGIFG+G ESCHTL HS TRA MLVRINTLLQGYSGIR
Sbjct  115   ATSHRRTKQGGALQKELIRSLNAGIFGSGTESCHTLPHSATRAAMLVRINTLLQGYSGIR  174

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEAITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G  L+AE
Sbjct  175   FEILEAITKFLNKNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGATLNAE  234

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAF+  G+  GFFELQPKE LA+ NGTA GS LA + LYEANI
Sbjct  235   EAFKLVGVNGGFFELQPKEGLALVNGTAVGSGLASIALYEANI  277



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   401 bits (1030),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 211/283 (75%), Positives = 231/283 (82%), Gaps = 16/283 (6%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             EN N + S      FC+++        DPLNW  AA+ALKGSHLDEVK+MV+EYR+  V+
Sbjct  7     ENTNSVAS------FCIKE--------DPLNWGMAADALKGSHLDEVKKMVKEYRQGVVR  52

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLTI+QVAAVA+      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  53    LGGETLTISQVAAVASHDQG--VKVELNESARAGVKASSDWVMESMNKGTDSYGVTTGFG  110

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIR
Sbjct  111   ATSHRRTKQGGALQKELIRFLNAGVFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIR  170

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEA+TK L+HNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L+AE
Sbjct  171   FEILEALTKFLDHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGETLNAE  230

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAF  AGI  GFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  231   EAFTLAGINGGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  273



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   391 bits (1004),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 204/278 (73%), Positives = 230/278 (83%), Gaps = 7/278 (3%)
 Frame = +2

Query  230   ISNGHAH-GFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             ++N H +  FC+     ++ + DPLNW  AAEALKGSHLDEVKRMV EYR+  V+LGGET
Sbjct  6     LTNAHQNCSFCLP----SAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGET  61

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVAAV+       V+VELSE+AR GVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  62    LTIAQVAAVSGHDQG--VRVELSESAREGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  119

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  120   RTKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILE  179

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             +ITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L A++AF  
Sbjct  180   SITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLTAKQAFEL  239

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             A I S F+ELQPKE LA+ NGTA GS +A +VL++ANI
Sbjct  240   ANINSEFYELQPKEGLALVNGTAVGSGMASIVLFDANI  277



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   401 bits (1030),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 215/291 (74%), Positives = 232/291 (80%), Gaps = 16/291 (5%)
 Frame = +2

Query  209   MENGNGI--ISNGHAHG-----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVE  367
             MENGN +   +NG  +G     FC++         DPLNW AAA  L GSHLDEVK+MV 
Sbjct  1     MENGNHVNGFTNGVVNGVVNDPFCIK---------DPLNWGAAAAELTGSHLDEVKKMVA  51

Query  368   EYRKATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDS  547
             E+RK  VKLGGETLT+AQVA +AA  G   VKVELSEAARAGV ASSDWVM  M  GTDS
Sbjct  52    EFRKPVVKLGGETLTVAQVAGIAAADGGSAVKVELSEAARAGVAASSDWVMESMNKGTDS  111

Query  548   YGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTL  727
             YGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTL
Sbjct  112   YGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTL  171

Query  728   LQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGP  907
             LQGYSGIRFEILEAITK LN+NITPCLPLRGTITASG L PLSYI GL+TGR NSKAVGP
Sbjct  172   LQGYSGIRFEILEAITKFLNNNITPCLPLRGTITASGGLVPLSYIAGLLTGRPNSKAVGP  231

Query  908   NGEALDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              GE L+AE AF RAG+E GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  232   TGEILNAETAFARAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  282



>gb|AEO92029.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
 gb|AEO94541.1| phenylalanine ammonia-lyase 3 [Coffea canephora]
Length=713

 Score =   400 bits (1029),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 213/283 (75%), Positives = 232/283 (82%), Gaps = 12/283 (4%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENGN      H++ FCV+         DPLNWNAAAE+LKGSHLDEVK+MV EYRK  VK
Sbjct  6     ENGNV----HHSNRFCVQD--------DPLNWNAAAESLKGSHLDEVKKMVREYRKPLVK  53

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLT+AQVAAVAA        VEL E+A+AGVKASS+WV+  M NGTDSYGVTTGFG
Sbjct  54    LGGETLTVAQVAAVAAVHAGGGTVVELCESAKAGVKASSEWVVESMNNGTDSYGVTTGFG  113

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQ ELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIR
Sbjct  114   ATSHRRTKQGTALQTELIRFLNAGIFGNGTESGHTLPHSATRAAMLVRINTLLQGYSGIR  173

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEA+TKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NS+ VGPNG +LDA 
Sbjct  174   FEILEALTKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSRCVGPNGRSLDAT  233

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAF+ AG+ SGFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  234   EAFQIAGMNSGFFELQPKEGLALVNGTAVGSGLASMVLFEANL  276



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   400 bits (1028),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 229/275 (83%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG +   C+       +  DPLNW  AAE++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  5     NGSSESLCM-------NGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  57

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  58    SQVAAIATRDN--DVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  115

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGNG+ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAI 
Sbjct  116   QGGALQKELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIA  175

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  176   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGI  235

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  236   DSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  270



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   400 bits (1028),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 232/284 (82%), Gaps = 13/284 (5%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             ME  NG   NG +   C         S DPLNW  AAE LKGSHLDEVKRMV+E+RK  V
Sbjct  1     MEYCNG---NGSSVNSC--------KSSDPLNWGLAAEGLKGSHLDEVKRMVDEFRKPLV  49

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             K GG++LTIAQVAA+A+Q G   +KVEL+E ARAGVKASSDWVM  M+ G DSYGVTTGF
Sbjct  50    KPGGKSLTIAQVAAIASQDGA--IKVELAEEARAGVKASSDWVMGSMDKGKDSYGVTTGF  107

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQ+ELIRFLNAGIFGNG ESCHTL H+ TRA MLVRINTLLQGYSGI
Sbjct  108   GATSHRRTKQGGALQRELIRFLNAGIFGNGTESCHTLPHTATRAAMLVRINTLLQGYSGI  167

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEI+EAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE+LDA
Sbjct  168   RFEIMEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDA  227

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              +AF  AGI+ GFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  228   TKAFELAGIDGGFFELQPKEGLALVNGTAVGSGLASMVLFEANV  271



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 225/269 (84%), Gaps = 2/269 (1%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FC+         HDPLNW AAAEALKGSHLDEVKRMV EYRK  V LGG+TLTI+QVAA+
Sbjct  11    FCLTANNGQQPRHDPLNWAAAAEALKGSHLDEVKRMVSEYRKPLVNLGGQTLTISQVAAI  70

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             AA      V V+LSEA+RAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  71    AANDQG--VSVQLSEASRAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQ  128

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG E+  TL H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  129   KELIRFLNAGIFGNGTETNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  188

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+A+EAF+ AGI S FFE
Sbjct  189   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAKEAFQAAGIGSDFFE  248

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGT  GS LA +VL+EANI
Sbjct  249   LQPKEGLALVNGTPVGSGLASVVLFEANI  277



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   400 bits (1028),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 208/277 (75%), Positives = 229/277 (83%), Gaps = 3/277 (1%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             SNGH +G   E       S DPLNW  AAE+L+GSHLDEVK+MV E+RK  VKLGGE+LT
Sbjct  3     SNGHVNGG--ENFELCKKSADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLT  60

Query  413   IaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             +AQVAA+A +  +   VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  61    VAQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRR  120

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TK G ALQKELIRFLNAG+FGNG E+ HTL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  121   TKNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAFR A
Sbjct  181   ITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVA  240

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             G+  GFFELQPKE LA+ NGTA GS +A MVL+++NI
Sbjct  241   GVNGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNI  277



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   400 bits (1028),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 206/281 (73%), Positives = 230/281 (82%), Gaps = 3/281 (1%)
 Frame = +2

Query  227   IISNGHAHGFC--VEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             I  NGH +G    V       S++DPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGG
Sbjct  5     IAQNGHINGEVEEVAMDLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGG  64

Query  401   ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             ETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  65    ETLTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGAT  124

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTK G ALQKELIRFLNAG+FGNG E+ HTL HS TRA MLVRINTLLQGYSGIRFE
Sbjct  125   SHRRTKNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFE  184

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSK VGPNGE L+AEEA
Sbjct  185   ILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKVVGPNGEKLNAEEA  244

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FR AG+  GFFELQPKE LA+ NGTA GS +A +VL+E+NI
Sbjct  245   FRVAGVTGGFFELQPKEGLALVNGTAVGSAMASIVLFESNI  285



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   400 bits (1028),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 211/282 (75%), Positives = 231/282 (82%), Gaps = 4/282 (1%)
 Frame = +2

Query  221   NGIISNGHA-HGFCVEQKRRASS-SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NG + NG +  G C          S D LNW AAAEA+KGSHL+EVKRMVEEYRK  V L
Sbjct  9     NGHVQNGVSLEGICTSNGNNGGVVSGDALNWGAAAEAMKGSHLEEVKRMVEEYRKPAVNL  68

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTI+QVAA+A+      VKVELSEAAR GVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  69    GGETLTISQVAAIASHDCG--VKVELSEAAREGVKASSDWVMESMSKGTDSYGVTTGFGA  126

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL H+ TR+ +LVRINTLLQGYSGIRF
Sbjct  127   TSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHTATRSALLVRINTLLQGYSGIRF  186

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEA+TKLLN N+TPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGPNGE+L A +
Sbjct  187   EILEAMTKLLNSNVTPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQ  246

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF+ AGI SGFFELQPKE LA+ NGTA GS LA MVL++ANI
Sbjct  247   AFKVAGINSGFFELQPKEGLALVNGTAVGSGLASMVLFDANI  288



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   400 bits (1027),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 229/284 (81%), Gaps = 11/284 (4%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MENG         H  CV+       S DPLNW  AAE+L GSHLDEVKRMV E+RK  V
Sbjct  1     MENG---------HDECVKVSEFCLKS-DPLNWGVAAESLMGSHLDEVKRMVAEFRKPVV  50

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             K GGE+LT+AQVAA+AA+G    VKVEL+E ARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  51    KFGGESLTVAQVAAIAAKGDQ-GVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGF  109

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRT QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGI
Sbjct  110   GATSHRRTNQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGI  169

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAIT  LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGEA +A
Sbjct  170   RFEILEAITTFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEAFNA  229

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EEAFR AG+  GFFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  230   EEAFRLAGLSGGFFELQPKEGLALVNGTAVGSGLASIVLFEANV  273



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   400 bits (1027),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 211/279 (76%), Positives = 229/279 (82%), Gaps = 11/279 (4%)
 Frame = +2

Query  230   ISNGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  403
             + NGH   +GFCV+Q       +DPLNW AAAEAL+GSHLDEVKRMV E+RK  VKLGGE
Sbjct  1     MENGHKNGNGFCVKQ-------NDPLNWGAAAEALQGSHLDEVKRMVAEFRKPVVKLGGE  53

Query  404   TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             TLTI+QVAA+AA+     V VEL+EAAR GVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  54    TLTISQVAAIAARDNG--VVVELAEAARPGVKASSDWVMESMNKGTDSYGVTTGFGATSH  111

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTKQG ALQKELIRFLNAGIFG G ES HTL H+ TRA MLVRINTLLQGYSGIRFEIL
Sbjct  112   RRTKQGGALQKELIRFLNAGIFGKGTESEHTLPHTATRAAMLVRINTLLQGYSGIRFEIL  171

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             E ITK LNHNITPCLPLRGTITASGDL PLSYI G +TGR NS+AVGP GEAL+AEEAF+
Sbjct  172   ETITKFLNHNITPCLPLRGTITASGDLVPLSYIAGFLTGRPNSRAVGPTGEALNAEEAFK  231

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG   GFFELQPKE LA+ NGTA GS LA + LYEAN+
Sbjct  232   LAGASGGFFELQPKEGLALVNGTAVGSGLASIALYEANV  270



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   400 bits (1027),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 228/275 (83%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C       +S  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10    NGSVESLC-------NSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63    SQVAAIATRDN--DVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGNG+ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAI 
Sbjct  121   QGGALQKELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIA  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  181   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  275



>gb|ABN79671.2| phenylalanine ammonia-lyase [Rudbeckia hirta]
Length=720

 Score =   400 bits (1028),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 231/284 (81%), Gaps = 11/284 (4%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGN +  NG A  FC++         DPLNW AAAEAL GSHLDEVK+MV E+RK  VKL
Sbjct  8     NGNHVNGNGAAAEFCIK---------DPLNWGAAAEALTGSHLDEVKKMVAEFRKPVVKL  58

Query  395   GGETLTIaqvaavaaqggTPE--VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             GGETLT++QVA +AA GG     V VELSEAARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  59    GGETLTVSQVAGIAAAGGGGGGTVTVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGF  118

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTK G ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGI
Sbjct  119   GATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  178

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GP GE L+A
Sbjct  179   RFEILEAITKFLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAMGPTGEILNA  238

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             E AF +AG++ GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  239   ETAFAQAGVKGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  282



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/281 (74%), Positives = 231/281 (82%), Gaps = 3/281 (1%)
 Frame = +2

Query  227   IISNGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             I  NGH +G  V  E  +++ +  DPLNW  AA++L+GSHLDEVK+MV E+RK  VKLGG
Sbjct  4     IAQNGHVNGEVVAMELCKKSINVDDPLNWEMAADSLRGSHLDEVKKMVAEFRKPIVKLGG  63

Query  401   ETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             ETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  64    ETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGAT  123

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFE
Sbjct  124   SHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFE  183

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITKL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEA
Sbjct  184   ILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEA  243

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             F  AG+  GFFELQPKE LA+ NGTA GS +A MVL+++NI
Sbjct  244   FCAAGVSGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNI  284



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 208/278 (75%), Positives = 234/278 (84%), Gaps = 7/278 (3%)
 Frame = +2

Query  230   ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             ++NG+ +G FC      ++ + DPLNW  AAEALKGSHLDEVKRMV EYR+  V+LGGET
Sbjct  6     LTNGNQNGSFCF----TSTKTSDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGET  61

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVA V+A      V+VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHR
Sbjct  62    LTIAQVAGVSAHDQG--VRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHR  119

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ESCHTL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  120   RTKQGGALQKELIRFLNAGIFGNGTESCHTLPHTATRAAMLVRINTLLQGYSGIRFEILE  179

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A++AF+ 
Sbjct  180   AITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGELLNAKQAFQS  239

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             A I S FFELQPKE LA+ NGTA GS LA +VL++ANI
Sbjct  240   ANINSDFFELQPKEGLALVNGTAVGSGLASIVLFDANI  277



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/281 (75%), Positives = 232/281 (83%), Gaps = 12/281 (4%)
 Frame = +2

Query  218   GNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  397
             GNG+ S G + GFC++         DPLNW  AAEA+KGSHL+EVK MVEE+RK  V+LG
Sbjct  8     GNGVGSGG-SPGFCLK---------DPLNWGVAAEAMKGSHLEEVKGMVEEFRKPVVRLG  57

Query  398   GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             GETLTI+QVAA+A +G   EV VELSE+AR GVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  58    GETLTISQVAAIAVRGS--EVAVELSESAREGVKASSDWVMESMNKGTDSYGVTTGFGAT  115

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTK+G ALQKELIRFLNAGIFGNG ESCHTL  S TRA MLVRINTLLQGYSGIRFE
Sbjct  116   SHRRTKEGGALQKELIRFLNAGIFGNGTESCHTLPQSATRAAMLVRINTLLQGYSGIRFE  175

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAI+K LN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L  +EA
Sbjct  176   ILEAISKFLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAVGPTGEILHPKEA  235

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             FR AG+E GFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  236   FRLAGVEGGFFELQPKEGLALVNGTAVGSGLASMVLFEANI  276



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 208/258 (81%), Positives = 226/258 (88%), Gaps = 2/258 (1%)
 Frame = +2

Query  287   SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKV  466
             S D LNW AAAEA+KGSHL+EVKRMVEEYRK  V LGGETLTI+QVAA+A+Q G   VKV
Sbjct  33    SGDALNWGAAAEAMKGSHLEEVKRMVEEYRKPAVNLGGETLTISQVAAIASQDGG--VKV  90

Query  467   ELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGI  646
             ELSEAAR GVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGI
Sbjct  91    ELSEAAREGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGI  150

Query  647   FGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTI  826
             FGNG ESCHTL H+ TRA +LVRINTLLQGYSGIRFEILEA+TKLLN N+TPCLPLRGT+
Sbjct  151   FGNGTESCHTLPHTTTRAALLVRINTLLQGYSGIRFEILEAMTKLLNGNVTPCLPLRGTV  210

Query  827   TASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMAN  1006
             TASGDL PLSYI GL+TGR NSKAVGPNGE+L A +AF+ AGI SGFFELQPKE LA+ N
Sbjct  211   TASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQPKEGLALVN  270

Query  1007  GTADGSRLACMVLYEANI  1060
             GTA GS LA MVL++ANI
Sbjct  271   GTAVGSGLASMVLFDANI  288



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 213/277 (77%), Positives = 231/277 (83%), Gaps = 6/277 (2%)
 Frame = +2

Query  233   SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +NGH +G FC+     A  ++DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4     TNGHQNGSFCLST---AKGNNDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETL  60

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TIAQVAAVA       V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHRR
Sbjct  61    TIAQVAAVAGHDHG--VAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRR  118

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  119   TKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  178

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKLLN+N+TPCL LRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF  A
Sbjct  179   ITKLLNNNVTPCLDLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELA  238

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              I S FFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  239   SINSEFFELQPKEGLALVNGTAVGSGLASMVLFEANI  275



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 218/259 (84%), Gaps = 2/259 (1%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVK  463
             S  DPLNW  AAE+LKGSHLDEVKRM++EYRK  +KLGGETLTI QV A+A++     VK
Sbjct  17    SPSDPLNWGMAAESLKGSHLDEVKRMIDEYRKPVIKLGGETLTIGQVTAIASRDVG--VK  74

Query  464   VELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  643
             VELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQKELIRFLNAG
Sbjct  75    VELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAG  134

Query  644   IFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  823
             IFGNG ES HTL HS +RA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  135   IFGNGTESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  194

Query  824   ITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMA  1003
             ITASGDL PLSYI GL+TGR NSKAVGPNGE L A EAF  AGI  GFFELQPKE LA+ 
Sbjct  195   ITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALV  254

Query  1004  NGTADGSRLACMVLYEANI  1060
             NGTA GS LA MVL+EAN+
Sbjct  255   NGTAVGSGLASMVLFEANV  273



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/277 (75%), Positives = 230/277 (83%), Gaps = 1/277 (0%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             SNGH +G    +  + SS+ DPLNW  AAE+L+GSHLDEVK+MV E+RK  VKLGGETLT
Sbjct  3     SNGHVNGGENFELCKKSSATDPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGETLT  62

Query  413   IaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             +AQVAA+A +  +   VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  63    VAQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRR  122

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TK G ALQKELIRFLNAG+FGNG E+ HTL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  123   TKNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  182

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             I KL+N NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAV PNGE L+AEEAFR A
Sbjct  183   IAKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVSPNGETLNAEEAFRVA  242

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             G+  GFFELQPKE LA+ NGTA GS +A MVL+++NI
Sbjct  243   GVNGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNI  279



>ref|XP_010032174.1| PREDICTED: phenylalanine ammonia-lyase-like [Eucalyptus grandis]
 gb|KCW51577.1| hypothetical protein EUGRSUZ_J01079 [Eucalyptus grandis]
Length=715

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 216/283 (76%), Positives = 233/283 (82%), Gaps = 17/283 (6%)
 Frame = +2

Query  218   GNGIISNGHAHGFCVEQKRRASSSH--DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             GNG+      H  C      A+ SH  DPLNW AAA AL GSHLDEVKRMVEEYR+  V+
Sbjct  10    GNGL------HSLC------AAGSHHADPLNWGAAAAALTGSHLDEVKRMVEEYRRPAVR  57

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGE+LTIAQVAAVA+Q G   V VELSEAAR  VKASSDWVM  M  GTDSYGVTTGFG
Sbjct  58    LGGESLTIAQVAAVASQEG---VGVELSEAARPRVKASSDWVMESMNKGTDSYGVTTGFG  114

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL  S TRA MLVR+NTLLQGYSGIR
Sbjct  115   ATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPQSSTRAAMLVRVNTLLQGYSGIR  174

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G++LDA 
Sbjct  175   FEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLDAV  234

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAFR AGI++GFFELQPKE LA+ NGTA GS LA +VL++ANI
Sbjct  235   EAFRLAGIDTGFFELQPKEGLALVNGTAVGSGLASIVLFDANI  277



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   399 bits (1026),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 207/289 (72%), Positives = 233/289 (81%), Gaps = 15/289 (5%)
 Frame = +2

Query  209   MENGNGIISNG-----HAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEY  373
             MENGNG+ +NG     H +  C++         DPLNW  AAEAL GSHL+EVK+MV+E+
Sbjct  1     MENGNGVYANGTNGNGHINDLCIK---------DPLNWGVAAEALTGSHLNEVKKMVKEF  51

Query  374   RKATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYG  553
             +   VK+GGETLT++QVA +AA      VKVELSE+ARAGVKASSDWVM  M  GTDSYG
Sbjct  52    KNPIVKIGGETLTVSQVAGIAASDNA-SVKVELSESARAGVKASSDWVMESMGKGTDSYG  110

Query  554   VTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQ  733
             VTTGFGATSHRRTK G ALQKELIRFLNAGIFGNG E+ HTL HS TRA MLVRINTLLQ
Sbjct  111   VTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTEASHTLPHSATRAAMLVRINTLLQ  170

Query  734   GYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNG  913
             GYSGIRFEILEAITK LN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G
Sbjct  171   GYSGIRFEILEAITKFLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTG  230

Query  914   EALDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             E L AE+AF +AG+E GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  231   EILTAEKAFAQAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  279



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 214/288 (74%), Positives = 235/288 (82%), Gaps = 14/288 (5%)
 Frame = +2

Query  209   MENGNGIISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYR  376
             MENGNG  +NGH +G    FC++       + DPL W  AAEA+ GSHLDEVK+MV EYR
Sbjct  1     MENGNGATTNGHVNGNGMDFCMK-------TEDPLYWGIAAEAMTGSHLDEVKKMVAEYR  53

Query  377   KATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGV  556
             K  VKLGGETLTI+QVAA++A+ G+  V VELSEAARAGVKASSDWVM  M  GTDSYGV
Sbjct  54    KPVVKLGGETLTISQVAAISARDGS-GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGV  112

Query  557   TTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQG  736
             TTGFGATSHRRTKQG ALQKELIRFLNAGIFGNG++  +TL HS TRA MLVRINTLLQG
Sbjct  113   TTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGSD--NTLPHSATRAAMLVRINTLLQG  170

Query  737   YSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGE  916
             YSGIRFEILEAITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G 
Sbjct  171   YSGIRFEILEAITKFLNQNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGV  230

Query  917   ALDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              L  EEAF+ AG+E GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  231   ILSPEEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  278



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 209/279 (75%), Positives = 232/279 (83%), Gaps = 12/279 (4%)
 Frame = +2

Query  233   SNGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  403
             SNGH   A+GFCV+Q       +DPLNW AAAE+LKGSHL+EVKRMVEE+RK  VKLGGE
Sbjct  9     SNGHNNGANGFCVKQ-------NDPLNWAAAAESLKGSHLEEVKRMVEEFRKPVVKLGGE  61

Query  404   TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             TLTI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSH
Sbjct  62    TLTISQVAAIAAKDNA--VAVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  119

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTKQG ALQKELIRFLNAGIFGN  ES HTL H+ TRA MLVRINTLLQGYSGIRFEIL
Sbjct  120   RRTKQGGALQKELIRFLNAGIFGNATESNHTLPHTATRAAMLVRINTLLQGYSGIRFEIL  179

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITK LN N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L AE+AF+
Sbjct  180   EAITKFLNQNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEPLTAEQAFK  239

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+  GFF+LQPKE LA+ NGTA GS LA + L++AN+
Sbjct  240   LAGVTGGFFDLQPKEGLALVNGTAVGSGLASIALFDANV  278



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 224/269 (83%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV          DPLNW  AAE LK SHLDEVKRMV EYRK  V+LGGETLTI+QVAA+
Sbjct  15    FCVS---------DPLNWGMAAETLKESHLDEVKRMVAEYRKPVVRLGGETLTISQVAAI  65

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             A + G  +V VELSE ARAGV ASS+WVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ
Sbjct  66    AGREG--DVGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQ  123

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAITKLLNHN
Sbjct  124   KELIRFLNAGIFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  183

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             ITPCLPLRGT+TASGDL PLS I GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFE
Sbjct  184   ITPCLPLRGTVTASGDLVPLSDIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFE  243

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  244   LQPKEGLALVNGTAVGSGLASMVLFETNV  272



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 230/284 (81%), Gaps = 17/284 (6%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MENGNG +       FC++         DPLNW  AAE++KGSHLDEVK+MV E+RK  V
Sbjct  1     MENGNGKME------FCMK---------DPLNWGMAAESMKGSHLDEVKKMVAEFRKPVV  45

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             +L G+TLTIAQVAA+AA+     V VEL+EAAR GVKASSDWVM  M  GTDSYGVTTGF
Sbjct  46    QLAGKTLTIAQVAAIAARDDG--VTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGF  103

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQKELIRFLNAGIFGNG E+ HTL HS TRA MLVRINTLLQGYSGI
Sbjct  104   GATSHRRTKQGGALQKELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGI  163

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L+A
Sbjct  164   RFEILEAITKFLNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEKLNA  223

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EEAFR AGI SGFFELQPKE LA+ NGTA GS +A MVLYEANI
Sbjct  224   EEAFRLAGISSGFFELQPKEGLALVNGTAVGSGMASMVLYEANI  267



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 225/275 (82%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG +   C ++        DPL+W  AAEA+KGSHLDEVKRMV EYRK  V L G+TLTI
Sbjct  11    NGSSESLCTQR--------DPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    +  VKVELSE+AR  VKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  63    AQVASIAGHDAS-NVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  121

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGI FEILEAIT
Sbjct  122   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGICFEILEAIT  181

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE LDA EAF+ AGI
Sbjct  182   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGI  241

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  242   DSGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  276



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 227/275 (83%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C       SS  DPLNW  AA+++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10    NGSTESLC-------SSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63    SQVAAIATRDN--DVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGN +ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAI 
Sbjct  121   QGGALQKELIRFLNSGIFGNESESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIA  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  181   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASIVLFEANI  275



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 227/276 (82%), Gaps = 3/276 (1%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSH-DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             N + HG  +E    A++ H DPLNW   A++LKGSHLDEVKRMV+EYR+  V+LGGETLT
Sbjct  8     NNNNHGSSLESFCTATAGHHDPLNWGMLADSLKGSHLDEVKRMVDEYRRPVVRLGGETLT  67

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             IAQV A+A +     +KVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  68    IAQVTAIANRDAG--IKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  125

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQG ALQ+ELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  126   KQGGALQRELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  185

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TK +NHN+TP LPLRGTITASGDL PLSYI GL+ GR NSK VGPNGE+LD  EAF  AG
Sbjct  186   TKFINHNVTPSLPLRGTITASGDLVPLSYIAGLLIGRPNSKCVGPNGESLDPTEAFTLAG  245

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I SGFF+LQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  246   INSGFFDLQPKEGLALVNGTAVGSGLASMVLFEANV  281



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   400 bits (1027),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 211/276 (76%), Positives = 229/276 (83%), Gaps = 10/276 (4%)
 Frame = +2

Query  236   NGHA-HGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             NGH+ +GFCV+Q        DPLNW AAAEAL+GSHLD VKRMVEE+RK  VKLGGETLT
Sbjct  56    NGHSENGFCVKQS-------DPLNWAAAAEALQGSHLDAVKRMVEEFRKPAVKLGGETLT  108

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             IAQVAA+A++     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  109   IAQVAAIASRDNA--VAVELAESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRT  166

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTL+QGYSGIRFEILEA+
Sbjct  167   KQGGALQKELIRFLNAGIFGNGTESNHTLPHSSTRAAMLVRINTLMQGYSGIRFEILEAL  226

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
              K LNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L AE AF+ AG
Sbjct  227   AKFLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEPLTAEAAFKLAG  286

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +  GFFELQPKE LA+ NGTA GS LA + LYEANI
Sbjct  287   VAGGFFELQPKEGLALVNGTAVGSGLASIALYEANI  322



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 213/278 (77%), Positives = 232/278 (83%), Gaps = 8/278 (3%)
 Frame = +2

Query  230   ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+NGHA   FCV +     S  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GG T
Sbjct  4     ITNGHAEATFCVTK-----SVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGAT  58

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59    LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  117   RTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILE  176

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF+ 
Sbjct  177   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQL  236

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGI S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  237   AGIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANV  274



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 213/278 (77%), Positives = 232/278 (83%), Gaps = 8/278 (3%)
 Frame = +2

Query  230   ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+NGHA   FCV +     S  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GG T
Sbjct  4     ITNGHAEATFCVTK-----SVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGAT  58

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHR
Sbjct  59    LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  116

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  117   RTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILE  176

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF+ 
Sbjct  177   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQL  236

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGI S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  237   AGIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANV  274



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   398 bits (1022),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 212/277 (77%), Positives = 229/277 (83%), Gaps = 7/277 (3%)
 Frame = +2

Query  233   SNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +NGH +G FC+     ++   DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGETL
Sbjct  4     TNGHQNGSFCLS----STKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETL  59

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TIAQVAAVA       V VELSE+AR GVKASS+WVM  M N TDSYGVTTGFGATSHRR
Sbjct  60    TIAQVAAVAGHDHG--VTVELSESAREGVKASSEWVMNSMNNRTDSYGVTTGFGATSHRR  117

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  118   TKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  177

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
              TKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L+A+EAF  A
Sbjct  178   NTKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELA  237

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              I S FFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  238   SINSEFFELQPKEGLALVNGTAVGSGLASMVLFEANI  274



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   398 bits (1022),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 225/276 (82%), Gaps = 11/276 (4%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             SNG +  FCV+         DPLNW  AAEALKGSHLDEVKRMVEE+RK  VKLGGETLT
Sbjct  10    SNGKSMDFCVK---------DPLNWGMAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLT  60

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             ++QVAA+AA+     V VELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRT
Sbjct  61    VSQVAAIAARDNA--VTVELSETARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRT  118

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  119   KQGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  178

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TK LNHNITPCLP RGTITASGDL PLSYI G++TGR NSKAVGP+G+ L  ++AF+ AG
Sbjct  179   TKFLNHNITPCLPPRGTITASGDLVPLSYIAGMLTGRPNSKAVGPSGQTLTPKDAFKLAG  238

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +  GFFELQPKE LA+ NGTA GS LA +VL+E N+
Sbjct  239   VNGGFFELQPKEGLALVNGTAVGSGLASIVLFETNV  274



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   398 bits (1022),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 205/275 (75%), Positives = 224/275 (81%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG +   C ++        DPL+W  AAEA+KGSHLDEVKRMV EYRK  V L G+ LTI
Sbjct  11    NGSSESLCTQR--------DPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    +  VKVELSE+AR  VKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  63    AQVASIAGHDAS-NVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  121

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  122   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  181

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN+NITPCLPLRGTITASGDL PLSYI GL+TG  NSKA GPNGE LDA EAF+ AGI
Sbjct  182   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGI  241

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  242   DSGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  276



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   397 bits (1021),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 207/281 (74%), Positives = 229/281 (81%), Gaps = 15/281 (5%)
 Frame = +2

Query  230   ISNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLG  397
             + NGH+ G    FC+E         DPLNW  AAE+LKGSHLDE+KRMVEE+RK  VKLG
Sbjct  6     VENGHSSGKLLNFCIE---------DPLNWGTAAESLKGSHLDELKRMVEEFRKPVVKLG  56

Query  398   GETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGAT  577
             GETLTI+QVAA+A++     VKVEL+EAARAGVKASSDWVM  M  GTDSYGVTTGFGAT
Sbjct  57    GETLTISQVAAIASRDNA--VKVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGAT  114

Query  578   SHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             SHRRTKQG ALQKELIRFLNAGIFGNG ES   L HS TRA MLVRINTLLQGYSGIRFE
Sbjct  115   SHRRTKQGGALQKELIRFLNAGIFGNGTESSQALPHSATRAAMLVRINTLLQGYSGIRFE  174

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITK LN NITPCLPLRGTI++SGDL PLSYI GL+TGR NSK VGP GE+L AEEA
Sbjct  175   ILEAITKFLNSNITPCLPLRGTISSSGDLVPLSYIAGLLTGRHNSKVVGPTGESLTAEEA  234

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             F+ AG+  GFFELQPKE LA+ NGTA GS LA +VL++AN+
Sbjct  235   FKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIVLFDANV  275



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   397 bits (1021),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 207/273 (76%), Positives = 223/273 (82%), Gaps = 6/273 (2%)
 Frame = +2

Query  254   FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3     FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63    VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
               LQKELIRFLNAGIFGNG ES HTL  S TRA MLVRINTLLQGYSGIRFE+LEAITKL
Sbjct  121   GELQKELIRFLNAGIFGNGTESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKL  180

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L   EAF +AGI+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDG  240

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASMVLFETNV  273



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   397 bits (1021),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 207/273 (76%), Positives = 223/273 (82%), Gaps = 6/273 (2%)
 Frame = +2

Query  254   FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3     FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63    VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
               LQKELIRFLNAGIFGNG ES HTL  S TRA MLVRINTLLQGYSGIRFE+LEAITKL
Sbjct  121   GELQKELIRFLNAGIFGNGTESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKL  180

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L   EAF +AGI+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDG  240

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASMVLFETNV  273



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   397 bits (1021),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 207/273 (76%), Positives = 223/273 (82%), Gaps = 6/273 (2%)
 Frame = +2

Query  254   FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3     FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63    VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
               LQKELIRFLNAGIFGNG ES HTL  S TRA MLVRINTLLQGYSGIRFE+LEAITKL
Sbjct  121   GELQKELIRFLNAGIFGNGTESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKL  180

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L   EAF +AGI+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDG  240

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASMVLFETNV  273



>ref|XP_010528074.1| PREDICTED: phenylalanine ammonia-lyase 1 [Tarenaya hassleriana]
Length=720

 Score =   397 bits (1021),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 206/261 (79%), Positives = 222/261 (85%), Gaps = 1/261 (0%)
 Frame = +2

Query  278   ASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE  457
             A+S+ DPLNW AAAE +KGSHL+EVKRMVEE+R+  V+LGGETLTI QVAA++A G    
Sbjct  23    AASAEDPLNWGAAAEEMKGSHLEEVKRMVEEFRRPVVRLGGETLTIGQVAAISAAGND-G  81

Query  458   VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLN  637
              KVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIRFLN
Sbjct  82    AKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  141

Query  638   AGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLR  817
             AGIFG+ AE  HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT LLNHNI PCLPLR
Sbjct  142   AGIFGSAAEKSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSLLNHNIAPCLPLR  201

Query  818   GTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLA  997
             GTITASGDL PLSYI GL+TGR NSKA GPNGE L AEEAF+ AGI SGFF+LQPKE LA
Sbjct  202   GTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLTAEEAFKLAGITSGFFDLQPKEGLA  261

Query  998   MANGTADGSRLACMVLYEANI  1060
             + NGTA GS LA MVL+EAN+
Sbjct  262   LVNGTAVGSGLASMVLFEANV  282



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 228/282 (81%), Gaps = 14/282 (5%)
 Frame = +2

Query  230   ISNGHAHG-----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             + NGH  G     FC++         DPLNW  AAE+L GSHLDEVKRMV E+RK  VKL
Sbjct  1     MENGHDEGVKVSEFCLKS--------DPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKL  52

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGE+LT+AQVAA+AA+G    VKVEL+E ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  53    GGESLTVAQVAAIAAKGDQ-GVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGA  111

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRT QG ALQKELIRFLNAGIFGNG E+CH L HS TRA MLVRINTLLQGYSGIRF
Sbjct  112   TSHRRTNQGGALQKELIRFLNAGIFGNGTETCHMLPHSATRAAMLVRINTLLQGYSGIRF  171

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAIT  LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGEA +AEE
Sbjct  172   EILEAITTFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEAFNAEE  231

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AFR AG+  GFF LQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  232   AFRLAGLSGGFFLLQPKEGLALVNGTAVGSGLASIVLFEANV  273



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 218/259 (84%), Gaps = 2/259 (1%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVK  463
             + +DPLNW  AAE+LKGSHLDEVKRM++EYRK  VKLGGETLTI QV A+A++     VK
Sbjct  17    NPNDPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDIG--VK  74

Query  464   VELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  643
             VELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQKELIRFLNAG
Sbjct  75    VELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAG  134

Query  644   IFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  823
             IFGNG ES HTL HS +RA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  135   IFGNGTESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  194

Query  824   ITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMA  1003
             ITASGDL PLSYI GL+TGR NSKA+GPNGE L A EAF  AGI  GFFELQPKE LA+ 
Sbjct  195   ITASGDLVPLSYIAGLLTGRPNSKALGPNGEPLTAAEAFTLAGINGGFFELQPKEGLALV  254

Query  1004  NGTADGSRLACMVLYEANI  1060
             NGTA GS LA MVL+E N+
Sbjct  255   NGTAVGSGLASMVLFETNV  273



>ref|XP_011077265.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Sesamum indicum]
Length=714

 Score =   397 bits (1019),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 209/287 (73%), Positives = 224/287 (78%), Gaps = 14/287 (5%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             MEN N   S      FCV      SSS DPLNW  AAE+L GSHLDEVK+MV EYRK  V
Sbjct  1     MENANANSS------FCVR-----SSSDDPLNWKLAAESLTGSHLDEVKKMVAEYRKPVV  49

Query  389   KLGGETLTIaqvaavaaqggT---PEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVT  559
             +LGGETL I Q    AA   T    EV VEL+E AR GVKASS+WVM  M  GTDSYGVT
Sbjct  50    RLGGETLAIGQGGGGAAAVATRDAEEVTVELAETAREGVKASSEWVMESMNKGTDSYGVT  109

Query  560   TGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGY  739
             TGFGATSHRRTKQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGY
Sbjct  110   TGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESSHTLPHSATRASMLVRINTLLQGY  169

Query  740   SGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEA  919
             SGIRFE+LEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+ GR NSKA+GPNGE 
Sbjct  170   SGIRFEVLEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLLGRPNSKAIGPNGEV  229

Query  920   LDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             LD  +AF  AGI++GFFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  230   LDPAQAFTLAGIDTGFFELQPKEGLALVNGTAVGSGLASIVLFEANV  276



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 209/279 (75%), Positives = 230/279 (82%), Gaps = 12/279 (4%)
 Frame = +2

Query  224   GIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGE  403
             G I NGH + FC++         DPLNW  AA++LKGSHLDEVKRMV E+R   VK+GG+
Sbjct  3     GAIENGHTNDFCIKV--------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  54

Query  404   TLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             TLT+AQVAA+AA+     VKVELSEAARAGVKASSDWVM  M NGTDSYGVTTGFGATSH
Sbjct  55    TLTVAQVAAIAARDNA--VKVELSEAARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  112

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQ+ELIRFLNAGIFG G  + HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  113   RRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  170

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L AEEAF+
Sbjct  171   EAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLTAEEAFK  230

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AG+  GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  231   LAGVNGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  269



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 211/291 (73%), Positives = 227/291 (78%), Gaps = 15/291 (5%)
 Frame = +2

Query  227   IISNGHAH-----------GFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVE  367
             I  NGH H           G C+  E  +   S  DPLNW AAAE++ GSHLDEV+RMV 
Sbjct  4     ITQNGHHHQNGIQNGSLDDGLCIKTESIKTGYSVSDPLNWGAAAESMTGSHLDEVRRMVA  63

Query  368   EYRKATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDS  547
             EYRK  VKLGGETLTI+QVAA+A       VKVEL+E+ARAGVKASSDWVM  M  GTDS
Sbjct  64    EYRKPVVKLGGETLTISQVAAIANHDSG--VKVELAESARAGVKASSDWVMDSMNKGTDS  121

Query  548   YGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTL  727
             YGVTTGFGATSHRRTKQGAALQKELIRFLNAG+  NG ES HTL HS TRA MLVRINTL
Sbjct  122   YGVTTGFGATSHRRTKQGAALQKELIRFLNAGVLRNGTESAHTLPHSATRAAMLVRINTL  181

Query  728   LQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGP  907
             LQGYSGIRFEILEAI+K LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP
Sbjct  182   LQGYSGIRFEILEAISKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGP  241

Query  908   NGEALDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              GE L+A EAF + GI SGFFELQPKE LA+ NGTA GS LA  VL+E NI
Sbjct  242   KGETLNAAEAFAQVGISSGFFELQPKEGLALVNGTAVGSGLASTVLFETNI  292



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 218/259 (84%), Gaps = 2/259 (1%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVK  463
             + +DPLNW   AE+LKGSHLDEVKRM++EYRK  VKLGGE+LTI QV A+A++     VK
Sbjct  17    NPNDPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVG--VK  74

Query  464   VELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  643
             VELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQKELIRFLNAG
Sbjct  75    VELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAG  134

Query  644   IFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  823
             IFGNG ES HTL HS +RA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  135   IFGNGTESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  194

Query  824   ITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMA  1003
             ITASGDL PLSYI GL+TGR NSKAVGPNGE L A EAF  AGI  GFFELQPKE LA+ 
Sbjct  195   ITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALV  254

Query  1004  NGTADGSRLACMVLYEANI  1060
             NGTA GS LA MVL+EAN+
Sbjct  255   NGTAVGSGLASMVLFEANV  273



>gb|KCW65428.1| hypothetical protein EUGRSUZ_G02848 [Eucalyptus grandis]
Length=701

 Score =   396 bits (1017),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 207/256 (81%), Positives = 220/256 (86%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW AAA AL GSHLDEVKRMVEE R+  V+LGGETLTIAQVAA+A +     + VEL
Sbjct  23    DPLNWGAAAAALTGSHLDEVKRMVEESRRPVVRLGGETLTIAQVAAIAGREAG--MAVEL  80

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ+ELIRFLNAGIFG
Sbjct  81    SEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFG  140

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILE + KLLN NITPCLPLRGTITA
Sbjct  141   NGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTITA  200

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNGE+L+A EAFR AGIE GFF+LQPKE LA+ NGT
Sbjct  201   SGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQPKEGLALVNGT  260

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VLYEANI
Sbjct  261   AVGSGLASIVLYEANI  276



>ref|XP_010067315.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65427.1| hypothetical protein EUGRSUZ_G02848 [Eucalyptus grandis]
Length=714

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 207/256 (81%), Positives = 220/256 (86%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW AAA AL GSHLDEVKRMVEE R+  V+LGGETLTIAQVAA+A +     + VEL
Sbjct  23    DPLNWGAAAAALTGSHLDEVKRMVEESRRPVVRLGGETLTIAQVAAIAGREAG--MAVEL  80

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQ+ELIRFLNAGIFG
Sbjct  81    SEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFG  140

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILE + KLLN NITPCLPLRGTITA
Sbjct  141   NGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTITA  200

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNGE+L+A EAFR AGIE GFF+LQPKE LA+ NGT
Sbjct  201   SGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIEHGFFDLQPKEGLALVNGT  260

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VLYEANI
Sbjct  261   AVGSGLASIVLYEANI  276



>gb|KHG26972.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=710

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 201/260 (77%), Positives = 222/260 (85%), Gaps = 2/260 (1%)
 Frame = +2

Query  281   SSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV  460
             SS  DPLNW A+A+++KGSHLDEVKRMVEEY+K  V+LGGETLTIAQV A+A +     V
Sbjct  15    SSLADPLNWAASAQSMKGSHLDEVKRMVEEYKKPVVRLGGETLTIAQVTAIANRDVA--V  72

Query  461   KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNA  640
             +VELSEAAR  VKASSDWVM GM  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNA
Sbjct  73    QVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNA  132

Query  641   GIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  820
             G+FG G ESCH+L H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN NITPC+PLRG
Sbjct  133   GVFGQGTESCHSLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNITPCVPLRG  192

Query  821   TITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAM  1000
             +ITASGDL PLSYI GL+TGR NSKA+GPNGE L+  EAF +AGI  GFFELQPKE LAM
Sbjct  193   SITASGDLVPLSYIAGLLTGRPNSKALGPNGETLNPTEAFSKAGINGGFFELQPKEGLAM  252

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS LA +VL+EAN+
Sbjct  253   VNGTAVGSGLASLVLFEANV  272



>gb|KJB73539.1| hypothetical protein B456_011G238400 [Gossypium raimondii]
Length=710

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 201/260 (77%), Positives = 222/260 (85%), Gaps = 2/260 (1%)
 Frame = +2

Query  281   SSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV  460
             SS  DPLNW A+A+++KGSHLDEVKRMVEEY+K  V+LGGETLTIAQV A+A +     V
Sbjct  15    SSLADPLNWAASAQSMKGSHLDEVKRMVEEYKKPVVRLGGETLTIAQVTAIANRDVA--V  72

Query  461   KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNA  640
             +VELSEAAR  VKASSDWVM GM  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNA
Sbjct  73    QVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNA  132

Query  641   GIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  820
             G+FG G ESCH+L H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN NITPC+PLRG
Sbjct  133   GVFGQGTESCHSLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNITPCVPLRG  192

Query  821   TITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAM  1000
             +ITASGDL PLSYI GL+TGR NSKA+GPNGE L+  EAF +AGI  GFFELQPKE LAM
Sbjct  193   SITASGDLVPLSYIAGLLTGRPNSKALGPNGETLNPTEAFSKAGINGGFFELQPKEGLAM  252

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS LA +VL+EAN+
Sbjct  253   VNGTAVGSGLASLVLFEANV  272



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 213/278 (77%), Positives = 236/278 (85%), Gaps = 10/278 (4%)
 Frame = +2

Query  230   ISNGH-AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             + NGH ++G CV+Q        DPLNW AAA++LKGSHLDEVK+MVEE+RK+ VKLGGET
Sbjct  5     VENGHFSNGLCVKQS-------DPLNWGAAADSLKGSHLDEVKKMVEEFRKSVVKLGGET  57

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVAA+AA+     V VEL+EAARAGVKASSDWVM  M+ GTDSYGVTTGFGATSHR
Sbjct  58    LTIAQVAAIAARDNA--VAVELAEAARAGVKASSDWVMDSMDKGTDSYGVTTGFGATSHR  115

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFG G ESCHTL HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  116   RTKQGGALQKELIRFLNAGIFGKGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  175

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITK LNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L++EEAF+ 
Sbjct  176   AITKFLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEDLNSEEAFKL  235

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AG+  GFFELQPKE LA+ NGTA GS LA + LYEAN+
Sbjct  236   AGVTGGFFELQPKEGLALVNGTAVGSGLASIALYEANV  273



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 207/275 (75%), Positives = 225/275 (82%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG    FCV+         DPLNW  AAE+LKGSHLDEVKRMV E+RK  V+LGGETLT+
Sbjct  13    NGERAEFCVKG--------DPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVRLGGETLTV  64

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+AA      VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK
Sbjct  65    SQVAAIAASDNA-GVKVELSETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  123

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             +G ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  124   EGGALQKELIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  183

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             K LNHN+TP LPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L+AE+AF  AG+
Sbjct  184   KFLNHNVTPFLPLRGTITASGDLVPLSYIAGLLTGRANSKAVGPTGEVLNAEKAFAEAGV  243

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             E GFFELQPKE LA+ NGTA GS +A MVL++AN+
Sbjct  244   EGGFFELQPKEGLALVNGTAVGSGMASMVLFDANV  278



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 204/275 (74%), Positives = 223/275 (81%), Gaps = 9/275 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG +   C ++        DPL+W  AAEA+KGSHLDEVKRMV EYRK  V L G+ L I
Sbjct  11    NGSSESLCTQR--------DPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNLII  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             AQVA++A    +  VKVELSE+AR  VKASSDWVM  M+ GTDSYGVTTGFGATSHRRTK
Sbjct  63    AQVASIAGHDAS-NVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTK  121

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  122   QGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  181

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KLLN+NITPCLPLRGTITASGDL PLSYI GL+TG  NSKA GPNGE LDA EAF+ AGI
Sbjct  182   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGI  241

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +SGFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  242   DSGFFELQPKEGLALVNGTAVGSGLASMVLFETNV  276



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   395 bits (1016),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 208/277 (75%), Positives = 229/277 (83%), Gaps = 11/277 (4%)
 Frame = +2

Query  236   NGH--AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             NGH  ++GFCV+Q        DPLNW AAAE++ GSHL EVKRMVEE+RK  V+LGGETL
Sbjct  5     NGHHASNGFCVKQS-------DPLNWGAAAESMSGSHLQEVKRMVEEFRKPVVRLGGETL  57

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GT SYGVTTGFGATSHRR
Sbjct  58    TISQVAAIAAKDNA--VAVELAESARAGVKASSDWVMDSMSKGTVSYGVTTGFGATSHRR  115

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  116   TKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  175

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE+L AE+AF+ A
Sbjct  176   ITKFLNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGESLTAEQAFKLA  235

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             G+  GFFELQPKE LA+ NGTA GS LA M LY AN+
Sbjct  236   GVSGGFFELQPKEGLALVNGTAVGSGLATMALYNANL  272



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   396 bits (1017),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/260 (77%), Positives = 223/260 (86%), Gaps = 1/260 (0%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE-V  460
             S++DPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGGETLT+AQVA++A        V
Sbjct  26    SNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANVDNKSNGV  85

Query  461   KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNA  640
             KVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIRFLNA
Sbjct  86    KVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNA  145

Query  641   GIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  820
             G+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAITKL+N NITPCLPLRG
Sbjct  146   GVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRG  205

Query  821   TITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAM  1000
             T+TASGDL PLSYI GL+TGR NSKAVGPN E L+AEEAFR AG+  GFFELQPKE LA+
Sbjct  206   TVTASGDLVPLSYIAGLLTGRPNSKAVGPNREKLNAEEAFRVAGVTGGFFELQPKEGLAL  265

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS +A +VLY++NI
Sbjct  266   VNGTAVGSGMASIVLYDSNI  285



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   396 bits (1017),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 233/284 (82%), Gaps = 8/284 (3%)
 Frame = +2

Query  212   ENGNGIISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             E  NG +SN      FC+ +     +  DPLNW  AAEA+KGSHLDEVKRMVE+YR   V
Sbjct  4     EGANGHVSNNVTEAEFCITK-----TGGDPLNWGVAAEAMKGSHLDEVKRMVEQYRNPVV  58

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             K+GGETLT+AQVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGF
Sbjct  59    KIGGETLTVAQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGF  116

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGI
Sbjct  117   GATSHRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGI  176

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A
Sbjct  177   RFEILEAITKLLNNNITPCLPLRGTITASGDLAPLSYIAGLLTGRPNSKAVGPSGEILNA  236

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +EAF  A I+S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  237   KEAFELANIDSEFFELQPKEGLALVNGTAVGSGLASIVLFEANV  280



>gb|AFJ80777.1| phenylalanine ammonia-lyase [Camellia japonica]
Length=706

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 204/275 (74%), Positives = 228/275 (83%), Gaps = 13/275 (5%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG+ HG  ++         DPL+W  AAE++KGSHLDEVKRMV E+R+  ++LGGETLTI
Sbjct  7     NGNGHGHVIK---------DPLSWELAAESMKGSHLDEVKRMVREFRQPAIRLGGETLTI  57

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAAVAA      + VELSEAARA V+ASS+WVM  M  GTDSYGVTTGFGATSHRRTK
Sbjct  58    SQVAAVAAGC----LPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTK  113

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEILEA+T
Sbjct  114   QGGALQKELIRFLNAGIFGNGTESCHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALT  173

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
             KL+NHNITPCLPLRGTITASGDL PLSYI G++TGR NSK VGP GE LDA EAFRRAGI
Sbjct  174   KLINHNITPCLPLRGTITASGDLVPLSYIAGVLTGRPNSKCVGPTGEPLDATEAFRRAGI  233

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             + GFFELQPKE LA+ NGTA GS LA +VL++AN+
Sbjct  234   DGGFFELQPKEGLALVNGTAVGSGLASIVLFDANV  268



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 217/259 (84%), Gaps = 2/259 (1%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVK  463
             + +DPLNW   AE+LKGSHLDEVKRM+ EYRK  VKLGGE+LTI QV A+A++     VK
Sbjct  17    NPNDPLNWGMVAESLKGSHLDEVKRMINEYRKPVVKLGGESLTIGQVTAIASRDVG--VK  74

Query  464   VELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  643
             VELSE AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG  LQKELIRFLNAG
Sbjct  75    VELSEEARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAG  134

Query  644   IFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  823
             IFGNG ES HTL HS +RA MLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  135   IFGNGTESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  194

Query  824   ITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMA  1003
             ITASGDL PLSYI GL+TGR NSKAVGPNGE L A EAF  AGI  GFFELQPKE LA+ 
Sbjct  195   ITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALV  254

Query  1004  NGTADGSRLACMVLYEANI  1060
             NGTA GS LA MVL+EAN+
Sbjct  255   NGTAVGSGLASMVLFEANV  273



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   396 bits (1017),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 203/256 (79%), Positives = 221/256 (86%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QVAA+A       V VEL
Sbjct  32    DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIATHDHG--VTVEL  89

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE++R GVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  90    SESSRPGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  149

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEAIT LLN+NITPCLPLRGTITA
Sbjct  150   NGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITNLLNNNITPCLPLRGTITA  209

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGP+GE L+A++AF+ AGI S FFELQPKE LA+ NGT
Sbjct  210   SGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKQAFQMAGINSEFFELQPKEGLALVNGT  269

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL++ANI
Sbjct  270   AVGSALASIVLFDANI  285



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   395 bits (1016),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 210/278 (76%), Positives = 231/278 (83%), Gaps = 8/278 (3%)
 Frame = +2

Query  230   ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+NGH    FC+ +     +  DPLNW AAAE+L GSHLDEVKRMVEEYR   VK+GGET
Sbjct  4     ITNGHVEATFCLSK-----NGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGET  58

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  59    LTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHR  116

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  117   RTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILE  176

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF+ 
Sbjct  177   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQL  236

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AGI S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  237   AGIGSDFFELQPKEGLALVNGTAVGSGLASIVLFEANV  274



>gb|AJT59582.1| phenylalanine ammonia lyase [Boehmeria nivea]
Length=728

 Score =   396 bits (1017),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 209/287 (73%), Positives = 228/287 (79%), Gaps = 11/287 (4%)
 Frame = +2

Query  227   IISNGHAH------GFCVEQKR---RASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRK  379
             +  NGH        G CV+      R  S  D LNW  AAEA+KGSHL+EVKRMV EYRK
Sbjct  5     VKQNGHHQNGVSLEGLCVKNDTNTTRKESRADALNWGEAAEAMKGSHLEEVKRMVAEYRK  64

Query  380   ATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVT  559
               V+LGGETLTIAQVAA+A       V+VELSE +RAGVKASSDWVM  M  GTDSYGVT
Sbjct  65    PVVRLGGETLTIAQVAAIAGHDAG--VRVELSEESRAGVKASSDWVMDSMNKGTDSYGVT  122

Query  560   TGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGY  739
             TGFGATSHRRTKQG ALQKELIRFLNAGIFGNG+E+CHTL HS TRA +LVRINTLLQGY
Sbjct  123   TGFGATSHRRTKQGGALQKELIRFLNAGIFGNGSETCHTLPHSATRAALLVRINTLLQGY  182

Query  740   SGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEA  919
             SGIRFEILEA+TKLLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G+ 
Sbjct  183   SGIRFEILEAMTKLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPEGQT  242

Query  920   LDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             L A EAF  AGI SGFFELQPKE LA+ NGTA GS +A  VL+EAN+
Sbjct  243   LSATEAFEAAGIHSGFFELQPKEGLALVNGTAVGSGMASTVLFEANV  289



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   395 bits (1016),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 206/258 (80%), Positives = 224/258 (87%), Gaps = 2/258 (1%)
 Frame = +2

Query  287   SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKV  466
             S D LNW AAAEA+KGSHL+EVKRMVEEYRK  V LGGETLTI+QVAA+A+Q G   VKV
Sbjct  33    SGDALNWGAAAEAMKGSHLEEVKRMVEEYRKPAVNLGGETLTISQVAAIASQDGG--VKV  90

Query  467   ELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGI  646
             ELSEAAR GVKASSDWVM  M+ GTDSYGVTTGFGATSHRRTKQG A QKELIRFLNAGI
Sbjct  91    ELSEAAREGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGVAFQKELIRFLNAGI  150

Query  647   FGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTI  826
             FGNG ESCHTL H+ T A +LVRINTLLQGYSGIRFEILEA+TKLLN N+TPCLPLRGT+
Sbjct  151   FGNGTESCHTLPHTTTGAALLVRINTLLQGYSGIRFEILEAMTKLLNGNVTPCLPLRGTV  210

Query  827   TASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMAN  1006
             TASGDL PLSYI GL+TGR NSKAVGPNGE+L A +AF+ AGI SGFFELQPKE LA+ N
Sbjct  211   TASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSGFFELQPKEGLALVN  270

Query  1007  GTADGSRLACMVLYEANI  1060
             GTA GS LA MVL++ANI
Sbjct  271   GTAVGSGLASMVLFDANI  288



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   395 bits (1016),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 202/256 (79%), Positives = 217/256 (85%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AA++LKGSHLDEVKRMV+EYR+  VKLGGE+LTI QV A+AA      VKVEL
Sbjct  29    DPLNWTVAADSLKGSHLDEVKRMVDEYRRPVVKLGGESLTIGQVTAIAAHDSG--VKVEL  86

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             +EAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLN+GIFG
Sbjct  87    AEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNSGIFG  146

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES HTL HS TRA MLVR+NTLLQGYSGIRFEILE ITK LNHNITPCLPLRGTITA
Sbjct  147   NGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNITPCLPLRGTITA  206

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNG+ L+  EAF  AG+ SGFFELQPKE LA+ NGT
Sbjct  207   SGDLVPLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVTSGFFELQPKEGLALVNGT  266

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA  VL+EANI
Sbjct  267   AVGSGLAATVLFEANI  282



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   395 bits (1015),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 233/284 (82%), Gaps = 16/284 (6%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENGNG+         C++++       DPL+W  AAEALKGSHL+EVKRMV EYRK  VK
Sbjct  9     ENGNGV-------DLCMKKE-------DPLSWGVAAEALKGSHLEEVKRMVAEYRKPVVK  54

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLTI+QVAA++A+  +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  55    LGGETLTISQVAAISARDDS-GVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFG  113

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAES-CHTLTHSVTRADMLVRINTLLQGYSGI  748
             ATSHRRTKQG ALQKELIRFLNAGIFG+GAE+  +TL HS TRA MLVRINTLLQGYSGI
Sbjct  114   ATSHRRTKQGGALQKELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGI  173

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G  L  
Sbjct  174   RFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSP  233

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EEAF+ AG+E GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  234   EEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  277



>gb|KGN52973.1| hypothetical protein Csa_4G008760 [Cucumis sativus]
Length=438

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 201/270 (74%), Positives = 223/270 (83%), Gaps = 9/270 (3%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTI  415
             NG     C       ++  DPLNW  AAE++KGSHLDEVKRMVEEYR+  VKLGGETLTI
Sbjct  10    NGSVETLC-------NTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTI  62

Query  416   aqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTK  595
             +QVAA+A +    +V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT 
Sbjct  63    SQVAAIATRDN--DVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTN  120

Query  596   QGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAIT  775
             QG ALQKELIRFLN+GIFGNG+ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGGALQKELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  776   KLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGI  955
              LLNHN+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA+GPNGE LDA+ AF +AGI
Sbjct  181   NLLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFTQAGI  240

Query  956   ESGFFELQPKERLAMANGTADGSRLACMVL  1045
             +SGFFELQPKE LA+ NGTA  S++A  VL
Sbjct  241   DSGFFELQPKEGLALVNGTAVVSQVAKKVL  270



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   395 bits (1015),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 202/278 (73%), Positives = 230/278 (83%), Gaps = 3/278 (1%)
 Frame = +2

Query  236   NGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             NGH +G  V  E  +++ + HDPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGGETL
Sbjct  4     NGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETL  63

Query  410   TIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             T+AQVA++A        VKVELSE++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  64    TVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHR  123

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTK G ALQKELIRFLNAG+FGNG E  HTL HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  124   RTKNGGALQKELIRFLNAGVFGNGTELSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  183

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKL+N NITPCLPLRG+ITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEA R 
Sbjct  184   AITKLINSNITPCLPLRGSITASGDLVPLSYIVGLLTGRPNSKAVGPNGEKLNAEEALRV  243

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AG+  GFFELQPKE LA+ NGTA  S +A +V++E+NI
Sbjct  244   AGVSGGFFELQPKEGLALVNGTAVASGMASIVVFESNI  281



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   395 bits (1015),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 206/256 (80%), Positives = 223/256 (87%), Gaps = 3/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QVAA+AA  G     VEL
Sbjct  35    DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDGA---TVEL  91

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  92    SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  151

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITA
Sbjct  152   NGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITA  211

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR+NSKA GP+GE L+A+EAF+ AGI + FFELQPKE LA+ NGT
Sbjct  212   SGDLVPLSYIAGLLTGRSNSKAHGPSGEMLNAKEAFQLAGINAEFFELQPKEGLALVNGT  271

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  272   AVGSGLASIVLFEANI  287



>gb|ACR15762.1| phenylalanine ammonia-lyase [Litchi chinensis]
Length=723

 Score =   395 bits (1015),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 211/280 (75%), Positives = 225/280 (80%), Gaps = 5/280 (2%)
 Frame = +2

Query  221   NGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             NG +S G     C           DPLNW   AEALKGSHL+EV RMVEE+R+  VK GG
Sbjct  12    NGGVS-GLLKSLCTSGNGDHHQKQDPLNWGVMAEALKGSHLEEVMRMVEEFRRPVVKFGG  70

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLTI+QVAA+AA      VKVELSE+AR GVKASSDWVM  M NGTD YGVTTG GATS
Sbjct  71    ETLTISQVAAIAANEAG--VKVELSESAREGVKASSDWVMDSMNNGTDCYGVTTGSGATS  128

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTKQGAALQ+ELIRFLNAG+FGNG ESCHTL HS TRA MLVRINTLLQGYSGIRFEI
Sbjct  129   HRRTKQGAALQRELIRFLNAGVFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEI  188

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE LDA+EA 
Sbjct  189   LEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLDAKEAS  248

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +RAG   GFFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  249   QRAGF--GFFELQPKEGLALVNGTAVGSGLASMVLFEANI  286



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   395 bits (1015),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 217/256 (85%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AA++LKGSHLDEVKRM++EYR+  VKLGGE+LTI QV A+AA      VKVEL
Sbjct  29    DPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLTIGQVTAIAAHDSG--VKVEL  86

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             +EAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLN+GIFG
Sbjct  87    AEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNSGIFG  146

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES HTL HS TRA MLVR+NTLLQGYSGIRFEILE ITK LNHNITPCLPLRGTITA
Sbjct  147   NGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNITPCLPLRGTITA  206

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNG+ L+  EAF  AG+ SGFFELQPKE LA+ NGT
Sbjct  207   SGDLVPLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVTSGFFELQPKEGLALVNGT  266

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA  VL+EANI
Sbjct  267   AVGSGLAATVLFEANI  282



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   395 bits (1014),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 212/277 (77%), Positives = 230/277 (83%), Gaps = 3/277 (1%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSH-DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +NGH      E +   S +  DPLNW  AAEALKGSHLDEVKRMVEEYR   VK+GGETL
Sbjct  6     ANGHVSNHVTEAEYCISKAGGDPLNWGVAAEALKGSHLDEVKRMVEEYRNPVVKIGGETL  65

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TIAQVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRR
Sbjct  66    TIAQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  123

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  124   TKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  183

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF+ A
Sbjct  184   ITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQLA  243

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              I S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  244   NIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANV  280



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   388 bits (997),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 222/269 (83%), Gaps = 11/269 (4%)
 Frame = +2

Query  254   FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaav  433
             FCV+         DPLNW  AAE++ GSHLDEVKRMV EYRK  V LGGETLTI+QVAA+
Sbjct  12    FCVKG--------DPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAI  63

Query  434   aaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQ  613
             AA  G   VKVELSE+ RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  64    AAADG---VKVELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQ  120

Query  614   KELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHN  793
             KELIRFLNAGIFG+G ESCHTL HS TRA +LVRINTLLQGYSGIRFEILEA+ KLLN+N
Sbjct  121   KELIRFLNAGIFGHGTESCHTLPHSSTRAGLLVRINTLLQGYSGIRFEILEAMAKLLNNN  180

Query  794   ITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFE  973
             +TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE+L A+EAF+ A I S FFE
Sbjct  181   VTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTAKEAFKVADINSSFFE  240

Query  974   LQPKERLAMANGTADGSRLACMVLYEANI  1060
             LQPKE LA+ NGTA GS +A  VL+EANI
Sbjct  241   LQPKEGLALVNGTAVGSGVASTVLFEANI  269



>gb|KHN09507.1| Phenylalanine ammonia-lyase 1 [Glycine soja]
Length=701

 Score =   394 bits (1011),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/278 (73%), Positives = 221/278 (79%), Gaps = 21/278 (8%)
 Frame = +2

Query  230   ISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I+NG  +G FC+   + +S   DPLNW AAAEA+KGSHLDEVKRMV EYRK  V+LGGE 
Sbjct  6     ITNGSQNGSFCLSTTKGSS---DPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGEG  62

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
                              V VELSE+AR GVKASS+WVM  M NGTDSYGVTTGFGATSHR
Sbjct  63    -----------------VAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHR  105

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILE
Sbjct  106   RTKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILE  165

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF  
Sbjct  166   AITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFEL  225

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             A I S FFELQPKE LA+ NGTA GS LA MVL+EANI
Sbjct  226   ASINSEFFELQPKEGLALVNGTAVGSGLASMVLFEANI  263



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   396 bits (1018),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 211/278 (76%), Positives = 230/278 (83%), Gaps = 13/278 (5%)
 Frame = +2

Query  236   NGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             NGH    +GFCV+Q       +DPLNW  AAE+LKGSHLDEVKRMV E+RK  VKLGGET
Sbjct  85    NGHHAAGNGFCVQQ-------NDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVKLGGET  137

Query  407   LTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHR  586
             LTI+QVAA+AA+     V VEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHR
Sbjct  138   LTISQVAAIAARDNA--VAVELNESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHR  195

Query  587   RTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILE  766
             RTKQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILE
Sbjct  196   RTKQGGALQKELIRFLNAGIFGNGTESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  255

Query  767   AITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRR  946
             AITK LN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE L A EAF+ 
Sbjct  256   AITKFLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGETLTAVEAFKL  315

Query  947   AGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AG++ GFFELQPKE LA+ NGTA GS LA + LYEAN+
Sbjct  316   AGVD-GFFELQPKEGLALVNGTAVGSGLASIALYEANV  352



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 207/283 (73%), Positives = 229/283 (81%), Gaps = 20/283 (7%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENGNG   NGH                DPL+W  AA+++KGSHLDEVKRMV E+R+  ++
Sbjct  6     ENGNG---NGHV-------------IKDPLSWELAADSMKGSHLDEVKRMVREFRQPAIR  49

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLTI+QVAAVAA      + VELSEAARA V+ASS+WVM  M  GTDSYGVTTGFG
Sbjct  50    LGGETLTISQVAAVAAGC----LPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFG  105

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIR  751
             ATSHRRTKQG ALQKELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGIR
Sbjct  106   ATSHRRTKQGGALQKELIRFLNAGIFGNGTESCHTLPHSSTRAAMLVRINTLLQGYSGIR  165

Query  752   FEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAE  931
             FEILEA+TKL+NHNITPCLPLRGTITASGDL PLSYI G++TGR NSK VGP GE LDA 
Sbjct  166   FEILEALTKLINHNITPCLPLRGTITASGDLVPLSYIAGVLTGRPNSKCVGPTGEPLDAT  225

Query  932   EAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EAFRRAGI+ GFFELQPKE LA+ NGTA GS LA +VL++AN+
Sbjct  226   EAFRRAGIDGGFFELQPKEGLALVNGTAVGSGLASIVLFDANV  268



>gb|AJW77399.1| phenylalanine ammonia-lyase [Angelica sinensis]
Length=718

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/285 (74%), Positives = 235/285 (82%), Gaps = 6/285 (2%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             M   NG  +NGHA+G  ++   +   + +PLNW  AAEAL GSHLDEVKRMV EYRK  V
Sbjct  1     MAYANGT-TNGHANGNGIDLCMK---NEEPLNWGVAAEALTGSHLDEVKRMVAEYRKPVV  56

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             KLGGETLTI+QVAA++A+  +  VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  57    KLGGETLTISQVAAISARDDS-GVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGF  115

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAES-CHTLTHSVTRADMLVRINTLLQGYSG  745
             GATSHRRTKQG ALQKELIRFLNAGIFG+GA++  +TL HS TRA MLVRINTLLQGYSG
Sbjct  116   GATSHRRTKQGGALQKELIRFLNAGIFGSGAQAGNNTLPHSATRAAMLVRINTLLQGYSG  175

Query  746   IRFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALD  925
             IRFEILEAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G  L 
Sbjct  176   IRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLS  235

Query  926   AEEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              EEAF+ AG+E GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  236   PEEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  280



>gb|AAX22053.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22054.1| phenylalanine ammonia-lyase [Brassica napus]
Length=724

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/265 (76%), Positives = 224/265 (85%), Gaps = 2/265 (1%)
 Frame = +2

Query  266   QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  445
             +K + + + DPLNW AAAE +KGSHLDEVKRMVE+YRK  V LGGETLTI QVAA++  G
Sbjct  24    EKTKVTVAADPLNWGAAAEQMKGSHLDEVKRMVEDYRKPVVNLGGETLTIGQVAAISNVG  83

Query  446   gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  625
             G   VKVEL+EA+RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQ ELI
Sbjct  84    GG--VKVELAEASRAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGTALQTELI  141

Query  626   RFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  805
             RFLNAGIFGN  E+CHTL  S TRA MLVR+NTLLQGYSGIRFEILEAIT LLNHNI+P 
Sbjct  142   RFLNAGIFGNTKETCHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPS  201

Query  806   LPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPK  985
             LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE+L AEEAF++AGI SGFF+LQPK
Sbjct  202   LPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGESLTAEEAFKKAGITSGFFDLQPK  261

Query  986   ERLAMANGTADGSRLACMVLYEANI  1060
             E LA+ NGTA GS +A MVL+EAN+
Sbjct  262   EGLALVNGTAVGSGMASMVLFEANV  286



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   394 bits (1011),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 209/277 (75%), Positives = 230/277 (83%), Gaps = 3/277 (1%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRAS-SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +N     FCV        S++DPLNW AAAEA+ GSHLDEVKRM+EEYR+  VKLGGETL
Sbjct  5     ANAANTNFCVNVSNNGYISANDPLNWGAAAEAMAGSHLDEVKRMLEEYRRPVVKLGGETL  64

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TI+QVAA+AA      VKVEL+E++RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  65    TISQVAAIAAHDQG--VKVELAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  122

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQGAALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  123   TKQGAALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEA  182

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF  A
Sbjct  183   ITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFELA  242

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              I + FFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  243   NIGAEFFELQPKEGLALVNGTAVGSGLASIVLFEANI  279



>ref|XP_003556238.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Glycine max]
Length=717

 Score =   394 bits (1011),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 232/284 (82%), Gaps = 5/284 (2%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             ME    I+SNG+A+G         + S DPLNW  AAEALKGSHLDEVKRMVE+YR   V
Sbjct  1     MEYSKEILSNGNANG----SLNLCNGSTDPLNWGMAAEALKGSHLDEVKRMVEDYRNPVV  56

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             KLGG++LT++QVAAVA +     V VEL++  R GVKASSDWVM  M  GTDSYGVTTGF
Sbjct  57    KLGGKSLTVSQVAAVATRHHG-GVTVELAKETRHGVKASSDWVMDSMVKGTDSYGVTTGF  115

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQGAALQ ELIRFLNAGIFGNG ESCHTL HS TRA MLVRINTLLQGYSGI
Sbjct  116   GATSHRRTKQGAALQNELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGI  175

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEI+EAI+K LNHNITPCLPLRGTITASGDL PLSY+ GL+ GR NSK++GPNG+ L+A
Sbjct  176   RFEIMEAISKFLNHNITPCLPLRGTITASGDLVPLSYVAGLLIGRPNSKSIGPNGQVLNA  235

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +EAF+ AGI+ GFFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  236   KEAFQLAGIDGGFFELQPKEGLALVNGTAVGSGLASVVLFEANL  279



>gb|AGU91428.1| phenylalanine ammonia-lyase [Chrysanthemum boreale]
Length=709

 Score =   393 bits (1010),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 205/277 (74%), Positives = 227/277 (82%), Gaps = 6/277 (2%)
 Frame = +2

Query  230   ISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             + NGHA+G   E   +     DPLNW  AAEAL GSHLDEVK+MV E+RK  VKLGGETL
Sbjct  1     MDNGHANGVAKELCIK-----DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETL  55

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             T++QVA +AA      VKVEL+E+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRR
Sbjct  56    TVSQVAGIAASENA-GVKVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRR  114

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TK G ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  115   TKNGGALQKELIRFLNAGIFGNGTESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  174

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITK LN N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+G+ L+AE+AF  A
Sbjct  175   ITKFLNTNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGQILNAEKAFSLA  234

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             G++ GFFELQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  235   GVDGGFFELQPKEGLALVNGTAVGSGMASMVLFEANV  271



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   394 bits (1011),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 211/281 (75%), Positives = 231/281 (82%), Gaps = 13/281 (5%)
 Frame = +2

Query  233   SNGHAHG----FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             +NGHA+G     C++++       DPLNW  AAEAL GSHLDEVKRMV EYRK  VKL G
Sbjct  8     TNGHANGNGLDLCMKKE-------DPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLEG  60

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLTI+QVAA++A+  +  VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  61    ETLTISQVAAISARDDS-GVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATS  119

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAES-CHTLTHSVTRADMLVRINTLLQGYSGIRFE  757
             HRRTKQG ALQKELIRFLNAGIFG+GAE+  +TL HS TRA MLVRINTLLQGYSGIRFE
Sbjct  120   HRRTKQGGALQKELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGIRFE  179

Query  758   ILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEA  937
             ILEAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G  L  EEA
Sbjct  180   ILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEA  239

Query  938   FRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             F+ AG+E GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  240   FKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  280



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   393 bits (1010),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 223/273 (82%), Gaps = 6/273 (2%)
 Frame = +2

Query  254   FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3     FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63    VTAIASRDVG--VVVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
               LQKELIRFLNAGIFGNG ES HTL  S TRA MLVRINTLLQGYSGIRFE+LEAITKL
Sbjct  121   GELQKELIRFLNAGIFGNGTESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKL  180

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L   EAF +A I+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPHGEPLSPAEAFTQARIDG  240

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASMVLFEANV  273



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   393 bits (1010),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 205/273 (75%), Positives = 221/273 (81%), Gaps = 6/273 (2%)
 Frame = +2

Query  254   FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYRK  VKLGGETLTI Q
Sbjct  3     FCQDSRNGNGSLGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQ  62

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63    VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
               LQKELIRFLNAGIFGN  ES HTL  S TRA MLVR NTLLQGYSGIRFE+LEAITKL
Sbjct  121   GELQKELIRFLNAGIFGNDTESSHTLPRSATRAAMLVRFNTLLQGYSGIRFEMLEAITKL  180

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L   EAF +AGI+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDG  240

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA MVL+E N+
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASMVLFETNV  273



>gb|AFF60415.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=639

 Score =   391 bits (1004),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 216/256 (84%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AA++LKGSHLDEVKRMV EYRK  VKLGGE+LTI+QVAA+A       VKVEL
Sbjct  9     DPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTG--VKVEL  66

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG+FG
Sbjct  67    SESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGVFG  126

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +  ES HTL H  TRA MLVRINTLLQGYSGIRFEILEAITK LN+N+TPCLPLRGTITA
Sbjct  127   SATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVTPCLPLRGTITA  186

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNG+ L+A EAF   GI SGFFELQPKE LA+ NGT
Sbjct  187   SGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSGFFELQPKEGLALVNGT  246

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA  VL+E NI
Sbjct  247   AVGSGLASTVLFETNI  262



>ref|XP_010553331.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Tarenaya hassleriana]
Length=725

 Score =   394 bits (1011),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 204/265 (77%), Positives = 219/265 (83%), Gaps = 2/265 (1%)
 Frame = +2

Query  266   QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  445
             +K   S + DPLNW  AAE +KGSHLDEVKRMVEE+R+  V+LGGETLTI QVAA+A+  
Sbjct  25    EKLCESPTADPLNWGVAAEQMKGSHLDEVKRMVEEHRRPVVRLGGETLTIGQVAAIASAV  84

Query  446   gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  625
                 VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELI
Sbjct  85    DG--VKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELI  142

Query  626   RFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  805
             RFLNAGIFG+  E  HTL  S TRA MLVRINTLLQGYSGIRFEILEAIT LLNHNI PC
Sbjct  143   RFLNAGIFGSATEKSHTLPQSTTRAAMLVRINTLLQGYSGIRFEILEAITSLLNHNIAPC  202

Query  806   LPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPK  985
             LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE L AEEAFR AGI SGFF+LQPK
Sbjct  203   LPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLTAEEAFRSAGITSGFFDLQPK  262

Query  986   ERLAMANGTADGSRLACMVLYEANI  1060
             E LA+ NGTA GS LA MVL++AN+
Sbjct  263   EGLALVNGTAVGSGLASMVLFDANV  287



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   393 bits (1010),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 232/284 (82%), Gaps = 16/284 (6%)
 Frame = +2

Query  212   ENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
             ENGNG+         C++++       DPL+W  AAEAL GSHL+EVKRMV EYRK  VK
Sbjct  9     ENGNGV-------DLCMKKE-------DPLSWGVAAEALTGSHLEEVKRMVAEYRKPVVK  54

Query  392   LGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFG  571
             LGGETLTI+QVAA++A+  +  VKVELSEAARAGVKASSDWVM  M  GTDSYGVTTGFG
Sbjct  55    LGGETLTISQVAAISARDDS-GVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFG  113

Query  572   ATSHRRTKQGAALQKELIRFLNAGIFGNGAES-CHTLTHSVTRADMLVRINTLLQGYSGI  748
             ATSHRRTKQG ALQKELIRFLNAGIFG+GAE+  +TL HS TRA MLVRINTLLQGYSGI
Sbjct  114   ATSHRRTKQGGALQKELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGI  173

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LNHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP G  L  
Sbjct  174   RFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSP  233

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EEAF+ AG+E GFFELQPKE LA+ NGTA GS +A MVL+EANI
Sbjct  234   EEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANI  277



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   393 bits (1010),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 209/276 (76%), Positives = 232/276 (84%), Gaps = 4/276 (1%)
 Frame = +2

Query  236   NGHAHGFCVEQKRRAS-SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLT  412
             NG+ + FC+        S++DPLNW AAAEA+ GSHLDEVKRMVEEYR+  VKLGGETLT
Sbjct  6     NGNTN-FCMSVNNNGYISANDPLNWGAAAEAMAGSHLDEVKRMVEEYRRPVVKLGGETLT  64

Query  413   IaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRT  592
             I+QVAA+AA      VKVEL+E++RAGVKASSDWVM  M+ GTDSYGVTTGFGATSHRRT
Sbjct  65    ISQVAAIAAHDQG--VKVELAESSRAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRT  122

Query  593   KQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAI  772
             KQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEILEAI
Sbjct  123   KQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAI  182

Query  773   TKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAG  952
             TKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF  A 
Sbjct  183   TKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFELAN  242

Query  953   IESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             I + FFELQPKE LA+ NGTA GS LA +VL+EANI
Sbjct  243   ISAEFFELQPKEGLALVNGTAVGSGLASIVLFEANI  278



>gb|ABL14039.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   378 bits (970),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 203/271 (75%), Positives = 221/271 (82%), Gaps = 3/271 (1%)
 Frame = +2

Query  233   SNGHAHGFCVEQKRRASSSH-DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETL  409
             +NGHA     E +   S +  DPLNW  AAEALKGS LDEVKRMVEEYR   VK+GGETL
Sbjct  6     ANGHASSTANEAELCISKAGGDPLNWAVAAEALKGSLLDEVKRMVEEYRNPVVKIGGETL  65

Query  410   TIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRR  589
             TI+QVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRR
Sbjct  66    TISQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  123

Query  590   TKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEA  769
             TKQG ALQKE IRFLNAGIFGNG ES +TL HS TRA MLVRINTLLQGYSGIRFEILEA
Sbjct  124   TKQGGALQKEFIRFLNAGIFGNGTESNYTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  183

Query  770   ITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRA  949
             ITKLLNHN+T CLPLRGTITASGD  PLSYI GL+TGR NSKAVGP GE L+A+EAF+ A
Sbjct  184   ITKLLNHNVTSCLPLRGTITASGDFVPLSYIAGLLTGRPNSKAVGPYGEILNAKEAFQLA  243

Query  950   GIESGFFELQPKERLAMANGTADGSRLACMV  1042
              I + F+ELQPKE LA+ NGTA GS LA +V
Sbjct  244   NIGTEFYELQPKEGLALVNGTAVGSGLASIV  274



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   393 bits (1009),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 204/273 (75%), Positives = 222/273 (81%), Gaps = 6/273 (2%)
 Frame = +2

Query  254   FCVEQKRRASS----SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaq  421
             FC + +    S    ++DPLNW  AAE+LKGSHLDEVKRM+EEYR   VKLGGETLTI Q
Sbjct  3     FCQDSRNGNGSPGFNTNDPLNWGMAAESLKGSHLDEVKRMIEEYRNPVVKLGGETLTIGQ  62

Query  422   vaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQG  601
             V A+A++     V VELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG
Sbjct  63    VTAIASRDVG--VMVELSEEARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQG  120

Query  602   AALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKL  781
               LQKELIRFLNAGIFGNG ES HTL  S TRA MLVR NTLLQGYSGIRFE+LEAITK+
Sbjct  121   GELQKELIRFLNAGIFGNGTESSHTLPRSATRAAMLVRTNTLLQGYSGIRFEMLEAITKM  180

Query  782   LNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIES  961
             +NHNITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGPNGE L   EAF +AGI+ 
Sbjct  181   INHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLTPAEAFTQAGIDG  240

Query  962   GFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             GFFELQPKE LA+ NGTA GS LA MVL+EAN+
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASMVLFEANV  273



>gb|ADY02661.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=673

 Score =   392 bits (1006),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 217/256 (85%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW AAAE +KGSHLDEVKRMVEE+R+  V LGGETLTI QVAA++  G    VKVEL
Sbjct  2     DPLNWGAAAEQMKGSHLDEVKRMVEEFRRPFVNLGGETLTIGQVAAISTVGNG--VKVEL  59

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIRFLNAGIFG
Sbjct  60    SETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFG  119

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +  E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLRGTITA
Sbjct  120   STKETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITA  179

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA GPNGEAL+AEEAF+ AGI SGFF+LQPKE LA+ NGT
Sbjct  180   SGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGISSGFFDLQPKEGLALVNGT  239

Query  1013  ADGSRLACMVLYEANI  1060
             A GS +A MVL+E N+
Sbjct  240   AVGSGMASMVLFETNV  255



>gb|ADA81868.1| phenylalanine ammonia-lyase [Brassica rapa subsp. chinensis]
Length=721

 Score =   393 bits (1009),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 209/282 (74%), Positives = 227/282 (80%), Gaps = 9/282 (3%)
 Frame = +2

Query  236   NGHAHGFCV-------EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NG +HG  V       E K    ++ DPLNW AAAE +KGSHLDEVKRMV E+RK  V L
Sbjct  4     NGLSHGGEVDAMLCGGEIKNVTVAAADPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNL  63

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTI QVAA++  G    VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGA
Sbjct  64    GGETLTIGQVAAISTVGNG--VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGA  121

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTK G ALQKELIRFLNAGIFG+  E+CHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  122   TSHRRTKNGVALQKELIRFLNAGIFGSTKETCHTLPHSATRAAMLVRINTLLQGYSGIRF  181

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAIT  LN NITP LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGEAL+AEE
Sbjct  182   EILEAITSFLNTNITPSLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEE  241

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF++AGI SGFF+LQPKE LA+ NGTA GS +A MVL+EAN+
Sbjct  242   AFKKAGIPSGFFDLQPKEGLALVNGTAVGSGMASMVLFEANV  283



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   393 bits (1009),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 233/284 (82%), Gaps = 8/284 (3%)
 Frame = +2

Query  212   ENGNGIISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             E  NG +SN      FC+ +     +  DPLNW AAAEALKGSHLDEVKRMVEEYR   V
Sbjct  4     EGANGHVSNHATEAEFCISK-----TGGDPLNWGAAAEALKGSHLDEVKRMVEEYRNPVV  58

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             K+GGETLTIAQVA +A+  G   VKVELSE+ARAGVKASSDWVM  M NGTDSYGVTTGF
Sbjct  59    KIGGETLTIAQVAGIASHDGG--VKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGF  116

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRT+QG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGI
Sbjct  117   GATSHRRTRQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGI  176

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITKLLN+NIT CLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A
Sbjct  177   RFEILEAITKLLNNNITSCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNA  236

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             +EAF+ A I S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  237   KEAFQLANIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANV  280



>ref|XP_009103852.1| PREDICTED: phenylalanine ammonia-lyase 2-like [Brassica rapa]
Length=718

 Score =   393 bits (1009),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 201/265 (76%), Positives = 222/265 (84%), Gaps = 2/265 (1%)
 Frame = +2

Query  266   QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  445
             +K   + + DPLNW AAAE +KGSHLDEVKRMVEEYR+  V LGGETLTI QVAA++  G
Sbjct  18    EKTNVAVAADPLNWGAAAEQMKGSHLDEVKRMVEEYRRPVVNLGGETLTIGQVAAISTVG  77

Query  446   gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  625
                 VKVEL+EA+RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQ ELI
Sbjct  78    NG--VKVELAEASRAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQTELI  135

Query  626   RFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  805
             RFLNAGIFGN  E+CHTL  S TRA MLVR+NTLLQGYSGIRFEILEAIT LLNHNI+P 
Sbjct  136   RFLNAGIFGNTKETCHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPS  195

Query  806   LPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPK  985
             LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE+L AEEAF++AGI SGFF+LQPK
Sbjct  196   LPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGESLTAEEAFKQAGIASGFFDLQPK  255

Query  986   ERLAMANGTADGSRLACMVLYEANI  1060
             E LA+ NGTA GS +A MVL+EAN+
Sbjct  256   EGLALVNGTAVGSGMASMVLFEANV  280



>gb|AAZ29734.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   393 bits (1009),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 204/256 (80%), Positives = 221/256 (86%), Gaps = 3/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QVAA+AA  G     VEL
Sbjct  35    DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDGA---TVEL  91

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDW+M  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  92    SESARAGVKASSDWIMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  151

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES H L H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITA
Sbjct  152   NGTESNHILPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITA  211

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA GP+GE L+A+EAF+ AGI + FFELQPKE LA+ NGT
Sbjct  212   SGDLVPLSYIAGLLTGRPNSKAHGPSGEILNAKEAFQLAGINADFFELQPKEGLALVNGT  271

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  272   AVGSGLASIVLFEANI  287



>gb|ADY02660.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   392 bits (1006),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 217/256 (85%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW AAAE +KGSHLDEVKRMVEE+R+  V LGGETLTI QVAA++  G    VKVEL
Sbjct  2     DPLNWGAAAEQMKGSHLDEVKRMVEEFRRPFVNLGGETLTIGQVAAISTVGNG--VKVEL  59

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIRFLNAGIFG
Sbjct  60    SETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFG  119

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +  E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLRGTITA
Sbjct  120   STKETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITA  179

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA GPNGEAL+AEEAF+ AGI SGFF+LQPKE LA+ NGT
Sbjct  180   SGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGISSGFFDLQPKEGLALVNGT  239

Query  1013  ADGSRLACMVLYEANI  1060
             A GS +A MVL+E N+
Sbjct  240   AVGSGMASMVLFETNV  255



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   392 bits (1008),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 228/279 (82%), Gaps = 2/279 (1%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I  NGH +G  V       S +DPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGGET
Sbjct  5     IAQNGHINGE-VAMDLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  63

Query  407   LTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             L++AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVT GFGATSH
Sbjct  64    LSVAQVASIANVDDKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSH  123

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQKELIRFLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  124   RRTKNGGALQKELIRFLNAGVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  183

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+N NITPCLPLRGTITASGD+ PLSYI GL+TGR NSKAV PNGE L+AEEAF 
Sbjct  184   EAITKLINSNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVRPNGEKLNAEEAFC  243

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              AGI SGFFELQPKE LA+ NGTA GS +A +VL+E+NI
Sbjct  244   VAGISSGFFELQPKEGLALVNGTAVGSAMASIVLFESNI  282



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   392 bits (1006),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 200/260 (77%), Positives = 221/260 (85%), Gaps = 1/260 (0%)
 Frame = +2

Query  284   SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPE-V  460
             S +DPLNW  AA++L+GSHLDEVK+MV+E+RK  VKLGGETL++AQVA++A        V
Sbjct  7     SINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDDKSNGV  66

Query  461   KVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNA  640
             KVELSE+ARAGVKASSDWVM  M  GTDSYGVT GFGATSHRRTK G ALQKELIRFLNA
Sbjct  67    KVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELIRFLNA  126

Query  641   GIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  820
             G+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEILEAITKL+N NITPCLPLRG
Sbjct  127   GVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRG  186

Query  821   TITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAM  1000
             TITASGDL PLSYI GL+TGR NSKAVGPNGE L+AEEAF  AGI  GFFELQPKE LA+
Sbjct  187   TITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFCVAGISGGFFELQPKEGLAL  246

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS +A +VL+E+NI
Sbjct  247   VNGTAVGSAMASIVLFESNI  266



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   392 bits (1007),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 208/280 (74%), Positives = 231/280 (83%), Gaps = 8/280 (3%)
 Frame = +2

Query  224   GIISNGHAHG-FCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             G +SNGHA   FC+ +     +  DPLNW  AA+++KGSHLDEVKRMVEEYR   V++GG
Sbjct  5     GALSNGHAQPTFCLTK-----TLPDPLNWGVAADSMKGSHLDEVKRMVEEYRNPIVRIGG  59

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLTIAQVA +A+      V+VELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  60    ETLTIAQVAGIASHDSG--VRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATS  117

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTKQG ALQKELIRFLNAGIFGNG ES  TL H+ TRA MLVRINTLLQGYSGIRFEI
Sbjct  118   HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEI  177

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITKLLN+NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP+GE L+A+EAF
Sbjct  178   LEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAF  237

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
               A I S FFELQPKE LA+ NGTA GS LA +VL+EAN+
Sbjct  238   ELASIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANV  277



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 230/284 (81%), Gaps = 3/284 (1%)
 Frame = +2

Query  218   GNGIISNGHAHGFCV--EQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVK  391
              + I  NGH +G  V  E  +++ + HDPLNW  AAE+L+GSHLDEVK+MV+E+RK  VK
Sbjct  2     ASSIAQNGHVNGEVVAMELCKKSINVHDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  61

Query  392   LGGETLTIaqvaavaaqggTPE-VKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             L GETLT+AQVA++A        VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGF
Sbjct  62    LEGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  121

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             G TSHRRTK G ALQK+LIRFLNAG+FGNG E  HTL HS TRA MLVRINTLLQGYSGI
Sbjct  122   GDTSHRRTKNGNALQKDLIRFLNAGVFGNGTELSHTLPHSATRAAMLVRINTLLQGYSGI  181

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITKL+N NITPCLPLRG+ITASGDL PLSYI GL+TGR NSKAVGPNGE L+A
Sbjct  182   RFEILEAITKLINSNITPCLPLRGSITASGDLVPLSYIVGLLTGRPNSKAVGPNGEKLNA  241

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EEA R AG+  GFFELQPKE LA+ NGTA  S +A +V++E+NI
Sbjct  242   EEALRVAGVSGGFFELQPKEGLALVNGTAVASGMASIVVFESNI  285



>gb|ADY02662.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   391 bits (1005),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/256 (78%), Positives = 217/256 (85%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW AAAE +KGSHLDEVKRMVEE+R+  V LGGETLTI QVAA++  G    VKVEL
Sbjct  2     DPLNWGAAAEQMKGSHLDEVKRMVEEFRRPFVNLGGETLTIGQVAAISTVGNG--VKVEL  59

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQKELIRFLNAGIFG
Sbjct  60    SETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFG  119

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +  E+CHTL HS TRA MLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLRGTITA
Sbjct  120   STKETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITA  179

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA GPNGEAL+AE+AF+ AGI SGFF+LQPKE LA+ NGT
Sbjct  180   SGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEZAFKMAGISSGFFDLQPKEGLALVNGT  239

Query  1013  ADGSRLACMVLYEANI  1060
             A GS +A MVL+E N+
Sbjct  240   AVGSGMASMVLFETNV  255



>gb|AAZ29732.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=724

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/256 (80%), Positives = 221/256 (86%), Gaps = 3/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QVAA+AA  G     VEL
Sbjct  34    DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDGA---TVEL  90

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  91    SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  150

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES H L H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITA
Sbjct  151   NGTESNHILPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITA  210

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA GP+GE L+A+EAF+ AGI + FFELQPKE LA+ NGT
Sbjct  211   SGDLVPLSYIAGLLTGRPNSKAHGPSGEILNAKEAFQLAGINADFFELQPKEGLALVNGT  270

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  271   AVGSGLASIVLFEANI  286



>ref|XP_009143533.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=719

 Score =   392 bits (1006),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/280 (74%), Positives = 225/280 (80%), Gaps = 7/280 (3%)
 Frame = +2

Query  236   NGHAHG----FC-VEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             NG +H      C  E K    ++ DPLNW AAAE +KGSHLDEVKRMV E+RK  V LGG
Sbjct  4     NGSSHKVDAMLCGAEIKNVTVAAADPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNLGG  63

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLTI QVAA++  G    VKVELSE ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  64    ETLTIGQVAAISTVGNG--VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATS  121

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTK G ALQKELIRFLNAGIFG+  E+CHTL HS TRA MLVRINTLLQGYSGIRFEI
Sbjct  122   HRRTKNGVALQKELIRFLNAGIFGSTKETCHTLPHSATRAAMLVRINTLLQGYSGIRFEI  181

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAIT  LN NITP LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGEAL+AEEAF
Sbjct  182   LEAITSFLNTNITPSLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAF  241

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             ++AGI SGFF+LQPKE LA+ NGTA GS +A MVL+E N+
Sbjct  242   KKAGIPSGFFDLQPKEGLALVNGTAVGSGMASMVLFETNV  281



>emb|CDX76219.1| BnaA04g04830D [Brassica napus]
Length=522

 Score =   385 bits (990),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/268 (75%), Positives = 224/268 (84%), Gaps = 5/268 (2%)
 Frame = +2

Query  266   QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  445
             +K + + + DPLNW AAAE +KGSHLDEVKRMVE+YRK  V LGGETLTI QVAA++  G
Sbjct  24    EKTKVTVAADPLNWGAAAEQMKGSHLDEVKRMVEDYRKPVVNLGGETLTIGQVAAISNVG  83

Query  446   gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  625
             G   VKVEL+EA+RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQ ELI
Sbjct  84    GG--VKVELAEASRAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGTALQTELI  141

Query  626   RFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  805
             RFLNAGIFGN  E+CHTL  S TRA MLVR+NTLLQGYSGIRFEILEAIT LLNHNI+P 
Sbjct  142   RFLNAGIFGNTKETCHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSLLNHNISPS  201

Query  806   LPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPK  985
             LPLRGTITASGDL PLSYI GL+TGR NSKA GP+GE+L AEEAF++AGI SGFF+LQPK
Sbjct  202   LPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPSGESLTAEEAFKKAGITSGFFDLQPK  261

Query  986   ERLAMA---NGTADGSRLACMVLYEANI  1060
             E LA+    NGTA GS +A MVL+EAN+
Sbjct  262   EGLALISQYNGTAVGSGMASMVLFEANV  289



>prf||2006271A Phe ammonia lyase
Length=725

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/256 (80%), Positives = 222/256 (87%), Gaps = 3/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGGETLTI+QVAA+AA  G     VEL
Sbjct  35    DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDGA---TVEL  91

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  92    SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  151

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITA
Sbjct  152   NGTESNHTLFHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITA  211

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TG +NSKA GP+GE L+A+EAF+ AGI + FFELQPKE LA+ NGT
Sbjct  212   SGDLVPLSYIAGLLTGPSNSKAHGPSGEMLNAKEAFQLAGINAEFFELQPKEGLALVNGT  271

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  272   AVGSGLASIVLFEANI  287



>ref|XP_008449235.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=702

 Score =   391 bits (1005),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 219/262 (84%), Gaps = 2/262 (1%)
 Frame = +2

Query  275   RASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTP  454
             + SS HDPLNW  AA++LKGSH DEVKRMVEEY +  V+L GETLTI+QVAA+A +  T 
Sbjct  5     KTSSIHDPLNWGVAADSLKGSHFDEVKRMVEEYERPRVQLDGETLTISQVAAIATR--TS  62

Query  455   EVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFL  634
             +V VELSE+ R GVKASSDW+M  +  GTDSYG+TTGFGATSHRRTKQG ALQKELIRFL
Sbjct  63    DVIVELSESTRLGVKASSDWIMESLNKGTDSYGITTGFGATSHRRTKQGEALQKELIRFL  122

Query  635   NAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPL  814
             NAGIF +G ES HTL+HS TRA MLVR NTLLQGYSGIRFEILEAITKLLNHNITPCLPL
Sbjct  123   NAGIFDSGTESSHTLSHSATRAAMLVRTNTLLQGYSGIRFEILEAITKLLNHNITPCLPL  182

Query  815   RGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERL  994
             RGT+TASGDL PLSYI GL+TGR NSKA GPNGE LDA+EAF  AGI SGFFE QPKE  
Sbjct  183   RGTVTASGDLVPLSYIAGLLTGRPNSKATGPNGENLDAKEAFIHAGITSGFFEFQPKEGF  242

Query  995   AMANGTADGSRLACMVLYEANI  1060
             A+ N TA GS LA +VL+EANI
Sbjct  243   ALVNSTAVGSGLASIVLFEANI  264



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   391 bits (1005),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 208/284 (73%), Positives = 227/284 (80%), Gaps = 16/284 (6%)
 Frame = +2

Query  209   MENGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATV  388
             +ENGNG         FC++         DPLNW  A+E++KGSHLDEVK MV E+RK  V
Sbjct  5     VENGNG-----KTMEFCMK---------DPLNWEMASESMKGSHLDEVKNMVAEFRKPVV  50

Query  389   KLGGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGF  568
             +L G+TLTI QVAA+AA+     V VEL+EAAR GVKASSDWVM  M  GTDSYGVTTGF
Sbjct  51    QLAGKTLTIGQVAAIAARDDG--VTVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGF  108

Query  569   GATSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGI  748
             GATSHRRTKQG ALQKELIRFLNAGIFGNG E+ HTL HS TRA MLVRINTLLQGYSGI
Sbjct  109   GATSHRRTKQGGALQKELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGI  168

Query  749   RFEILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDA  928
             RFEILEAITK LN NITPCLPLRGTITASGDL PLSYI GL+TGR NSKAVGP GE ++A
Sbjct  169   RFEILEAITKFLNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEKINA  228

Query  929   EEAFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             EEAFR AGI +GFFELQPKE LA+ NGTA GS +A MVLYEANI
Sbjct  229   EEAFRLAGISTGFFELQPKEGLALVNGTAVGSGMASMVLYEANI  272



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   392 bits (1006),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/256 (78%), Positives = 216/256 (84%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AA++LKGSHLDEVKRM++EYR+  VKLGGE+LTI QV A+AA      VKVEL
Sbjct  29    DPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLTIGQVTAIAAHDSG--VKVEL  86

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             +EAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLN+GIFG
Sbjct  87    AEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNSGIFG  146

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES HTL HS TRA MLVR+NTLLQGYSGIRFEILE ITK LNHNITPCLPLRGTITA
Sbjct  147   NGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITKFLNHNITPCLPLRGTITA  206

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVG NG+ L+  EAF  AG+ SGFFELQPKE LA+ NGT
Sbjct  207   SGDLVPLSYIAGLLTGRPNSKAVGSNGQVLNPTEAFNLAGVTSGFFELQPKEGLALVNGT  266

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA  VL+EANI
Sbjct  267   AVGSGLAATVLFEANI  282



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   392 bits (1006),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 226/279 (81%), Gaps = 2/279 (1%)
 Frame = +2

Query  227   IISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGET  406
             I  NGH +G  VE+     S HDPLNW  A ++L+GSHLDEVK+MV+E+RK  VKL GET
Sbjct  5     IAQNGHVNGE-VEEVLWKKSIHDPLNWEMAVDSLRGSHLDEVKKMVDEFRKPIVKLWGET  63

Query  407   LTIaqvaa-vaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSH  583
             LT+AQVA+   A   T   KVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGF ATSH
Sbjct  64    LTVAQVASIANADNKTSGFKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFCATSH  123

Query  584   RRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEIL  763
             RRTK G ALQKELI+FLNAG+FGNG ES HTL HS TRA MLVRINTLLQGYSGIRFEIL
Sbjct  124   RRTKNGGALQKELIKFLNAGVFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  183

Query  764   EAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFR  943
             EAITKL+N NITPCLPLRGT+TASGDL PLSYI GL+TGR NSKAVGP+G  LDA+EAFR
Sbjct  184   EAITKLINSNITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGSKLDADEAFR  243

Query  944   RAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
              A +  GFFELQPKE LA+ NGTA GS +A +VLY++NI
Sbjct  244   VAAVSGGFFELQPKEGLALVNGTAVGSGMASIVLYDSNI  282



>gb|AAZ29735.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   391 bits (1005),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 203/256 (79%), Positives = 221/256 (86%), Gaps = 3/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW  AAEA+KGSHLDEVKRMVEEYRK  V+LGG+TLTI+QVAA+AA  G     VEL
Sbjct  35    DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGKTLTISQVAAIAAHDGA---TVEL  91

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  92    SESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  151

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ES HTL H+ TRA MLVRINTLLQGYSGIRFEILEAITKLLN+N+TPCLPLRGTITA
Sbjct  152   NGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLPLRGTITA  211

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKA GP GE L+A++AF+ AGI + FFELQPKE LA+ NGT
Sbjct  212   SGDLVPLSYIAGLLTGRPNSKAHGPTGEVLNAKQAFQLAGINTEFFELQPKEGLALVNGT  271

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  272   AVGSGLASIVLFEANI  287



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   390 bits (1003),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 204/280 (73%), Positives = 226/280 (81%), Gaps = 14/280 (5%)
 Frame = +2

Query  230   ISNGH---AHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGG  400
             I NG    A  FC++         DPLNW   AE+LKGSHL+EVKRMV E+RK  VKLGG
Sbjct  6     IENGQVNEAIEFCIK---------DPLNWGVTAESLKGSHLNEVKRMVAEFRKPVVKLGG  56

Query  401   ETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATS  580
             ETLT++QVA +AA+     VKVELSE+ARAGVKASSDWVM  M  GTDSYGVTTGFGATS
Sbjct  57    ETLTVSQVAGIAARDNG--VKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATS  114

Query  581   HRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEI  760
             HRRTKQG ALQKELIRFLNAGIFGNG ES HTL HS TRA MLVR+NTLLQGYSGIRFEI
Sbjct  115   HRRTKQGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEI  174

Query  761   LEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAF  940
             LEAITK LNHN+TP LPLRGTITASGDL PLSYI GL+TGR NSKAVGP G+ L+AE+AF
Sbjct  175   LEAITKFLNHNVTPVLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGQVLNAEQAF  234

Query  941   RRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
               AG+E GFFELQPKE LA+ NG A GS +A MVL++AN+
Sbjct  235   GLAGVEDGFFELQPKEGLALVNGAAVGSGMASMVLFDANV  274



>ref|XP_002285277.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 emb|CAN74850.1| hypothetical protein VITISV_000789 [Vitis vinifera]
Length=717

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 233/282 (83%), Gaps = 11/282 (4%)
 Frame = +2

Query  215   NGNGIISNGHAHGFCVEQKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
             NGNG +    A+GFC++       + DPL W AAAE LKGSHL+EVKRMV ++RK  V+L
Sbjct  9     NGNGKVD---ANGFCMK-------AADPLYWAAAAETLKGSHLEEVKRMVADFRKPVVRL  58

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGE+L IAQVAAVAA G +  V VELSE+ARAGV+ASS+WVM  M  GTDSYGVTTGFGA
Sbjct  59    GGESLNIAQVAAVAATG-SDGVTVELSESARAGVQASSNWVMESMNQGTDSYGVTTGFGA  117

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQKELIRFLNAGIFG G ESCHTL HS TRA MLVRINTLLQGYSGIRF
Sbjct  118   TSHRRTKQGNALQKELIRFLNAGIFGKGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  177

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEA  KLLN NI+PCLPLRGTI+ASGDL PLSYI GL+TGR NS+AVGPNGE+L+AEE
Sbjct  178   EILEATVKLLNANISPCLPLRGTISASGDLVPLSYIAGLLTGRPNSRAVGPNGESLNAEE  237

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AFR AGI+ GFFELQPKE LA+ NGTA GS LA  VL+EANI
Sbjct  238   AFRLAGIDGGFFELQPKEGLALVNGTAVGSGLASTVLFEANI  279



>gb|AAX22055.1| phenylalanine ammonia-lyase [Brassica napus]
 gb|AAX22056.1| phenylalanine ammonia-lyase [Brassica napus]
Length=723

 Score =   391 bits (1004),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 223/265 (84%), Gaps = 2/265 (1%)
 Frame = +2

Query  266   QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  445
             +K + + + DPLNW AAAE +KGSHLDE+KRMVEEYR+  V LGGETLTI QVAA++  G
Sbjct  23    EKTKVAVAADPLNWGAAAEQMKGSHLDELKRMVEEYRRPVVNLGGETLTIGQVAAISTAG  82

Query  446   gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  625
             G   VKVEL+EA+RAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRTK G ALQ ELI
Sbjct  83    GG--VKVELAEASRAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGTALQTELI  140

Query  626   RFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  805
             RFLNAGIFGN  E+CHTL  S TRA MLVR+NTLLQGYSGIRFEILEAIT  LNHNI+P 
Sbjct  141   RFLNAGIFGNTKETCHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSFLNHNISPS  200

Query  806   LPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPK  985
             LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE+L AEEAF++AGI SGFF+LQPK
Sbjct  201   LPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGESLTAEEAFKQAGIASGFFDLQPK  260

Query  986   ERLAMANGTADGSRLACMVLYEANI  1060
             E LA+ NGTA GS +A MVL+EAN+
Sbjct  261   EGLALVNGTAVGSGMASMVLFEANV  285



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   390 bits (1003),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 219/256 (86%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW +A+E+LKGSHLDEVKRMV EYRK  V+LGGETLTIAQVAAVA++     V VEL
Sbjct  23    DPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVASRDDG--VTVEL  80

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             +E ARAGVKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG
Sbjct  81    NEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  140

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
              G ESCH L H+ TRA MLVRINTLLQGYSGIRFEILEAITK LN NITPCLPLR +ITA
Sbjct  141   KGTESCHMLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNRNITPCLPLRASITA  200

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL P SYI GL+TGR NS AVGPNGE+L+A EAF +AGI+ GFFELQPKE LA+ NGT
Sbjct  201   SGDLVPFSYIAGLLTGRPNSVAVGPNGESLNAAEAFSQAGIDGGFFELQPKEGLALVNGT  260

Query  1013  ADGSRLACMVLYEANI  1060
               G+ LA +VL+EANI
Sbjct  261   GVGAGLASIVLFEANI  276



>emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera]
Length=686

 Score =   389 bits (1000),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 217/249 (87%), Gaps = 2/249 (1%)
 Frame = +2

Query  314   AAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVELSEAARAG  493
             AAE LKGSHLDEVKRMV EYRK  V+LGGETLTI+QVAA+A + G  +V VELSE ARAG
Sbjct  2     AAETLKGSHLDEVKRMVAEYRKPVVQLGGETLTISQVAAIAGREG--DVSVELSETARAG  59

Query  494   VKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGNGAESCH  673
             VKASSDWVM  M+ G DSYGVTTGFGATSHRRTKQG ALQKELIR LNAGIFGNG ESCH
Sbjct  60    VKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAGIFGNGRESCH  119

Query  674   TLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLGPL  853
             TL HS TRA MLVRIN+LLQGYSGIRFEILEAITKLLNHNITPCLPLRGT+TASGDL PL
Sbjct  120   TLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASGDLVPL  179

Query  854   SYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGTADGSRLA  1033
             SYI GL+TGR NSKAVGP+GE ++AEEAF+ AGIESGFFELQPKE  A+ NGTA GS LA
Sbjct  180   SYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGFALVNGTAVGSGLA  239

Query  1034  CMVLYEANI  1060
              MVL+E N+
Sbjct  240   SMVLFETNV  248



>ref|XP_010543544.1| PREDICTED: phenylalanine ammonia-lyase 4 [Tarenaya hassleriana]
Length=718

 Score =   390 bits (1002),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 204/260 (78%), Positives = 223/260 (86%), Gaps = 2/260 (1%)
 Frame = +2

Query  287   SHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEV-K  463
             S DPLNWNAAAEA+KGSH++EVKRMVE+YR+ TVKLGGETLTI QVAAV+  GG+    K
Sbjct  21    SGDPLNWNAAAEAMKGSHVEEVKRMVEDYRRKTVKLGGETLTIGQVAAVSGFGGSAAAAK  80

Query  464   VELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  643
             VELSEAARAGVKASSDWVM  M  GTDSYGVTTGFGATSHRRT+QG ALQKELIRFLNAG
Sbjct  81    VELSEAARAGVKASSDWVMESMNRGTDSYGVTTGFGATSHRRTRQGGALQKELIRFLNAG  140

Query  644   IFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  823
             IFG+G  +CHTL H+ TRA MLVR+NTLLQG+SGIRFEILEAI K LNHNITPCLPLRGT
Sbjct  141   IFGSGDATCHTLPHAATRAAMLVRVNTLLQGFSGIRFEILEAIAKFLNHNITPCLPLRGT  200

Query  824   ITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESG-FFELQPKERLAM  1000
             ITASGDL PLSYI GL+TGR NS AVGP+GE L A EAF+ AGIE G FFELQPKE LA+
Sbjct  201   ITASGDLVPLSYIAGLLTGRPNSVAVGPSGETLSAAEAFKLAGIEGGSFFELQPKEGLAL  260

Query  1001  ANGTADGSRLACMVLYEANI  1060
              NGTA GS LA  +L+EANI
Sbjct  261   VNGTAVGSGLAATILFEANI  280



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   390 bits (1002),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 206/282 (73%), Positives = 229/282 (81%), Gaps = 5/282 (2%)
 Frame = +2

Query  224   GIISNGHAHGFCVEQKRRAS---SSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKL  394
              I  N     FC+   +  +   +  DPLNW  AAEA+KGSH+DEVKRMVEEYRK  V+L
Sbjct  7     AITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHIDEVKRMVEEYRKPVVRL  66

Query  395   GGETLTIaqvaavaaqggTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGA  574
             GGETLTI+QVAA+AA      V+VELSE+ARAGV+ASSDWVM  M  GTDSYGVTTGFGA
Sbjct  67    GGETLTISQVAAIAAHDHG--VQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGFGA  124

Query  575   TSHRRTKQGAALQKELIRFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRF  754
             TSHRRTKQG ALQKELIRFLNAGIFGNG ES HTL H+ TRA MLVRINTLLQGYSGIRF
Sbjct  125   TSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRF  184

Query  755   EILEAITKLLNHNITPCLPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEE  934
             EILEAITKLLN+N+TPCLPLRGTITASGDL PLSYI GL+TGR NSKA GP+GE L+A+E
Sbjct  185   EILEAITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAHGPSGEILNAKE  244

Query  935   AFRRAGIESGFFELQPKERLAMANGTADGSRLACMVLYEANI  1060
             AF+ AGI + F ELQPKE LA+ NGTA GS LA +VL EANI
Sbjct  245   AFKLAGINAEFLELQPKEGLALVNGTAVGSGLASIVLLEANI  286



>gb|ADL09136.1| phenylanlanine ammonia-lyase [Brassica oleracea var. botrytis]
Length=723

 Score =   390 bits (1002),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 222/265 (84%), Gaps = 2/265 (1%)
 Frame = +2

Query  266   QKRRASSSHDPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqg  445
             +K + + + DPLNW AAAE +KGSHLDEVKRMVEEYR+  V LGGETLTI QVAA++  G
Sbjct  23    EKTKVAVAADPLNWGAAAEQMKGSHLDEVKRMVEEYRRPVVNLGGETLTIGQVAAISTVG  82

Query  446   gTPEVKVELSEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELI  625
             G   VKVEL+EA+RAGVKASSDWVM  M  GTDSYGVT GFGATSHRRTK G ALQ ELI
Sbjct  83    GG--VKVELAEASRAGVKASSDWVMESMGKGTDSYGVTAGFGATSHRRTKNGTALQTELI  140

Query  626   RFLNAGIFGNGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  805
             RFLNAGIFGN  E+CHTL  S TRA MLVR+NTLLQGYSGIRFEILEAIT  LNHNI+P 
Sbjct  141   RFLNAGIFGNTKETCHTLPESATRAAMLVRVNTLLQGYSGIRFEILEAITSFLNHNISPS  200

Query  806   LPLRGTITASGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPK  985
             LPLRGTITASGDL PLSYI GL+TGR NSKA GPNGE+L AEEAF++AGI SGFF+LQPK
Sbjct  201   LPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGESLTAEEAFKQAGIASGFFDLQPK  260

Query  986   ERLAMANGTADGSRLACMVLYEANI  1060
             E LA+ NGTA GS +A MVL+EAN+
Sbjct  261   EGLALVNGTAVGSGMASMVLFEANV  285



>gb|AAW78932.1| phenylalanine-ammonia lyase [Rhodiola sachalinensis]
Length=710

 Score =   390 bits (1001),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 201/256 (79%), Positives = 221/256 (86%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPL+W  AAEA+KGSHLDEVKRMVEEYRK  VKLGGETLTIAQVAA+A +G   +V+VEL
Sbjct  19    DPLSWGLAAEAMKGSHLDEVKRMVEEYRKPAVKLGGETLTIAQVAAIAGRGS--DVRVEL  76

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SE+AR GVKASSDWVM  M  GTDSYGVTTGFGATSHRRTKQG ALQKELIRFLNAGIFG
Sbjct  77    SESAREGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  136

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             +G ++CHTL+ S TRA MLVRINTLLQGYSGIRFEILEAIT LLN +ITPCLPLRGTITA
Sbjct  137   SGKDTCHTLSQSATRAAMLVRINTLLQGYSGIRFEILEAITSLLNSDITPCLPLRGTITA  196

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAV  NGE +  +EAF+RAGIE GFF LQPKE LA+ NGT
Sbjct  197   SGDLVPLSYIAGLLTGRPNSKAVAENGEVITPDEAFKRAGIEGGFFNLQPKEGLALVNGT  256

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA MVL++AN+
Sbjct  257   AVGSGLASMVLFDANV  272



>ref|XP_010067316.1| PREDICTED: phenylalanine ammonia-lyase [Eucalyptus grandis]
 gb|KCW65429.1| hypothetical protein EUGRSUZ_G02849 [Eucalyptus grandis]
Length=714

 Score =   390 bits (1001),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 203/256 (79%), Positives = 217/256 (85%), Gaps = 2/256 (1%)
 Frame = +2

Query  293   DPLNWNAAAEALKGSHLDEVKRMVEEYRKATVKLGGETLTIaqvaavaaqggTPEVKVEL  472
             DPLNW AAA AL GSHLDEVKRMVEE R+  V+LGGETLTIAQVAA+A +       VEL
Sbjct  23    DPLNWGAAAAALTGSHLDEVKRMVEESRRPVVRLGGETLTIAQVAAIAGREAG--AAVEL  80

Query  473   SEAARAGVKASSDWVMAGMENGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFG  652
             SEAARA VKASSDWVM  M NGTDSYGVTTGFGATSHRRTKQG ALQ ELIRFLNAGIFG
Sbjct  81    SEAARAAVKASSDWVMESMRNGTDSYGVTTGFGATSHRRTKQGGALQTELIRFLNAGIFG  140

Query  653   NGAESCHTLTHSVTRADMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  832
             NG ESCH L HS TRA MLVRINTLLQGYSGIRFEILE + KLLN NITPCLPLRGT+TA
Sbjct  141   NGTESCHMLPHSATRAAMLVRINTLLQGYSGIRFEILETMAKLLNRNITPCLPLRGTVTA  200

Query  833   SGDLGPLSYIDGLITGRTNSKAVGPNGEALDAEEAFRRAGIESGFFELQPKERLAMANGT  1012
             SGDL PLSYI GL+TGR NSKAVGPNGE+L+A EAFR AGI+ GFF+LQPKE LA+ NGT
Sbjct  201   SGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAVEAFRLAGIKHGFFDLQPKEGLAIVNGT  260

Query  1013  ADGSRLACMVLYEANI  1060
             A GS LA +VL+EANI
Sbjct  261   AVGSGLASIVLFEANI  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2747734375960