BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig1045

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075175.1|  PREDICTED: TBCC domain-containing protein 1-...    141   5e-35   Sesamum indicum [beniseed]
emb|CBI30042.3|  unnamed protein product                                139   2e-34   Vitis vinifera
ref|XP_002278205.1|  PREDICTED: TBCC domain-containing protein 1-...    139   3e-34   Vitis vinifera
gb|KHN26370.1|  TBCC domain-containing protein 1                        137   9e-34   Glycine soja [wild soybean]
ref|XP_003554199.1|  PREDICTED: TBCC domain-containing protein 1-...    137   9e-34   Glycine max [soybeans]
ref|XP_009629812.1|  PREDICTED: TBCC domain-containing protein 1-...    134   1e-32   Nicotiana tomentosiformis
gb|EYU20708.1|  hypothetical protein MIMGU_mgv1a007731mg                133   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_009772589.1|  PREDICTED: TBCC domain-containing protein 1-...    134   2e-32   Nicotiana sylvestris
emb|CDP20019.1|  unnamed protein product                                134   2e-32   Coffea canephora [robusta coffee]
ref|XP_003521203.1|  PREDICTED: TBCC domain-containing protein 1-...    133   3e-32   Glycine max [soybeans]
gb|KHN07410.1|  TBCC domain-containing protein 1                        133   3e-32   Glycine soja [wild soybean]
ref|XP_008360822.1|  PREDICTED: TBCC domain-containing protein 1-...    131   3e-32   
emb|CDY06066.1|  BnaA09g37140D                                          125   4e-32   
gb|KCW48078.1|  hypothetical protein EUGRSUZ_K01823                     132   4e-32   Eucalyptus grandis [rose gum]
ref|XP_007028946.1|  Tubulin binding cofactor C domain-containing...    132   5e-32   
ref|XP_004249279.1|  PREDICTED: TBCC domain-containing protein 1        132   6e-32   Solanum lycopersicum
gb|KJB16388.1|  hypothetical protein B456_002G228100                    132   8e-32   Gossypium raimondii
ref|XP_009369834.1|  PREDICTED: TBCC domain-containing protein 1-...    132   9e-32   Pyrus x bretschneideri [bai li]
gb|KJB15036.1|  hypothetical protein B456_002G156800                    132   9e-32   Gossypium raimondii
ref|XP_010038901.1|  PREDICTED: TBCC domain-containing protein 1        131   9e-32   
ref|XP_011078850.1|  PREDICTED: TBCC domain-containing protein 1-...    132   1e-31   Sesamum indicum [beniseed]
ref|XP_002532335.1|  conserved hypothetical protein                     131   1e-31   Ricinus communis
ref|XP_003520533.1|  PREDICTED: TBCC domain-containing protein 1-...    131   2e-31   Glycine max [soybeans]
gb|KHN26369.1|  TBCC domain-containing protein 1                        130   2e-31   Glycine soja [wild soybean]
ref|XP_003554198.1|  PREDICTED: TBCC domain-containing protein 1-...    130   2e-31   Glycine max [soybeans]
ref|XP_006351339.1|  PREDICTED: TBCC domain-containing protein 1-...    130   2e-31   Solanum tuberosum [potatoes]
gb|EYU39914.1|  hypothetical protein MIMGU_mgv1a003654mg                130   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_007162300.1|  hypothetical protein PHAVU_001G140500g             129   6e-31   Phaseolus vulgaris [French bean]
ref|XP_009629687.1|  PREDICTED: TBCC domain-containing protein 1-...    129   7e-31   Nicotiana tomentosiformis
ref|XP_012087738.1|  PREDICTED: TBCC domain-containing protein 1        129   9e-31   Jatropha curcas
ref|XP_009797552.1|  PREDICTED: TBCC domain-containing protein 1-...    129   9e-31   Nicotiana sylvestris
ref|XP_010672700.1|  PREDICTED: TBCC domain-containing protein 1        128   2e-30   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX98257.1|  BnaC06g16180D                                          128   2e-30   
ref|XP_009369843.1|  PREDICTED: TBCC domain-containing protein 1-...    127   3e-30   Pyrus x bretschneideri [bai li]
emb|CDX67713.1|  BnaA07g17530D                                          128   3e-30   
ref|XP_002323291.1|  tubulin-specific chaperone C-related family ...    127   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008240958.1|  PREDICTED: TBCC domain-containing protein 1 ...    126   8e-30   Prunus mume [ume]
ref|XP_009104081.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    126   8e-30   Brassica rapa
ref|XP_009376106.1|  PREDICTED: TBCC domain-containing protein 1-...    126   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_011033250.1|  PREDICTED: TBCC domain-containing protein 1 ...    125   2e-29   Populus euphratica
ref|XP_004304384.1|  PREDICTED: TBCC domain-containing protein 1 ...    125   2e-29   Fragaria vesca subsp. vesca
ref|XP_011020269.1|  PREDICTED: TBCC domain-containing protein 1 ...    125   2e-29   Populus euphratica
ref|XP_011020268.1|  PREDICTED: TBCC domain-containing protein 1 ...    125   2e-29   Populus euphratica
ref|XP_011020267.1|  PREDICTED: TBCC domain-containing protein 1 ...    125   2e-29   Populus euphratica
ref|XP_007162298.1|  hypothetical protein PHAVU_001G140300g             125   2e-29   Phaseolus vulgaris [French bean]
emb|CDY61748.1|  BnaA04g27540D                                          125   3e-29   Brassica napus [oilseed rape]
emb|CDY06067.1|  BnaA09g37130D                                          124   3e-29   
ref|XP_006402830.1|  hypothetical protein EUTSA_v10005862mg             125   3e-29   Eutrema salsugineum [saltwater cress]
emb|CDY47657.1|  BnaC04g23940D                                          125   3e-29   Brassica napus [oilseed rape]
emb|CDX71986.1|  BnaC08g28880D                                          124   4e-29   
gb|AFK40546.1|  unknown                                                 117   5e-29   Lotus japonicus
ref|XP_006381055.1|  tubulin-specific chaperone C-related family ...    124   7e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010524365.1|  PREDICTED: TBCC domain-containing protein 1-...    124   9e-29   Tarenaya hassleriana [spider flower]
ref|XP_009116487.1|  PREDICTED: TBCC domain-containing protein 1        123   1e-28   Brassica rapa
ref|XP_002876443.1|  hypothetical protein ARALYDRAFT_486241             123   1e-28   
ref|XP_003625224.1|  TBCC domain-containing protein                     123   1e-28   
ref|XP_009139004.1|  PREDICTED: TBCC domain-containing protein 1-...    123   1e-28   Brassica rapa
ref|XP_004493562.1|  PREDICTED: TBCC domain-containing protein 1-...    123   2e-28   Cicer arietinum [garbanzo]
ref|XP_006290821.1|  hypothetical protein CARUB_v10016930mg             123   2e-28   Capsella rubella
ref|XP_007203759.1|  hypothetical protein PRUPE_ppa003584mg             122   3e-28   Prunus persica
emb|CAB67617.1|  putative protein                                       122   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567059.1|  Tubulin binding cofactor C domain-containing pr...    122   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008240959.1|  PREDICTED: TBCC domain-containing protein 1 ...    122   3e-28   Prunus mume [ume]
gb|KFK35082.1|  hypothetical protein AALP_AA5G233000                    122   4e-28   Arabis alpina [alpine rockcress]
ref|XP_010427682.1|  PREDICTED: TBCC domain-containing protein 1-...    122   4e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001190120.1|  Tubulin binding cofactor C domain-containing...    122   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392091.1|  PREDICTED: TBCC domain-containing protein 1        121   5e-28   
gb|KJB82781.1|  hypothetical protein B456_013G212400                    120   5e-28   Gossypium raimondii
ref|XP_010507501.1|  PREDICTED: uncharacterized protein LOC104784134    120   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_011468069.1|  PREDICTED: TBCC domain-containing protein 1 ...    121   8e-28   Fragaria vesca subsp. vesca
ref|XP_006342320.1|  PREDICTED: TBCC domain-containing protein 1-...    121   8e-28   Solanum tuberosum [potatoes]
gb|KJB82780.1|  hypothetical protein B456_013G212400                    120   8e-28   Gossypium raimondii
gb|EPS74445.1|  hypothetical protein M569_00304                         121   8e-28   Genlisea aurea
ref|XP_010548390.1|  PREDICTED: TBCC domain-containing protein 1-...    121   9e-28   Tarenaya hassleriana [spider flower]
gb|KDO57721.1|  hypothetical protein CISIN_1g0403992mg                  116   9e-28   Citrus sinensis [apfelsine]
ref|XP_008442093.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    120   1e-27   Cucumis melo [Oriental melon]
gb|KJB82776.1|  hypothetical protein B456_013G212400                    120   1e-27   Gossypium raimondii
ref|XP_010265832.1|  PREDICTED: TBCC domain-containing protein 1-...    120   1e-27   
ref|XP_004146385.1|  PREDICTED: TBCC domain-containing protein 1-...    120   2e-27   Cucumis sativus [cucumbers]
gb|KEH41654.1|  tubulin-binding cofactor C domain protein               120   2e-27   Medicago truncatula
emb|CDY53502.1|  BnaC04g02540D                                          120   2e-27   Brassica napus [oilseed rape]
ref|XP_010265831.1|  PREDICTED: TBCC domain-containing protein 1-...    119   2e-27   Nelumbo nucifera [Indian lotus]
ref|NP_973669.1|  C-CAP/cofactor C-like domain-containing protein       119   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508603.1|  PREDICTED: TBCC domain-containing protein 1-...    118   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010517737.1|  PREDICTED: TBCC domain-containing protein 1-...    118   9e-27   Camelina sativa [gold-of-pleasure]
gb|AGJ83863.1|  tublin binding cofactor C                               118   9e-27   Gossypium hirsutum [American cotton]
ref|XP_010506033.1|  PREDICTED: TBCC domain-containing protein 1-...    118   9e-27   Camelina sativa [gold-of-pleasure]
gb|KHG16745.1|  TBCC domain-containing 1                                117   1e-26   Gossypium arboreum [tree cotton]
ref|XP_010257397.1|  PREDICTED: TBCC domain-containing protein 1-...    117   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009142814.1|  PREDICTED: TBCC domain-containing protein 1        117   2e-26   Brassica rapa
emb|CDX79886.1|  BnaA05g02700D                                          117   2e-26   
ref|XP_006293916.1|  hypothetical protein CARUB_v10022907mg             116   3e-26   
ref|XP_010516427.1|  PREDICTED: TBCC domain-containing protein 1-...    117   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006411483.1|  hypothetical protein EUTSA_v10016442mg             116   5e-26   Eutrema salsugineum [saltwater cress]
ref|XP_006485027.1|  PREDICTED: TBCC domain-containing protein 1-...    115   9e-26   Citrus sinensis [apfelsine]
gb|KJB36107.1|  hypothetical protein B456_006G141400                    113   9e-26   Gossypium raimondii
ref|XP_006437044.1|  hypothetical protein CICLE_v10031101mg             115   9e-26   Citrus clementina [clementine]
gb|KJB36111.1|  hypothetical protein B456_006G141400                    113   1e-25   Gossypium raimondii
gb|KJB36108.1|  hypothetical protein B456_006G141400                    113   1e-25   Gossypium raimondii
ref|XP_004497930.1|  PREDICTED: TBCC domain-containing protein 1-...    114   1e-25   Cicer arietinum [garbanzo]
ref|XP_008778358.1|  PREDICTED: TBCC domain-containing protein 1-...    112   3e-25   Phoenix dactylifera
gb|KJB36105.1|  hypothetical protein B456_006G141400                    114   3e-25   Gossypium raimondii
gb|KJB36106.1|  hypothetical protein B456_006G141400                    113   5e-25   Gossypium raimondii
ref|XP_008795746.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    112   1e-24   Phoenix dactylifera
gb|AFW66197.1|  hypothetical protein ZEAMMB73_400795                    105   2e-24   
ref|XP_010928451.1|  PREDICTED: TBCC domain-containing protein 1 ...    110   4e-24   
ref|NP_001058077.1|  Os06g0614300                                       110   5e-24   
gb|EEC80975.1|  hypothetical protein OsI_23703                          110   5e-24   Oryza sativa Indica Group [Indian rice]
gb|EEE66013.1|  hypothetical protein OsJ_21970                          110   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010928450.1|  PREDICTED: TBCC domain-containing protein 1 ...    110   5e-24   
ref|XP_009411800.1|  PREDICTED: TBCC domain-containing protein 1-...    110   7e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391882.1|  PREDICTED: TBCC domain-containing protein 1-...    110   7e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800652.1|  PREDICTED: TBCC domain-containing protein 1-...    109   2e-23   Phoenix dactylifera
ref|XP_006657134.1|  PREDICTED: TBCC domain-containing protein 1-...    105   1e-22   Oryza brachyantha
ref|XP_004965884.1|  PREDICTED: TBCC domain-containing protein 1-...    105   3e-22   Setaria italica
gb|ACN28202.1|  unknown                                                 105   3e-22   Zea mays [maize]
ref|XP_010943570.1|  PREDICTED: TBCC domain-containing protein 1-...    104   6e-22   Elaeis guineensis
gb|KJB15038.1|  hypothetical protein B456_002G156800                    104   9e-22   Gossypium raimondii
dbj|BAJ90629.1|  predicted protein                                      104   9e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001168301.1|  hypothetical protein                               103   1e-21   Zea mays [maize]
ref|XP_003563624.1|  PREDICTED: TBCC domain-containing protein 1-...    103   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_004951581.1|  PREDICTED: TBCC domain-containing protein 1-...    103   1e-21   Setaria italica
dbj|BAJ93674.1|  predicted protein                                      101   8e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003571239.1|  PREDICTED: TBCC domain-containing protein 1-...  99.8    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_002453473.1|  hypothetical protein SORBIDRAFT_04g006490        99.0    6e-20   Sorghum bicolor [broomcorn]
ref|XP_011033249.1|  PREDICTED: TBCC domain-containing protein 1 ...  99.0    6e-20   Populus euphratica
gb|AFK39829.1|  unknown                                               91.3    6e-20   Medicago truncatula
gb|ABR16182.1|  unknown                                               99.0    7e-20   Picea sitchensis
gb|KHG18606.1|  TBCC domain-containing 1                              97.4    2e-19   Gossypium arboreum [tree cotton]
ref|XP_008643390.1|  PREDICTED: hypothetical protein isoform X2       97.1    2e-19   Zea mays [maize]
ref|NP_001144767.1|  hypothetical protein                             97.1    2e-19   Zea mays [maize]
ref|XP_008643389.1|  PREDICTED: hypothetical protein isoform X1       97.1    3e-19   Zea mays [maize]
ref|XP_006648417.1|  PREDICTED: TBCC domain-containing protein 1-...  95.9    4e-19   Oryza brachyantha
gb|EEE56495.1|  hypothetical protein OsJ_05741                        96.3    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72669.1|  hypothetical protein OsI_06222                        96.3    5e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001046181.1|  Os02g0194800                                     96.3    5e-19   
ref|XP_006850073.1|  PREDICTED: TBCC domain-containing protein 1      95.9    7e-19   Amborella trichopoda
gb|KJB36110.1|  hypothetical protein B456_006G141400                  92.4    2e-18   Gossypium raimondii
ref|XP_010913921.1|  PREDICTED: TBCC domain-containing protein 1-...  94.7    2e-18   Elaeis guineensis
ref|XP_008787292.1|  PREDICTED: TBCC domain-containing protein 1-...  94.4    2e-18   Phoenix dactylifera
gb|EEC67872.1|  hypothetical protein OsI_35505                        91.3    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_002881827.1|  hypothetical protein ARALYDRAFT_483312           93.2    5e-18   
gb|KGN54813.1|  hypothetical protein Csa_4G507430                     92.4    1e-17   Cucumis sativus [cucumbers]
ref|NP_181752.3|  C-CAP/cofactor C-like domain-containing protein     91.7    2e-17   
gb|AAB88648.1|  hypothetical protein                                  90.9    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98763.1|  TBCC domain-containing 1                              89.7    8e-17   Gossypium arboreum [tree cotton]
gb|KJB15037.1|  hypothetical protein B456_002G156800                  86.7    7e-16   Gossypium raimondii
gb|ACM17606.1|  tubulin-specific chaperon-like protein                76.6    9e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002964936.1|  hypothetical protein SELMODRAFT_439144           75.9    3e-12   Selaginella moellendorffii
ref|XP_002986516.1|  hypothetical protein SELMODRAFT_182480           75.9    3e-12   
gb|EMT07109.1|  TBCC domain-containing protein 1                      75.1    5e-12   
gb|EMT00776.1|  hypothetical protein F775_29395                       71.6    9e-12   
ref|XP_010233970.1|  PREDICTED: TBCC domain-containing protein 1-...  73.2    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_001757659.1|  predicted protein                                73.2    2e-11   
ref|XP_001778693.1|  predicted protein                                68.2    9e-10   
ref|XP_001765734.1|  predicted protein                                67.0    2e-09   
ref|XP_001758135.1|  predicted protein                                62.8    5e-08   
gb|EMS64518.1|  TBCC domain-containing protein 1                      62.4    6e-08   Triticum urartu
ref|XP_003060588.1|  predicted protein                                60.5    3e-07   Micromonas pusilla CCMP1545
ref|XP_005651291.1|  TBCC-domain-containing protein                   57.8    3e-06   Coccomyxa subellipsoidea C-169
ref|XP_011396281.1|  TBCC domain-containing protein 1                 57.4    3e-06   Auxenochlorella protothecoides
ref|XP_002505027.1|  predicted protein                                54.7    3e-05   Micromonas commoda
gb|ETP20620.1|  hypothetical protein F441_05699                       51.2    5e-04   Phytophthora parasitica CJ01A1
gb|ETI50864.1|  hypothetical protein F443_05691                       51.2    5e-04   Phytophthora parasitica P1569
ref|XP_008903430.1|  hypothetical protein, variant                    51.2    5e-04   Phytophthora parasitica INRA-310
gb|ETO79606.1|  hypothetical protein, variant                         51.2    5e-04   Phytophthora parasitica P1976
gb|ETL97323.1|  hypothetical protein, variant                         51.2    5e-04   Phytophthora parasitica
gb|ETK90738.1|  hypothetical protein L915_05554                       51.2    5e-04   Phytophthora parasitica
gb|ETO79605.1|  hypothetical protein F444_05744                       51.2    5e-04   Phytophthora parasitica P1976
ref|XP_008903429.1|  hypothetical protein PPTG_22581                  51.2    5e-04   Phytophthora parasitica INRA-310
gb|ETL97322.1|  hypothetical protein L917_05380                       51.2    5e-04   Phytophthora parasitica
ref|XP_009514404.1|  hypothetical protein PHYSODRAFT_358230           51.2    5e-04   Phytophthora sojae
ref|XP_002909594.1|  conserved hypothetical protein                   50.8    6e-04   Phytophthora infestans T30-4



>ref|XP_011075175.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=570

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -3

Query  735  AQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDW  556
            + Q+GSTKDNPFPLPDAY+ASQ KNHKNLVE+K ILRET+LE+SRKREL++ALH  FKDW
Sbjct  495  SDQAGSTKDNPFPLPDAYLASQQKNHKNLVEVKHILRETQLEESRKRELSTALHACFKDW  554

Query  555  LYASGNIRQLYCLQGE  508
            LYASGNIRQLYCLQGE
Sbjct  555  LYASGNIRQLYCLQGE  570



>emb|CBI30042.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +G+TKDNPFPLPDAYMASQ +NHKNL EIKQILRET LE++RKREL+ ALHV FK
Sbjct  389  FGGESAGTTKDNPFPLPDAYMASQQRNHKNLGEIKQILRETPLEENRKRELSCALHVFFK  448

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  449  DWLYASGNIRQLYCLQGD  466



>ref|XP_002278205.1| PREDICTED: TBCC domain-containing protein 1-like [Vitis vinifera]
Length=568

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +G+TKDNPFPLPDAYMASQ +NHKNL EIKQILRET LE++RKREL+ ALHV FK
Sbjct  491  FGGESAGTTKDNPFPLPDAYMASQQRNHKNLGEIKQILRETPLEENRKRELSCALHVFFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  551  DWLYASGNIRQLYCLQGD  568



>gb|KHN26370.1| TBCC domain-containing protein 1 [Glycine soja]
Length=553

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  732  QQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWL  553
            + +GSTKDNPF LPDAYMASQHKNHKNL EI+Q+LRE  LE+SRKREL+SALHV FKDWL
Sbjct  479  ESTGSTKDNPFTLPDAYMASQHKNHKNLEEIRQLLREASLEESRKRELSSALHVYFKDWL  538

Query  552  YASGNIRQLYCLQGE  508
            YASGNIRQLYCLQG+
Sbjct  539  YASGNIRQLYCLQGD  553



>ref|XP_003554199.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -3

Query  732  QQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWL  553
            + +GSTKDNPF LPDAYMASQHKNHKNL EI+Q+LRE  LE+SRKREL+SALHV FKDWL
Sbjct  491  ESTGSTKDNPFTLPDAYMASQHKNHKNLEEIRQLLREASLEESRKRELSSALHVYFKDWL  550

Query  552  YASGNIRQLYCLQGE  508
            YASGNIRQLYCLQG+
Sbjct  551  YASGNIRQLYCLQGD  565



>ref|XP_009629812.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=570

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE Q SGSTKDNPFPLPDAY+ASQ +NHKNL E K++L++TEL+++RKRE+A+ALH  FK
Sbjct  493  FEGQHSGSTKDNPFPLPDAYLASQQRNHKNLEENKRMLKDTELDETRKREVATALHACFK  552

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  553  DWLYASGNIRQLYCLQGD  570



>gb|EYU20708.1| hypothetical protein MIMGU_mgv1a007731mg [Erythranthe guttata]
Length=397

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +G TKDNPFPLPDAY+ASQ KN K+L E+KQILRET+LE++RKREL+SALH  FK
Sbjct  320  LEIENAGPTKDNPFPLPDAYLASQQKNIKSLAEVKQILRETQLEENRKRELSSALHACFK  379

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  380  DWLYASGNIRQLYCLQGE  397



>ref|XP_009772589.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=568

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE QQSGSTKDNPFPLPDAY+ASQ +NHK+L E K++L++TEL+++RKRE+A+ALH  FK
Sbjct  491  FEGQQSGSTKDNPFPLPDAYLASQQRNHKHLEENKRMLKDTELDETRKREVATALHACFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  551  DWLYASGNIRQLYCLQGD  568



>emb|CDP20019.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAYM SQ +NHKNL EIK IL+ET+LE+SRKREL+S LH  FK
Sbjct  513  FGGEAVGSTKDNPFPLPDAYMVSQQRNHKNLGEIKHILKETQLEESRKRELSSTLHACFK  572

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  573  DWLYASGNIRQLYCLQGD  590



>ref|XP_003521203.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=566

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A+ +G+TK NPF LPDAYMASQHKN KNL EI+Q+LRE  LE+SRKREL+SALHV FK
Sbjct  489  FGAESTGATKGNPFMLPDAYMASQHKNQKNLGEIRQLLREAPLEESRKRELSSALHVYFK  548

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  549  DWLYASGNIRQLYCLQGD  566



>gb|KHN07410.1| TBCC domain-containing protein 1 [Glycine soja]
Length=566

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A+ +G+TK NPF LPDAYMASQHKN KNL EI+Q+LRE  LE+SRKREL+SALHV FK
Sbjct  489  FGAESTGATKGNPFMLPDAYMASQHKNQKNLGEIRQLLREAPLEESRKRELSSALHVYFK  548

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  549  DWLYASGNIRQLYCLQGD  566



>ref|XP_008360822.1| PREDICTED: TBCC domain-containing protein 1-like [Malus domestica]
Length=362

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPDAYMASQH+N  NL E+KQ+L+E  LE++RKREL++ALHV FK
Sbjct  285  YGGESQGSTKDNPFPLPDAYMASQHRNQNNLGEVKQLLKEAPLEENRKRELSTALHVYFK  344

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  345  DWLYASGNIRQLYCLQGE  362



>emb|CDY06066.1| BnaA09g37140D [Brassica napus]
Length=136

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPD YMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FK
Sbjct  59   FNGEEIGSTKDNPFPLPDPYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFK  118

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  119  DWLYASGNIRQLYCLQGD  136



>gb|KCW48078.1| hypothetical protein EUGRSUZ_K01823 [Eucalyptus grandis]
Length=397

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE++  GST+ NPFPLPDAYM SQ +NHK+L EIKQ+LRE  LE++RKREL+SALHV FK
Sbjct  320  FESESVGSTEGNPFPLPDAYMTSQQRNHKSLGEIKQMLREVPLEENRKRELSSALHVYFK  379

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  380  DWLYASGNIRQLYCLQGD  397



>ref|XP_007028946.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 ref|XP_007028947.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09448.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09449.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
Length=567

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + +GSTKDNPFPLPD Y+ SQ +N KNL EIKQILRE  LE++RKREL+ ALHV FK
Sbjct  490  FEGESTGSTKDNPFPLPDTYLTSQQRNQKNLGEIKQILREAPLEENRKRELSCALHVYFK  549

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  550  DWLYASGNIRQLYCLQGD  567



>ref|XP_004249279.1| PREDICTED: TBCC domain-containing protein 1 [Solanum lycopersicum]
Length=569

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE QQSGSTKDNPFPLP+AYMASQ +N KNL E K  L++ +L++SRKRE+A+ALHV FK
Sbjct  492  FEGQQSGSTKDNPFPLPEAYMASQQRNLKNLEETKSSLKDIDLDESRKREVAAALHVCFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  552  DWLYASGNIRQLYCLQGE  569



>gb|KJB16388.1| hypothetical protein B456_002G228100 [Gossypium raimondii]
Length=572

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + +GSTKDNPFPLPDAY+ SQ +N KNL EIKQILRE  LE++RKREL+ ALHV FK
Sbjct  495  FEGESAGSTKDNPFPLPDAYLKSQLRNQKNLSEIKQILREAPLEENRKRELSCALHVYFK  554

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  555  DWLYASGNIRQLYCLQGD  572



>ref|XP_009369834.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=565

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPDAYMASQH+N  NL E+KQ+L+E  LE++RKREL++ALHV FK
Sbjct  488  YGGESQGSTKDNPFPLPDAYMASQHRNQNNLGEVKQLLKEAPLEENRKRELSTALHVYFK  547

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  548  DWLYASGNIRQLYCLQGE  565



>gb|KJB15036.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=567

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + +GSTKDNPFPLPDAYM SQ +N KNL EIKQ+LRE  LE++ KREL+SALHV FK
Sbjct  490  FENESTGSTKDNPFPLPDAYMTSQQRNQKNLSEIKQMLREAPLEENWKRELSSALHVYFK  549

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  550  DWLYASGNIRQLYCLQGD  567



>ref|XP_010038901.1| PREDICTED: TBCC domain-containing protein 1 [Eucalyptus grandis]
Length=523

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE++  GST+ NPFPLPDAYM SQ +NHK+L EIKQ+LRE  LE++RKREL+SALHV FK
Sbjct  446  FESESVGSTEGNPFPLPDAYMTSQQRNHKSLGEIKQMLREVPLEENRKRELSSALHVYFK  505

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  506  DWLYASGNIRQLYCLQGD  523



>ref|XP_011078850.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=573

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E++Q+GSTKDNPFPLPDAY+ASQ K  K+L E+KQ+L++T+LE+SRKR+L+SALH  FK
Sbjct  496  LESEQAGSTKDNPFPLPDAYLASQQKKTKSLGEVKQVLKDTQLEESRKRQLSSALHACFK  555

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  556  DWLYASGNIRQLYCLQGE  573



>ref|XP_002532335.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30037.1| conserved hypothetical protein [Ricinus communis]
Length=572

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + SGSTKDNPFPLP+AYM+SQ +N KNL EIKQ+LRE  LE++RKREL+ ALH+LFK
Sbjct  495  FGGESSGSTKDNPFPLPEAYMSSQERNQKNLGEIKQLLREAPLEENRKRELSCALHLLFK  554

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  555  DWLYASGNIRQLYCLQGD  572



>ref|XP_003520533.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  735  AQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDW  556
             + +G  KDNPF LPDAYMASQHKNHKNL EI+++LRE  LE+SRKREL+SALHV FKDW
Sbjct  490  GESTGFKKDNPFTLPDAYMASQHKNHKNLEEIRKLLREASLEESRKRELSSALHVYFKDW  549

Query  555  LYASGNIRQLYCLQGE  508
            LYASGNIRQLYCLQG+
Sbjct  550  LYASGNIRQLYCLQGD  565



>gb|KHN26369.1| TBCC domain-containing protein 1 [Glycine soja]
Length=551

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +G+TK NPF LPDAYM SQHKN KNL EI+ +LRE  LEDSRKREL+SALHV FK
Sbjct  474  FGGESTGATKGNPFTLPDAYMVSQHKNQKNLGEIRHLLREAPLEDSRKRELSSALHVYFK  533

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  534  DWLYASGNIRQLYCLQGD  551



>ref|XP_003554198.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Glycine 
max]
Length=566

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +G+TK NPF LPDAYM SQHKN KNL EI+ +LRE  LEDSRKREL+SALHV FK
Sbjct  489  FGGESTGATKGNPFTLPDAYMVSQHKNQKNLGEIRHLLREAPLEDSRKRELSSALHVYFK  548

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  549  DWLYASGNIRQLYCLQGD  566



>ref|XP_006351339.1| PREDICTED: TBCC domain-containing protein 1-like [Solanum tuberosum]
Length=569

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE QQSGSTKDNPFPLP+AY+ASQ +N KNL E K  L++ +L++SRKRE+A+ALHV FK
Sbjct  492  FEGQQSGSTKDNPFPLPEAYLASQQRNLKNLEETKNSLKDIDLDESRKREVATALHVCFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  552  DWLYASGNIRQLYCLQGE  569



>gb|EYU39914.1| hypothetical protein MIMGU_mgv1a003654mg [Erythranthe guttata]
Length=571

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  738  EAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKD  559
            E++Q+GSTKDNPF LPD Y+ASQ KNHKNL E+KQILRET+LE+SRKREL+ ALH  FKD
Sbjct  496  ESEQAGSTKDNPFTLPDPYLASQQKNHKNLEEVKQILRETQLEESRKRELSGALHACFKD  555

Query  558  WLYASGNIRQLYCL  517
            WLYASGN+RQLYCL
Sbjct  556  WLYASGNVRQLYCL  569



>ref|XP_007162300.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
 gb|ESW34294.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
Length=565

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  726  SGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYA  547
            +G+T+ NPF LPDAYMASQHKNHKNL E++Q++RE  LE+SRKREL+SALHV FKDWLYA
Sbjct  493  TGTTEGNPFSLPDAYMASQHKNHKNLGELRQLIREASLEESRKRELSSALHVYFKDWLYA  552

Query  546  SGNIRQLYCLQGE  508
            SGNIRQLYCLQG+
Sbjct  553  SGNIRQLYCLQGD  565



>ref|XP_009629687.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=572

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +QSGSTK+NPFPLPDAYMASQ +  KNL EIKQ LRE ELE+SRK+EL +ALH  FK
Sbjct  495  FEGEQSGSTKNNPFPLPDAYMASQQRRQKNLEEIKQSLREAELEESRKKELTTALHQCFK  554

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQ +
Sbjct  555  DWLYASGNIRQLYCLQND  572



>ref|XP_012087738.1| PREDICTED: TBCC domain-containing protein 1 [Jatropha curcas]
 gb|KDP24597.1| hypothetical protein JCGZ_25513 [Jatropha curcas]
Length=568

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + SGSTKDNPFPLP+AY++SQ +N KNL EIKQ+LRE  LE++RKREL+ ALH+LFK
Sbjct  491  FGRESSGSTKDNPFPLPEAYLSSQQRNQKNLGEIKQLLREAPLEENRKRELSCALHLLFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  551  DWLYASGNIRQLYCLQGD  568



>ref|XP_009797552.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=572

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +QSGSTK+NPFPLPDAYMASQ +  KNL EIKQ LRE +LE+SRK+EL +ALH  FK
Sbjct  495  FEGEQSGSTKNNPFPLPDAYMASQQRRQKNLEEIKQNLREADLEESRKKELTTALHQCFK  554

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQ E
Sbjct  555  DWLYASGNIRQLYCLQNE  572



>ref|XP_010672700.1| PREDICTED: TBCC domain-containing protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=568

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F+ +  G+TKDNPF LP+AYMASQHKN+ NL E+KQ+L+ET L++S+KREL+ ALHVLFK
Sbjct  491  FDGEVPGATKDNPFSLPEAYMASQHKNNTNLGEVKQVLQETPLDESKKRELSCALHVLFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCL G+
Sbjct  551  DWLYASGNIRQLYCLHGD  568



>emb|CDX98257.1| BnaC06g16180D [Brassica napus]
Length=590

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPDAYMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FK
Sbjct  513  FSGEEIGSTKDNPFPLPDAYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFK  572

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  573  DWLYASGNIRQLYCLQGD  590



>ref|XP_009369843.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=564

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPDAYMASQH+N+ NL E+KQ+L+E  LE++RKREL++ALHV FK
Sbjct  488  YGGESQGSTKDNPFPLPDAYMASQHRNN-NLGEVKQLLKEAPLEENRKRELSTALHVYFK  546

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  547  DWLYASGNIRQLYCLQGE  564



>emb|CDX67713.1| BnaA07g17530D [Brassica napus]
Length=598

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPDAYMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FK
Sbjct  521  FSGEEIGSTKDNPFPLPDAYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFK  580

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  581  DWLYASGNIRQLYCLQGD  598



>ref|XP_002323291.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|EEF05052.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=571

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPF LP+AYMASQ +N KNL EIKQ+LRE  LE+++KREL+SALH+LFK
Sbjct  494  FGGESPGSTKDNPFQLPEAYMASQQRNQKNLGEIKQLLREVPLEENQKRELSSALHLLFK  553

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  554  DWLYASGNIRQLYCLQGD  571



>ref|XP_008240958.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Prunus 
mume]
Length=565

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPD Y+ASQ +N  NL E+KQ+LRE  LE++RKREL++ALHV FK
Sbjct  488  YGGESEGSTKDNPFPLPDIYVASQQRNQNNLGEVKQLLREAPLEENRKRELSTALHVYFK  547

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  548  DWLYASGNIRQLYCLQGE  565



>ref|XP_009104081.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Brassica rapa]
Length=554

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLP+AYMA+Q +N KNL E +Q LRET LE++RK+EL+SALHV FK
Sbjct  477  FSGEEIGSTKDNPFPLPEAYMAAQQRNLKNLEETRQSLRETPLEENRKKELSSALHVYFK  536

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  537  DWLYASGNIRQLYCLQGD  554



>ref|XP_009376106.1| PREDICTED: TBCC domain-containing protein 1-like [Pyrus x bretschneideri]
Length=564

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 1/78 (1%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPDAYM SQH+N+ NL E+KQ+L+E  LE++RKREL++ALHV FK
Sbjct  488  YGGESQGSTKDNPFPLPDAYMVSQHRNN-NLGEVKQLLKEAPLEENRKRELSTALHVYFK  546

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  547  DWLYASGNIRQLYCLQGE  564



>ref|XP_011033250.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=569

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPF LP+AY+ASQ +N KNL EIKQ+LRE  LE+++KREL+SALH+LFK
Sbjct  492  FGGESPGSTKDNPFQLPEAYIASQQRNQKNLGEIKQLLREVPLEENQKRELSSALHLLFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  552  DWLYASGNIRQLYCLQGD  569



>ref|XP_004304384.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=569

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  723  GSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            GSTKDNPFPLP+AY+ SQ +N KNL E+KQ+LRE  LED++KREL++ALHV FKDWLYAS
Sbjct  498  GSTKDNPFPLPEAYVESQERNQKNLGEVKQLLREAPLEDNKKRELSTALHVYFKDWLYAS  557

Query  543  GNIRQLYCLQGE  508
            GNIRQLYCLQGE
Sbjct  558  GNIRQLYCLQGE  569



>ref|XP_011020269.1| PREDICTED: TBCC domain-containing protein 1 isoform X3 [Populus 
euphratica]
Length=577

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A+  GSTKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFK
Sbjct  500  FGAESPGSTKDNPFQLPEAYMASQQRNQKNLAETKKLLREAPLEENQKRELSSALHLLFK  559

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGN+RQLYCLQG+
Sbjct  560  DWLYASGNVRQLYCLQGD  577



>ref|XP_011020268.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=579

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A+  GSTKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFK
Sbjct  502  FGAESPGSTKDNPFQLPEAYMASQQRNQKNLAETKKLLREAPLEENQKRELSSALHLLFK  561

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGN+RQLYCLQG+
Sbjct  562  DWLYASGNVRQLYCLQGD  579



>ref|XP_011020267.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=581

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A+  GSTKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFK
Sbjct  504  FGAESPGSTKDNPFQLPEAYMASQQRNQKNLAETKKLLREAPLEENQKRELSSALHLLFK  563

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGN+RQLYCLQG+
Sbjct  564  DWLYASGNVRQLYCLQGD  581



>ref|XP_007162298.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
 gb|ESW34292.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
Length=566

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +GSTK NPF LPDAYMASQ+KN KNL EI+Q+LRE  LE+SRKREL+SALHV F+
Sbjct  489  FGGESTGSTKSNPFTLPDAYMASQNKNQKNLGEIRQLLREAPLEESRKRELSSALHVYFR  548

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLY LQG+
Sbjct  549  DWLYASGNIRQLYFLQGD  566



>emb|CDY61748.1| BnaA04g27540D [Brassica napus]
Length=595

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +GSTKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FK
Sbjct  518  FSGEDTGSTKDNPFPLPDPYMAAQQRNLKNLDETRRSLRETPLEENRKKELSSALHVYFK  577

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  578  DWLYASGNIRQLYCLQGD  595



>emb|CDY06067.1| BnaA09g37130D [Brassica napus]
Length=513

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FK
Sbjct  436  FNGEEIGSTKDNPFPLPDPYMAAQQRNLKNLEETRRSLRETPLEENRKKELSSALHVYFK  495

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  496  DWLYASGNIRQLYCLQGD  513



>ref|XP_006402830.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
 gb|ESQ44283.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
Length=573

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPDAYMA+Q +N K+L E ++ LRET LE++RK+EL+SALHV FK
Sbjct  496  FSGEEIGSTKDNPFPLPDAYMAAQQRNLKSLEETRRSLRETPLEENRKKELSSALHVYFK  555

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  556  DWLYASGNIRQLYCLQGD  573



>emb|CDY47657.1| BnaC04g23940D [Brassica napus]
Length=648

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +GSTKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FK
Sbjct  571  FSGEDTGSTKDNPFPLPDTYMAAQQRNLKNLDETRRSLRETPLEENRKKELSSALHVYFK  630

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  631  DWLYASGNIRQLYCLQGD  648



>emb|CDX71986.1| BnaC08g28880D [Brassica napus]
Length=565

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FK
Sbjct  488  FNGEEIGSTKDNPFPLPDPYMAAQQRNLKNLEETRRSLRETPLEENRKKELSSALHVYFK  547

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  548  DWLYASGNIRQLYCLQGD  565



>gb|AFK40546.1| unknown [Lotus japonicus]
Length=116

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  720  STKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASG  541
            + K+NPF LPD Y+ASQH+N KNL EI+++L+E+ LE+SRKRE +SALHV FKDWLYASG
Sbjct  46   TAKNNPFTLPDVYVASQHRNQKNLGEIRKLLQESSLEESRKREFSSALHVYFKDWLYASG  105

Query  540  NIRQLYCLQGE  508
            NIRQLYCLQG+
Sbjct  106  NIRQLYCLQGD  116



>ref|XP_006381055.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|ERP58852.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=585

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A+  GSTKDNPF LP+AYMASQ +N KNL E K++LRE  LE+++KREL+SALH+LFK
Sbjct  508  FGAESPGSTKDNPFQLPEAYMASQQRNQKNLGETKKLLREAPLEENQKRELSSALHLLFK  567

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGN+RQLYCLQG+
Sbjct  568  DWLYASGNVRQLYCLQGD  585



>ref|XP_010524365.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=569

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  Q  GSTKDNPFPLPDAYMA+Q +N KNL E +Q LR   LE++RKREL+SALH+ FK
Sbjct  492  FGGQSVGSTKDNPFPLPDAYMATQQRNLKNLEETRQSLRGAPLEENRKRELSSALHLYFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  552  DWLYATGNIRQLYCLQGD  569



>ref|XP_009116487.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=570

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPD YMA+Q +N KNL E ++ LR+T LE++RK+EL+SALHV FK
Sbjct  493  FNGEEIGSTKDNPFPLPDPYMAAQQRNLKNLEETRRALRKTPLEENRKKELSSALHVYFK  552

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  553  DWLYASGNIRQLYCLQGD  570



>ref|XP_002876443.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52702.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +++GSTKDNPFPLPD YMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FK
Sbjct  494  FSGEETGSTKDNPFPLPDTYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFK  553

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  554  DWLYASGNIRQLYCLQGD  571



>ref|XP_003625224.1| TBCC domain-containing protein [Medicago truncatula]
 gb|ABN08645.1| Tubulin binding cofactor C [Medicago truncatula]
 gb|AES81442.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=558

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPF LP+ YMASQ +N +NL EI+Q+LRE  LE+SRKREL+SALHV FK
Sbjct  481  LEGESTGSTKDNPFTLPEGYMASQQRNERNLGEIRQLLREAPLEESRKRELSSALHVYFK  540

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLY LQG+
Sbjct  541  DWLYASGNIRQLYYLQGD  558



>ref|XP_009139004.1| PREDICTED: TBCC domain-containing protein 1-like [Brassica rapa]
Length=569

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +G TKDNPFPLPD YMA+Q +N KNL E ++ LRET LE++RK+EL+SALHV FK
Sbjct  492  FSGEDTGLTKDNPFPLPDPYMAAQQRNLKNLDETRRSLRETPLEENRKKELSSALHVYFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  552  DWLYASGNIRQLYCLQGD  569



>ref|XP_004493562.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=555

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  735  AQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDW  556
             + +GSTKDNPF LP+AYMASQ KN KNL EI+Q+LRE  LE+SRK+EL+SALHV FKDW
Sbjct  480  GESTGSTKDNPFTLPEAYMASQQKNEKNLGEIRQLLREAPLEESRKKELSSALHVYFKDW  539

Query  555  LYASGNIRQLYCLQGE  508
            LYASGNIRQLY LQG+
Sbjct  540  LYASGNIRQLYYLQGD  555



>ref|XP_006290821.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 ref|XP_006290822.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23719.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23720.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
Length=573

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FK
Sbjct  496  FSGEDIGSTKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFK  555

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  556  DWLYASGNIRQLYCLQGD  573



>ref|XP_007203759.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
 gb|EMJ04958.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
Length=564

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPD Y+ASQ +N+ NL E+KQ+LRE  LE++RKREL++ALHV FK
Sbjct  488  YGGESEGSTKDNPFPLPDIYVASQQRNN-NLGEVKQLLREAPLEENRKRELSTALHVYFK  546

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  547  DWLYASGNIRQLYCLQGE  564



>emb|CAB67617.1| putative protein [Arabidopsis thaliana]
Length=570

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F   + GSTKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FK
Sbjct  493  FSGAELGSTKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFK  552

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  553  DWLYASGNIRQLYCLQGD  570



>ref|NP_567059.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK96632.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AAL36073.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AEE79713.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=573

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F   + GSTKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FK
Sbjct  496  FSGAELGSTKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFK  555

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  556  DWLYASGNIRQLYCLQGD  573



>ref|XP_008240959.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Prunus 
mume]
Length=564

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPD Y+ASQ +N+ NL E+KQ+LRE  LE++RKREL++ALHV FK
Sbjct  488  YGGESEGSTKDNPFPLPDIYVASQQRNN-NLGEVKQLLREAPLEENRKRELSTALHVYFK  546

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  547  DWLYASGNIRQLYCLQGE  564



>gb|KFK35082.1| hypothetical protein AALP_AA5G233000 [Arabis alpina]
Length=576

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ GSTKDNPFPLPD YMA+Q +N KN  E ++ L+ET LE++RK+EL+SALHV FK
Sbjct  499  FTGEEIGSTKDNPFPLPDPYMAAQQRNLKNFEETRRSLKETPLEENRKKELSSALHVYFK  558

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  559  DWLYASGNIRQLYCLQGD  576



>ref|XP_010427682.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=575

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKRE++SALHV FK
Sbjct  498  FSGEDIGSTKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKREVSSALHVYFK  557

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  558  DWLYASGNIRQLYCLQGD  575



>ref|NP_001190120.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79714.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=609

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F   + GSTKDNPFPLPDAYMA+Q +N KN  E ++ L+E  LE++RKREL+SALHV FK
Sbjct  532  FSGAELGSTKDNPFPLPDAYMAAQQRNLKNFEETRRSLKEAPLEENRKRELSSALHVYFK  591

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  592  DWLYASGNIRQLYCLQGD  609



>ref|XP_008392091.1| PREDICTED: TBCC domain-containing protein 1 [Malus domestica]
Length=564

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            +  +  GSTKDNPFPLPDAYM SQ +N+ NL E+KQ+L E  LE++RKREL++ALHV FK
Sbjct  488  YGGESQGSTKDNPFPLPDAYMVSQXRNN-NLGEVKQLLXEAPLEENRKRELSTALHVYFK  546

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  547  DWLYASGNIRQLYCLQGE  564



>gb|KJB82781.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=397

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + + ST++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FK
Sbjct  320  FEGEPTKSTRNNPFPLPDPYFTSQQRNQKNLGEIQQILREAPLEENRKRELSCALHVYFK  379

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCL G+
Sbjct  380  DWLYASGNIRQLYCLLGD  397



>ref|XP_010507501.1| PREDICTED: uncharacterized protein LOC104784134 [Camelina sativa]
Length=512

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAYMA+Q +N KN  E ++ L E  LE++RKRE++SALHV FK
Sbjct  435  FSGEDIGSTKDNPFPLPDAYMAAQQRNLKNFEETRRSLNEAPLEENRKREVSSALHVYFK  494

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  495  DWLYASGNIRQLYCLQGD  512



>ref|XP_011468069.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = -3

Query  723  GSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            GSTKDNPFPLP+AY+ SQ +N KNL E+KQ+LRE  LED++KREL++ALHV FKDWLYAS
Sbjct  498  GSTKDNPFPLPEAYVESQERN-KNLGEVKQLLREAPLEDNKKRELSTALHVYFKDWLYAS  556

Query  543  GNIRQLYCLQGE  508
            GNIRQLYCLQGE
Sbjct  557  GNIRQLYCLQGE  568



>ref|XP_006342320.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=567

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -3

Query  738  EAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKD  559
            E +QSGSTKDNPFPLPDA++AS+ +NHKNL  +KQIL+E +LE+SRK+EL +ALH  FKD
Sbjct  491  EGKQSGSTKDNPFPLPDAFLASKQRNHKNLEGLKQILQEADLEESRKKELTTALHGCFKD  550

Query  558  WLYASGNIRQLYCLQGE  508
            WLYASGNIRQLY LQ +
Sbjct  551  WLYASGNIRQLYFLQND  567



>gb|KJB82780.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=534

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + + ST++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FK
Sbjct  457  FEGEPTKSTRNNPFPLPDPYFTSQQRNQKNLGEIQQILREAPLEENRKRELSCALHVYFK  516

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCL G+
Sbjct  517  DWLYASGNIRQLYCLLGD  534



>gb|EPS74445.1| hypothetical protein M569_00304, partial [Genlisea aurea]
Length=572

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  732  QQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWL  553
            ++ GST+DNPF LPDAY+ SQ KN KNL E+KQILRET+L++++KREL+SALH  FKDWL
Sbjct  499  EEGGSTEDNPFRLPDAYLVSQQKNLKNLAEVKQILRETQLDEAKKRELSSALHASFKDWL  558

Query  552  YASGNIRQLYCLQG  511
            YASGN+RQLYCL G
Sbjct  559  YASGNVRQLYCLHG  572



>ref|XP_010548390.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=577

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F ++  GSTKDNPFPLPDAY  +Q +N KNL E KQ LRE  LE++RKREL+ ALHV FK
Sbjct  500  FGSESVGSTKDNPFPLPDAYTVAQQRNLKNLEETKQSLREAPLEENRKRELSGALHVHFK  559

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  560  DWLYATGNIRQLYCLQGD  577



>gb|KDO57721.1| hypothetical protein CISIN_1g0403992mg, partial [Citrus sinensis]
Length=219

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +GSTK NPFPLPDAY+A+Q +  K+ VEIK++++E  L+DSRKRE++SALHV F+
Sbjct  142  FGGECAGSTKANPFPLPDAYVAAQQRKQKSWVEIKKLIKEAPLDDSRKREVSSALHVYFR  201

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQ +
Sbjct  202  DWLYATGNIRQLYCLQND  219



>ref|XP_008442093.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis melo]
Length=570

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  723  GSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            G+T  NPFPLPDAY+AS  +N K L E+KQILRET LE++RKREL+SALHV FKDWLYAS
Sbjct  499  GATDCNPFPLPDAYLASLERNKKTLGEVKQILRETPLEENRKRELSSALHVYFKDWLYAS  558

Query  543  GNIRQLYCLQGE  508
            GNIRQLYCLQG+
Sbjct  559  GNIRQLYCLQGD  570



>gb|KJB82776.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
 gb|KJB82779.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=569

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + + ST++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FK
Sbjct  492  FEGEPTKSTRNNPFPLPDPYFTSQQRNQKNLGEIQQILREAPLEENRKRELSCALHVYFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCL G+
Sbjct  552  DWLYASGNIRQLYCLLGD  569



>ref|XP_010265832.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=520

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  720  STKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASG  541
            STK NPFPLP+ YMASQ KN +NL EIKQ LRE +LE+SRKREL+SALHV FKDWLY SG
Sbjct  450  STKHNPFPLPEVYMASQQKNLQNLGEIKQSLRELQLEESRKRELSSALHVYFKDWLYTSG  509

Query  540  NIRQLYCLQGE  508
            NIRQLYCLQG+
Sbjct  510  NIRQLYCLQGD  520



>ref|XP_004146385.1| PREDICTED: TBCC domain-containing protein 1-like [Cucumis sativus]
Length=570

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  723  GSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            G T  NPFPLPDAY+AS  +N K L E+KQILRET LE++RKREL+SALHV FKDWLYAS
Sbjct  499  GDTDCNPFPLPDAYLASLERNKKTLGEVKQILRETPLEENRKRELSSALHVYFKDWLYAS  558

Query  543  GNIRQLYCLQGE  508
            GNIRQLYCLQG+
Sbjct  559  GNIRQLYCLQGD  570



>gb|KEH41654.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=553

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  726  SGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYA  547
            +GSTKDNPF LPDAY ASQHKN  NL E+++++ E  LE+SRKREL+S LHV FKDWLYA
Sbjct  481  TGSTKDNPFALPDAYAASQHKNQNNLEEVRKLIHEASLEESRKRELSSVLHVYFKDWLYA  540

Query  546  SGNIRQLYCLQGE  508
            SGNIRQLYCLQ +
Sbjct  541  SGNIRQLYCLQAD  553



>emb|CDY53502.1| BnaC04g02540D [Brassica napus]
Length=599

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAYMA Q  + KNL E +Q LRET LED+RKREL +A H+ FK
Sbjct  522  FVGEALGSTKDNPFPLPDAYMAVQQTSLKNLEETRQSLRETPLEDNRKRELTTAFHMHFK  581

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  582  DWLYATGNIRQLYCLQGD  599



>ref|XP_010265831.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=567

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  720  STKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASG  541
            STK NPFPLP+ YMASQ KN +NL EIKQ LRE +LE+SRKREL+SALHV FKDWLY SG
Sbjct  497  STKHNPFPLPEVYMASQQKNLQNLGEIKQSLRELQLEESRKRELSSALHVYFKDWLYTSG  556

Query  540  NIRQLYCLQGE  508
            NIRQLYCLQG+
Sbjct  557  NIRQLYCLQGD  567



>ref|NP_973669.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AAU05480.1| At2g42230 [Arabidopsis thaliana]
 gb|AAU95425.1| At2g42230 [Arabidopsis thaliana]
 dbj|BAE98485.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10091.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=568

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  491  FAGEAIGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHMYFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  551  DWLYATGNIRQLYCLQGD  568



>ref|XP_010508603.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=565

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  488  FAGEAVGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELITAFHMHFK  547

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  548  DWLYATGNIRQLYCLQGD  565



>ref|XP_010517737.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=572

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  495  FAGEAVGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELITAFHMHFK  554

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  555  DWLYATGNIRQLYCLQGD  572



>gb|AGJ83863.1| tublin binding cofactor C [Gossypium hirsutum]
Length=570

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +   ST++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALHV FK
Sbjct  493  FEGEPIKSTRNNPFPLPDLYFTSQQRNKKNLGEIQQILREAPLEENRKRELSCALHVYFK  552

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCL G+
Sbjct  553  DWLYASGNIRQLYCLLGD  570



>ref|XP_010506033.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=568

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  491  FAGEAVGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELITAFHMHFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  551  DWLYATGNIRQLYCLQGD  568



>gb|KHG16745.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=569

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +   ST++NPFPLPD Y  SQ +N KNL EI+QILRE  LE++RKREL+ ALH+ FK
Sbjct  492  FEGEPIKSTRNNPFPLPDLYFTSQQRNKKNLGEIQQILREAPLEENRKRELSCALHIYFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCL G+
Sbjct  552  DWLYASGNIRQLYCLLGD  569



>ref|XP_010257397.1| PREDICTED: TBCC domain-containing protein 1-like [Nelumbo nucifera]
Length=575

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  720  STKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASG  541
            STK NPF LP+ YMASQ KNH+NL EIKQ LR+ +LE+SRKREL++ALH+ FKDWLY SG
Sbjct  505  STKHNPFSLPETYMASQQKNHQNLGEIKQALRDLQLEESRKRELSNALHIYFKDWLYTSG  564

Query  540  NIRQLYCLQGE  508
            NIRQLYCLQG+
Sbjct  565  NIRQLYCLQGD  575



>ref|XP_009142814.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=569

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY+A Q  + KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  492  FAGEALGSTKDNPFPLPDAYLAVQQSSLKNLEETRQSLRETPLEENRKRELTTAFHMHFK  551

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GN+RQLYCLQG+
Sbjct  552  DWLYATGNVRQLYCLQGD  569



>emb|CDX79886.1| BnaA05g02700D [Brassica napus]
Length=582

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY+A Q  + KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  505  FAGEALGSTKDNPFPLPDAYLAVQQSSLKNLEETRQSLRETPLEENRKRELTTAFHMHFK  564

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GN+RQLYCLQG+
Sbjct  565  DWLYATGNVRQLYCLQGD  582



>ref|XP_006293916.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
 gb|EOA26814.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
Length=570

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  G+TKDNPFPLP+AY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  493  FAGEAVGTTKDNPFPLPNAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHIHFK  552

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  553  DWLYATGNIRQLYCLQGD  570



>ref|XP_010516427.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010516428.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=612

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPF LPDAYMA+Q +N KN  E ++ L E  LE++RKRE++SALHV FK
Sbjct  535  FSGEDIGSTKDNPFQLPDAYMAAQQRNLKNFEETRRSLNEAPLEENRKREVSSALHVYFK  594

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  595  DWLYASGNIRQLYCLQGD  612



>ref|XP_006411483.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
 gb|ESQ52936.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
Length=572

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  G TKDNPFPLPDAYMA Q  N K L E +Q LRET LE++RKREL +A H+ FK
Sbjct  495  FAGESLGYTKDNPFPLPDAYMAVQQTNLKKLEETRQSLRETPLEENRKRELTTAFHMHFK  554

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  555  DWLYATGNIRQLYCLQGD  572



>ref|XP_006485027.1| PREDICTED: TBCC domain-containing protein 1-like [Citrus sinensis]
Length=568

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +GSTK NPFPLPDAY+A+Q +  K+ VEIK++++E  L+D+RKRE++SALHV F+
Sbjct  491  FGGECAGSTKANPFPLPDAYVAAQQRKQKSWVEIKKLIKEAPLDDNRKREVSSALHVYFR  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQ +
Sbjct  551  DWLYATGNIRQLYCLQND  568



>gb|KJB36107.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
 gb|KJB36109.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=347

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+
Sbjct  270  LEGESTGSTKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFR  329

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYC Q +
Sbjct  330  DWLYASGNIRQLYCQQSD  347



>ref|XP_006437044.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
 gb|ESR50284.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
Length=568

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  + +GSTK NPFPLPDAY+A+Q +  K+ VEIK++++E  L+D+RKRE++SALHV F+
Sbjct  491  FGGECAGSTKANPFPLPDAYVAAQQRKQKSWVEIKKLIKEAPLDDNRKREVSSALHVYFR  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQ +
Sbjct  551  DWLYATGNIRQLYCLQND  568



>gb|KJB36111.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=377

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+
Sbjct  300  LEGESTGSTKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFR  359

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYC Q +
Sbjct  360  DWLYASGNIRQLYCQQSD  377



>gb|KJB36108.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=398

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+
Sbjct  321  LEGESTGSTKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFR  380

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYC Q +
Sbjct  381  DWLYASGNIRQLYCQQSD  398



>ref|XP_004497930.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=561

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  735  AQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDW  556
             + +GSTKDNPF LPDAY ASQ +N K+L E++Q+++E  LE++RKRE +S LHV FKDW
Sbjct  486  GESTGSTKDNPFALPDAYAASQLRNQKSLGELRQLIQEASLEENRKREFSSVLHVHFKDW  545

Query  555  LYASGNIRQLYCLQGE  508
            L+ASGNIRQLYCLQGE
Sbjct  546  LHASGNIRQLYCLQGE  561



>ref|XP_008778358.1| PREDICTED: TBCC domain-containing protein 1-like, partial [Phoenix 
dactylifera]
Length=374

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRE+A ALHV FK
Sbjct  297  FGVESPGSTKYNPFPLPEIYKASEKKNNSIVCDIQQAIRDAQLEESRKREMACALHVHFK  356

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  357  DWLYASGNIRQLYCLQGD  374



>gb|KJB36105.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=555

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+
Sbjct  478  LEGESTGSTKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFR  537

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYC Q +
Sbjct  538  DWLYASGNIRQLYCQQSD  555



>gb|KJB36106.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=606

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+
Sbjct  529  LEGESTGSTKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFR  588

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYC Q +
Sbjct  589  DWLYASGNIRQLYCQQSD  606



>ref|XP_008795746.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1 [Phoenix dactylifera]
Length=577

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRE+A ALHV FK
Sbjct  500  FGVESPGSTKYNPFPLPEIYKASEKKNNSIVCDIQQAIRDAQLEESRKREMACALHVHFK  559

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  560  DWLYASGNIRQLYCLQGD  577



>gb|AFW66197.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
 gb|AFW66198.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=136

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ G+T  NPFPLP+ Y  SQ K    L +I++++RE +L+++RKRELA+ALHV FK
Sbjct  59   FGDERQGTTNRNPFPLPEIYGTSQSKKRSALEDIQKMIRELQLDENRKRELATALHVQFK  118

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  119  DWLYASGNIRQLYCLQGD  136



>ref|XP_010928451.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  723  GSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            GSTK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRELA ALHV FKDWLYAS
Sbjct  486  GSTKYNPFPLPEIYKASEKKNNSVVCDIQQAIRDAQLEESRKRELACALHVHFKDWLYAS  545

Query  543  GNIRQLYCLQGE  508
            GNIRQLYCLQG+
Sbjct  546  GNIRQLYCLQGD  557



>ref|NP_001058077.1| Os06g0614300 [Oryza sativa Japonica Group]
 dbj|BAD35569.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAD35914.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAF19991.1| Os06g0614300 [Oryza sativa Japonica Group]
Length=581

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FEAQ  G TK NPF LP+ Y ASQ K H +L +I++ +RE EL+D+RK+ELASALH  FK
Sbjct  506  FEAQ--GPTKYNPFTLPEVYWASQRKKHVSLEDIQKNIRELELDDTRKKELASALHAQFK  563

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  564  DWLYASGNIRQLYCLQGE  581



>gb|EEC80975.1| hypothetical protein OsI_23703 [Oryza sativa Indica Group]
Length=568

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FEAQ  G TK NPF LP+ Y ASQ K H +L +I++ +RE EL+D+RK+ELASALH  FK
Sbjct  493  FEAQ--GPTKYNPFTLPEVYWASQRKKHVSLEDIQKNIRELELDDTRKKELASALHAQFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  551  DWLYASGNIRQLYCLQGE  568



>gb|EEE66013.1| hypothetical protein OsJ_21970 [Oryza sativa Japonica Group]
Length=581

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FEAQ  G TK NPF LP+ Y ASQ K H +L +I++ +RE EL+D+RK+ELASALH  FK
Sbjct  506  FEAQ--GPTKYNPFTLPEVYWASQRKKHVSLEDIQKNIRELELDDTRKKELASALHAQFK  563

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  564  DWLYASGNIRQLYCLQGE  581



>ref|XP_010928450.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Elaeis 
guineensis]
Length=592

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  723  GSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            GSTK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+SRKRELA ALHV FKDWLYAS
Sbjct  521  GSTKYNPFPLPEIYKASEKKNNSVVCDIQQAIRDAQLEESRKRELACALHVHFKDWLYAS  580

Query  543  GNIRQLYCLQGE  508
            GNIRQLYCLQG+
Sbjct  581  GNIRQLYCLQGD  592



>ref|XP_009411800.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A    STKDNPFPLP+ Y ASQ K + NL++I+Q +R   L+++R+REL SALHV FK
Sbjct  504  FGADLPQSTKDNPFPLPEIYGASQQKKNSNLIDIQQAIRNVHLDENRERELTSALHVHFK  563

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQ +
Sbjct  564  DWLYASGNIRQLYCLQAD  581



>ref|XP_009391882.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F A    STK NPFPLP+ Y ASQ K H NL ++++ +R+ +L+++RKRELASALHV F+
Sbjct  504  FGADSPQSTKYNPFPLPEIYRASQKKKHSNLTDVQEAIRDVQLDENRKRELASALHVHFR  563

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQ +
Sbjct  564  DWLYASGNIRQLYCLQSD  581



>ref|XP_008800652.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=577

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +  GSTK NPFPLP+ Y AS+ KN+  + +I++ + + +LE+SRKRELA ALH  FK
Sbjct  500  FEVESLGSTKCNPFPLPEIYKASEKKNNSIMCDIQRAISDAQLEESRKRELACALHAHFK  559

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  560  DWLYASGNIRQLYCLQGD  577



>ref|XP_006657134.1| PREDICTED: TBCC domain-containing protein 1-like, partial [Oryza 
brachyantha]
Length=481

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FEAQ  G T  NPF LP+ Y ASQ K H +L +I++ +RE +L+D+RK+ELASALH  FK
Sbjct  406  FEAQ--GPTNYNPFTLPEIYWASQRKKHVSLEDIQKNIRELKLDDNRKKELASALHAQFK  463

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  464  DWLYASGNIRQLYCLQGE  481



>ref|XP_004965884.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=583

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE Q  G TK NPF LP+ Y ASQ K H +L +I++ +RE E++D+RK+ELA ALH  FK
Sbjct  508  FEPQ--GPTKYNPFTLPEVYWASQRKKHASLEDIQKNIRELEIDDNRKKELACALHAQFK  565

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  566  DWLYASGNIRQLYCLQGE  583



>gb|ACN28202.1| unknown [Zea mays]
 gb|AFW66195.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=579

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ G+T  NPFPLP+ Y  SQ K    L +I++++RE +L+++RKRELA+ALHV FK
Sbjct  502  FGDERQGTTNRNPFPLPEIYGTSQSKKRSALEDIQKMIRELQLDENRKRELATALHVQFK  561

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  562  DWLYASGNIRQLYCLQGD  579



>ref|XP_010943570.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=579

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +   STK NPFPLP+ Y AS+ KN+  + +I+Q +R+ +LE+ RKRELA ALH  F+
Sbjct  502  FGVESLESTKCNPFPLPEIYKASEKKNNSIMCDIQQAIRDAQLEEGRKRELACALHAHFR  561

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  562  DWLYASGNIRQLYCLQGD  579



>gb|KJB15038.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=582

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + +GSTKDNPFPLPDAYM SQ +N KNL EIKQ+LRE  LE++ KREL+SALHV FK
Sbjct  490  FENESTGSTKDNPFPLPDAYMTSQQRNQKNLSEIKQMLREAPLEENWKRELSSALHVYFK  549

Query  561  DWLYASGNIRQLY  523
            DWLY    I   +
Sbjct  550  DWLYGKSIISIFF  562



>dbj|BAJ90629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FEA+  G TK NPF LP+ Y ASQ K + +L +I++ +RE EL+D+RK+ELA ALH  FK
Sbjct  513  FEAE--GPTKYNPFTLPEVYWASQRKKNASLEDIQKSIRELELDDNRKKELACALHSQFK  570

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  571  DWLYASGNIRQLYCLQGE  588



>ref|NP_001168301.1| hypothetical protein [Zea mays]
 gb|ACN27744.1| unknown [Zea mays]
 gb|ACN28930.1| unknown [Zea mays]
 gb|AFW76296.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=574

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +  G TK NPF LP+ Y ASQ K H +L +I++ +RE E++D RK+ELA ALH  FK
Sbjct  499  FEVE--GPTKYNPFTLPEVYWASQRKKHASLEDIQKNIRELEIDDIRKKELACALHAQFK  556

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  557  DWLYASGNIRQLYCLQGE  574



>ref|XP_003563624.1| PREDICTED: TBCC domain-containing protein 1-like [Brachypodium 
distachyon]
Length=583

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FEA+  G TK NPF LP+ Y ASQ K + +L +I++ +RE EL+D+RK+ELA ALH  FK
Sbjct  508  FEAE--GPTKYNPFTLPEVYWASQTKKNASLEDIQKNIRELELDDNRKKELACALHSQFK  565

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQGE
Sbjct  566  DWLYASGNIRQLYCLQGE  583



>ref|XP_004951581.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=578

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++ G T  NPFPLP+ Y A Q K H  L +I++ +RE +L+++RKR+LA+ALH  FK
Sbjct  501  FGDERQGPTTCNPFPLPEIYGACQSKKHSALEDIQKTIRELQLDENRKRDLATALHAQFK  560

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  561  DWLYASGNIRQLYCLQGD  578



>dbj|BAJ93674.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +    TK NPFPLP+ Y ASQ+K    L + K+I+RE +L+++R +ELASALH  FK
Sbjct  493  FEDEVQEPTKCNPFPLPEIYQASQNKKQAVLEDTKKIIRELQLDENRNKELASALHSQFK  552

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  553  DWLYATGNIRQLYCLQGD  570



>ref|XP_003571239.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=568

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +    TK NPFPLP+ Y ASQ K H  L + ++ +RE +++++RK+ELA+ALH  FK
Sbjct  491  FEDEVQEPTKCNPFPLPELYQASQIKKHAVLEDTQKTIRELQIDENRKKELANALHAQFK  550

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYA+GNIRQLYCLQG+
Sbjct  551  DWLYATGNIRQLYCLQGD  568



>ref|XP_002453473.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
 gb|EES06449.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
Length=582

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  ++   T  NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELASALH  FK
Sbjct  505  FGDERQEPTNCNPFPLPEIYGAFQSKKRSALEDIQKMIRELQLDENRKRELASALHAQFK  564

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  565  DWLYASGNIRQLYCLQGD  582



>ref|XP_011033249.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=575

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 5/76 (7%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPF LP+AY+ASQ +N KNL EIKQ+LRE  LE+++KREL+SALH+LFK
Sbjct  492  FGGESPGSTKDNPFQLPEAYIASQQRNQKNLGEIKQLLREVPLEENQKRELSSALHLLFK  551

Query  561  DWLYASGNIRQLYCLQ  514
            DWLY       + CLQ
Sbjct  552  DWLYVC-----VACLQ  562



>gb|AFK39829.1| unknown [Medicago truncatula]
Length=58

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  681  MASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQLYCLQGE  508
            MASQ +N +NL EI+Q+LRE  LE+SRKREL+ ALHV FKDWLYASGNIRQLY LQG+
Sbjct  1    MASQQRNERNLGEIRQLLREAPLEESRKRELSFALHVYFKDWLYASGNIRQLYYLQGD  58



>gb|ABR16182.1| unknown [Picea sitchensis]
Length=609

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            TKDNPF LP+ YMA+Q + + +L +++  LR T+L+D++KRELASA+H  FKDWLYASGN
Sbjct  532  TKDNPFILPNPYMAAQQQKYTSLEDMRASLRNTQLDDTKKRELASAIHGHFKDWLYASGN  591

Query  537  IRQLYCLQ  514
            IRQLYCLQ
Sbjct  592  IRQLYCLQ  599



>gb|KHG18606.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=582

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPFPL D Y+ SQ KN  NL EIKQILRE  LE++ KREL+ ALHV F+
Sbjct  487  LEGESTGSTKDNPFPLTDPYLTSQQKNQNNLGEIKQILREAPLEENLKRELSCALHVYFR  546

Query  561  DWLYASGNIRQLYCLQGE*KCCWM  490
            DWLY S  +  +   Q    CC +
Sbjct  547  DWLYVSSTLLPVPQAQLISFCCGL  570



>ref|XP_008643390.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=566

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  708  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  529
            NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELA+ALH  FKDWLYASGNIRQ
Sbjct  500  NPFPLPEIYEAFQSKKRSALEDIQKMIRELQLDENRKRELAAALHAQFKDWLYASGNIRQ  559

Query  528  LYCLQGE  508
            LYCLQG+
Sbjct  560  LYCLQGD  566



>ref|NP_001144767.1| hypothetical protein [Zea mays]
 gb|ACG42825.1| hypothetical protein [Zea mays]
 gb|AFW70774.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=569

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  708  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  529
            NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELA+ALH  FKDWLYASGNIRQ
Sbjct  503  NPFPLPEIYEAFQSKKRSALEDIQKMIRELQLDENRKRELAAALHAQFKDWLYASGNIRQ  562

Query  528  LYCLQGE  508
            LYCLQG+
Sbjct  563  LYCLQGD  569



>ref|XP_008643389.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN30975.1| unknown [Zea mays]
 gb|AFW70773.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=581

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -3

Query  708  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  529
            NPFPLP+ Y A Q K    L +I++++RE +L+++RKRELA+ALH  FKDWLYASGNIRQ
Sbjct  515  NPFPLPEIYEAFQSKKRSALEDIQKMIRELQLDENRKRELAAALHAQFKDWLYASGNIRQ  574

Query  528  LYCLQGE  508
            LYCLQG+
Sbjct  575  LYCLQGD  581



>ref|XP_006648417.1| PREDICTED: TBCC domain-containing protein 1-like [Oryza brachyantha]
Length=484

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +    TK  PFPLP+ Y  SQ K    L +I++ +RE +++D+RK+ELA+ALH  FK
Sbjct  407  FGTEVQEPTKCCPFPLPEIYGVSQSKKLAALEDIRKTIRELQIDDNRKKELANALHAQFK  466

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  467  DWLYASGNIRQLYCLQGD  484



>gb|EEE56495.1| hypothetical protein OsJ_05741 [Oryza sativa Japonica Group]
Length=544

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +    TK  PFPLP+ Y ASQ K    L +I++ +RE +++D+RK+EL +ALH  FK
Sbjct  467  FGTEVQEPTKCCPFPLPEIYCASQSKKLAALEDIRRTIRELQIDDNRKKELTNALHAQFK  526

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  527  DWLYASGNIRQLYCLQGD  544



>gb|EEC72669.1| hypothetical protein OsI_06222 [Oryza sativa Indica Group]
Length=579

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +    TK  PFPLP+ Y ASQ K    L +I++ +RE +++D+RK+EL +ALH  FK
Sbjct  502  FGTEVQEPTKCCPFPLPEIYCASQSKKLAALEDIRRTIRELQIDDNRKKELTNALHAQFK  561

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  562  DWLYASGNIRQLYCLQGD  579



>ref|NP_001046181.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAD25242.1| tubulin-specific chaperone C-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF08095.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAH00408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=579

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +    TK  PFPLP+ Y ASQ K    L +I++ +RE +++D+RK+EL +ALH  FK
Sbjct  502  FGTEVQEPTKCCPFPLPEIYCASQSKKLAALEDIRRTIRELQIDDNRKKELTNALHAQFK  561

Query  561  DWLYASGNIRQLYCLQGE  508
            DWLYASGNIRQLYCLQG+
Sbjct  562  DWLYASGNIRQLYCLQGD  579



>ref|XP_006850073.1| PREDICTED: TBCC domain-containing protein 1 [Amborella trichopoda]
 gb|ERN11654.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
Length=589

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  708  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  529
            NPF LP AY ASQ K    L EIKQ L E +LE++RKREL SALHV FK+WLYASGNIRQ
Sbjct  523  NPFRLPVAYEASQKKKSMVLNEIKQALIEAQLEENRKRELNSALHVYFKEWLYASGNIRQ  582

Query  528  LYCLQGE  508
            LYCLQG+
Sbjct  583  LYCLQGD  589



>gb|KJB36110.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=342

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
             E + +GSTKDNPFPL D Y+ SQ KN  NL E KQILRE  LE++ KREL+ ALHV F+
Sbjct  270  LEGESTGSTKDNPFPLTDPYLTSQQKNQNNLGETKQILREAPLEENLKRELSCALHVYFR  329

Query  561  DWLYASGNIRQLY  523
            DWLY    I   Y
Sbjct  330  DWLYGKSIIFLFY  342



>ref|XP_010913921.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=577

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  735  AQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDW  556
            A+    TK  PF LP+ Y  SQ + H  L +I+Q LR+ +L+ +RKR+LA ALHV FKDW
Sbjct  502  AESPQPTKYIPFRLPEIYSESQRRKHSVLSDIQQALRDVQLDANRKRDLAMALHVHFKDW  561

Query  555  LYASGNIRQLYCLQGE  508
            LYASGNIRQLYCLQG+
Sbjct  562  LYASGNIRQLYCLQGD  577



>ref|XP_008787292.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=574

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  735  AQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDW  556
            A+    TK  PF LP+ Y  SQ + H  L +I+Q LR+ +L+ +RKR+LA ALHV FKDW
Sbjct  499  AESPQPTKYIPFRLPEIYSESQKRKHSVLSDIQQALRDVQLDANRKRDLAMALHVHFKDW  558

Query  555  LYASGNIRQLYCLQGE  508
            LYASGNIRQLYCLQG+
Sbjct  559  LYASGNIRQLYCLQGD  574



>gb|EEC67872.1| hypothetical protein OsI_35505 [Oryza sativa Indica Group]
Length=349

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T  NPFPLP+ Y   Q K H  L +I++ + E +L+++RKR+LA+ALH  FK WLYASGN
Sbjct  280  TNCNPFPLPEIYGTFQSKKHSALEDIQKTIWELQLDENRKRDLATALHAQFKGWLYASGN  339

Query  537  IRQLYCLQGE  508
            IRQLYCLQG+
Sbjct  340  IRQLYCLQGD  349



>ref|XP_002881827.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58086.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +  GSTKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  491  FEGEALGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETSLEENRKRELTTAFHMHFK  550

Query  561  DWLYAS  544
            DWLY +
Sbjct  551  DWLYGN  556



>gb|KGN54813.1| hypothetical protein Csa_4G507430 [Cucumis sativus]
Length=561

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  723  GSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            G T  NPFPLPDAY+AS  +N K L E+KQILRET LE++RKREL+SALHV FKDWLY  
Sbjct  499  GDTDCNPFPLPDAYLASLERNKKTLGEVKQILRETPLEENRKRELSSALHVYFKDWLYGR  558

Query  543  GNI  535
              +
Sbjct  559  AKL  561



>ref|NP_181752.3| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC10092.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=562

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  491  FAGEAIGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHMYFK  550

Query  561  DWLYAS  544
            DWLY +
Sbjct  551  DWLYGN  556



>gb|AAB88648.1| hypothetical protein [Arabidopsis thaliana]
Length=551

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            F  +  GSTKDNPFPLPDAY A Q  N KNL E +Q LRET LE++RKREL +A H+ FK
Sbjct  439  FAGEAIGSTKDNPFPLPDAYKAVQQTNLKNLEETRQSLRETPLEENRKRELTTAFHMYFK  498

Query  561  DWLYA  547
            DWLY 
Sbjct  499  DWLYV  503



>gb|KHF98763.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=598

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 10/83 (12%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE + +GSTKDNPFPLPDAY+ SQ +N KNL EIKQILRE  LE++RKREL+ ALH+   
Sbjct  493  FEGESAGSTKDNPFPLPDAYLKSQLRNQKNLSEIKQILREAPLEENRKRELSCALHLPVT  552

Query  561  DWLYAS----------GNIRQLY  523
               Y +          G IRQ+Y
Sbjct  553  YVSYTAYKVIETLRLRGVIRQVY  575



>gb|KJB15037.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=536

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -3

Query  657  KNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQLYCLQGE  508
            KNL EIKQ+LRE  LE++ KREL+SALHV FKDWLYASGNIRQLYCLQG+
Sbjct  487  KNLSEIKQMLREAPLEENWKRELSSALHVYFKDWLYASGNIRQLYCLQGD  536



>gb|ACM17606.1| tubulin-specific chaperon-like protein [Oryza sativa Indica Group]
Length=389

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 53/99 (54%), Gaps = 29/99 (29%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLY----  550
            T  NPFPLP+ Y   Q K H  L +I++ + E +L+++RKR+LA+ALH  FK WLY    
Sbjct  291  TNCNPFPLPEIYGTFQSKKHSALEDIQKTIWELQLDENRKRDLATALHAQFKGWLYGIDS  350

Query  549  -------------------------ASGNIRQLYCLQGE  508
                                     ASGNIRQLYCLQG+
Sbjct  351  APATSSYEQLLQMLLAENDSHLSGVASGNIRQLYCLQGD  389



>ref|XP_002964936.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
 gb|EFJ33774.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
Length=599

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T+ NPF LP  Y+ +Q + +K +  ++ +L+   L+D+RKR+L++A+H  FK+WLY SGN
Sbjct  525  TRANPFLLPKLYLMAQQQRNKAMENLRHLLQNVPLDDNRKRDLSNAIHAHFKEWLYGSGN  584

Query  537  IRQLYCLQ  514
            IRQLY LQ
Sbjct  585  IRQLYDLQ  592



>ref|XP_002986516.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
 gb|EFJ12373.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
Length=570

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T+ NPF LP  Y+ +Q + +K +  ++ +L+   L+D+RKR+L++A+H  FK+WLY SGN
Sbjct  496  TRANPFLLPKLYLMAQQQRNKAMENLRHLLQNVPLDDNRKRDLSNAIHAHFKEWLYGSGN  555

Query  537  IRQLYCLQ  514
            IRQLY LQ
Sbjct  556  IRQLYDLQ  563



>gb|EMT07109.1| TBCC domain-containing protein 1 [Aegilops tauschii]
Length=511

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FEA+  G TK NPF LP+ Y ASQ K + +L +I++ +RE EL+D+RK+ELA ALH  FK
Sbjct  408  FEAE--GPTKYNPFTLPEVYWASQRKKNASLEDIQKNIRELELDDNRKKELACALHAQFK  465

Query  561  DWLYA  547
            DWLY 
Sbjct  466  DWLYG  470



>gb|EMT00776.1| hypothetical protein F775_29395 [Aegilops tauschii]
Length=224

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +    TK NPFPLP+ Y ASQ K    L + K+ +RE +L+++RK+ELASALH  FK
Sbjct  82   FEDEVQEPTKCNPFPLPEIYQASQSKKQAVLEDSKKTIRELQLDENRKKELASALHSQFK  141

Query  561  DWLYA  547
            DWLY 
Sbjct  142  DWLYV  146



>ref|XP_010233970.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Brachypodium 
distachyon]
Length=560

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFK  562
            FE +    TK NPFPLP+ Y ASQ K H  L + ++ +RE +++++RK+ELA+ALH  FK
Sbjct  491  FEDEVQEPTKCNPFPLPELYQASQIKKHAVLEDTQKTIRELQIDENRKKELANALHAQFK  550

Query  561  DWLYAS  544
            DWLYA+
Sbjct  551  DWLYAA  556



>ref|XP_001757659.1| predicted protein [Physcomitrella patens]
 gb|EDQ77716.1| predicted protein [Physcomitrella patens]
Length=608

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T+ NPF LP  Y+ +Q    K    +KQ LR   LE+ +KREL SA+H  F+DWL+ASGN
Sbjct  529  TRANPFLLPKPYLLAQQHRCKAAEILKQNLRTALLEEGKKRELISAIHGHFRDWLFASGN  588

Query  537  IRQLYCLQG  511
            IRQ+Y LQ 
Sbjct  589  IRQIYDLQA  597



>ref|XP_001778693.1| predicted protein [Physcomitrella patens]
 gb|EDQ56486.1| predicted protein, partial [Physcomitrella patens]
Length=584

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T+ NPF LP  Y+ +Q    K    +KQ L+   LED ++REL SA+   F+DWL A+GN
Sbjct  505  TRANPFLLPKPYLLAQQHRCKAAETLKQNLKTALLEDGKERELISAIQGHFRDWLVATGN  564

Query  537  IRQLYCLQG  511
            IRQ+Y LQ 
Sbjct  565  IRQMYGLQA  573



>ref|XP_001765734.1| predicted protein [Physcomitrella patens]
 gb|EDQ69325.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T+ NPF LP  Y+ +Q    K    +KQ L+   LE+ +KR +  A+H  F+DWL+ASGN
Sbjct  481  TRANPFLLPKPYLLAQQHRCKAAENLKQNLKTITLEEGKKRGVILAIHGHFRDWLFASGN  540

Query  537  IRQLYCLQG  511
            IRQ+Y LQ 
Sbjct  541  IRQIYELQA  549



>ref|XP_001758135.1| predicted protein [Physcomitrella patens]
 gb|EDQ76957.1| predicted protein [Physcomitrella patens]
Length=579

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T  NPF LP  Y+A+  +  +    +K  ++   LE  ++REL +A+H  F+DWLYASG+
Sbjct  509  TSANPFILPQLYIAAVEQRSRAAETLKLNIKNAALEVDKERELVAAIHSHFRDWLYASGS  568

Query  537  IRQLY  523
            IRQLY
Sbjct  569  IRQLY  573



>gb|EMS64518.1| TBCC domain-containing protein 1 [Triticum urartu]
Length=472

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 29/93 (31%)
 Frame = -3

Query  741  FEAQQSGSTKDNPFPLPDAYMASQHKN---------------------------HKNLVE  643
            FEA+  GSTK NPF LP+ Y ASQ K                            + +L +
Sbjct  382  FEAE--GSTKYNPFTLPEVYWASQRKKVFRSFTIGARLRGSVLPLKIPQLALSLNASLED  439

Query  642  IKQILRETELEDSRKRELASALHVLFKDWLYAS  544
            I++ +RE EL+D+RK+ELA ALH  FKDWLY +
Sbjct  440  IQKNIRELELDDNRKKELACALHAQFKDWLYGN  472



>ref|XP_003060588.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55357.1| predicted protein [Micromonas pusilla CCMP1545]
Length=490

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T+ NPF +P+AY+ +  +  +++  ++  +R+  L+D +KREL + +   FK+WL  SG+
Sbjct  417  TQANPFSVPEAYVRALDQKVRSVASLRAAMRDAGLDDDQKRELQATIQAYFKEWLLTSGS  476

Query  537  IRQLY  523
            +RQ+Y
Sbjct  477  MRQVY  481



>ref|XP_005651291.1| TBCC-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26747.1| TBCC-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=575

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -3

Query  726  SGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYA  547
            SG    +PF LP  Y  ++ +    + +++  ++   L+D +KREL + +   FKDWL  
Sbjct  473  SGPLAPSPFRLPAVYEEAKERKVSAVSDLRNAVKAASLDDGKKRELQAVIQSYFKDWLMT  532

Query  546  SGNIRQLYCL  517
            SGN+RQ+Y L
Sbjct  533  SGNMRQVYDL  542



>ref|XP_011396281.1| TBCC domain-containing protein 1 [Auxenochlorella protothecoides]
 gb|KFM23411.1| TBCC domain-containing protein 1 [Auxenochlorella protothecoides]
Length=472

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -3

Query  708  NPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIRQ  529
            +PFPLP  Y  +         E++  ++E  LE+ R+REL +A+   FKDWL ++G++R 
Sbjct  393  SPFPLPQQYFETWEAKMAAAGEVRAAVKEAALEEGRRRELMAAIQASFKDWLQSTGSMRH  452

Query  528  LY  523
            +Y
Sbjct  453  VY  454



>ref|XP_002505027.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66285.1| predicted protein [Micromonas sp. RCC299]
Length=634

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -3

Query  717  TKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGN  538
            T+ NPF +P  Y+ +     K +  ++  LR+  L++  +REL + +   FK+WL  SG+
Sbjct  561  TQANPFAVPPEYVRALDAKVKAVASLRSALRDAGLDERSRRELQATIQAFFKEWLMTSGS  620

Query  537  IRQLY  523
            +RQ+Y
Sbjct  621  MRQVY  625



>gb|ETP20620.1| hypothetical protein F441_05699 [Phytophthora parasitica CJ01A1]
Length=1302

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711   DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
             + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  1223  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  1282

Query  531   QL  526
             Q+
Sbjct  1283  QI  1284



>gb|ETI50864.1| hypothetical protein F443_05691 [Phytophthora parasitica P1569]
Length=1302

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711   DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
             + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  1223  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  1282

Query  531   QL  526
             Q+
Sbjct  1283  QI  1284



>ref|XP_008903430.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETL44151.1| hypothetical protein L916_05494 [Phytophthora parasitica]
 gb|ETN11400.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=655

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  531  QL  526
            Q+
Sbjct  636  QI  637



>gb|ETO79606.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP48551.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=655

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  531  QL  526
            Q+
Sbjct  636  QI  637



>gb|ETL97323.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM50474.1| hypothetical protein, variant [Phytophthora parasitica]
Length=655

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  531  QL  526
            Q+
Sbjct  636  QI  637



>gb|ETK90738.1| hypothetical protein L915_05554 [Phytophthora parasitica]
Length=655

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  576  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  635

Query  531  QL  526
            Q+
Sbjct  636  QI  637



>gb|ETO79605.1| hypothetical protein F444_05744 [Phytophthora parasitica P1976]
 gb|ETP48550.1| hypothetical protein F442_05738 [Phytophthora parasitica P10297]
Length=699

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  620  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  679

Query  531  QL  526
            Q+
Sbjct  680  QI  681



>ref|XP_008903429.1| hypothetical protein PPTG_22581 [Phytophthora parasitica INRA-310]
 gb|ETN11399.1| hypothetical protein PPTG_22581 [Phytophthora parasitica INRA-310]
Length=699

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  620  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  679

Query  531  QL  526
            Q+
Sbjct  680  QI  681



>gb|ETL97322.1| hypothetical protein L917_05380 [Phytophthora parasitica]
 gb|ETM50473.1| hypothetical protein L914_05503 [Phytophthora parasitica]
Length=699

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  620  ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  679

Query  531  QL  526
            Q+
Sbjct  680  QI  681



>ref|XP_009514404.1| hypothetical protein PHYSODRAFT_358230 [Phytophthora sojae]
 gb|EGZ27129.1| hypothetical protein PHYSODRAFT_358230 [Phytophthora sojae]
Length=723

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -3

Query  735  AQQSGSTKDNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDW  556
            A  SG   + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+W
Sbjct  638  AAGSGPA-ERPFPIPPEYVAAVRKQYETVESLRQLVTSDEFDLTKKRTMEVVIQLKFKEW  696

Query  555  LYASGNIRQL  526
            L ++ N+RQ+
Sbjct  697  LSSTSNVRQI  706



>ref|XP_002909594.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY58408.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=706

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  711  DNPFPLPDAYMASQHKNHKNLVEIKQILRETELEDSRKRELASALHVLFKDWLYASGNIR  532
            + PFP+P  Y+A+  K ++ +  ++Q++   E + ++KR +   + + FK+WL ++ N+R
Sbjct  625  ERPFPIPPEYVAAVRKQYETVDSLRQLVTSDEFDLTKKRTMEVVIQLKFKEWLSSTSNVR  684

Query  531  QL  526
            Q+
Sbjct  685  QI  686



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1400076157675