BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10352

Length=823
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621368.1|  PREDICTED: sucrose nonfermenting 4-like prot...    283   8e-89   Nicotiana tomentosiformis
ref|XP_009801936.1|  PREDICTED: sucrose nonfermenting 4-like prot...    282   1e-88   Nicotiana sylvestris
ref|XP_009621367.1|  PREDICTED: sucrose nonfermenting 4-like prot...    283   2e-88   Nicotiana tomentosiformis
ref|XP_009801935.1|  PREDICTED: sucrose nonfermenting 4-like prot...    282   4e-88   Nicotiana sylvestris
ref|XP_004229201.1|  PREDICTED: sucrose nonfermenting 4-like protein    280   2e-87   Solanum lycopersicum
ref|XP_011090936.1|  PREDICTED: sucrose nonfermenting 4-like protein    275   4e-85   Sesamum indicum [beniseed]
ref|XP_011071458.1|  PREDICTED: sucrose nonfermenting 4-like protein    270   3e-83   Sesamum indicum [beniseed]
ref|XP_003533466.1|  PREDICTED: sucrose nonfermenting 4-like prot...    270   3e-83   Glycine max [soybeans]
ref|XP_006586934.1|  PREDICTED: sucrose nonfermenting 4-like prot...    270   3e-83   Glycine max [soybeans]
gb|EYU43924.1|  hypothetical protein MIMGU_mgv1a007064mg                267   7e-83   Erythranthe guttata [common monkey flower]
gb|KHN26574.1|  Sucrose nonfermenting 4-like protein                    270   9e-83   Glycine soja [wild soybean]
ref|XP_006342753.1|  PREDICTED: sucrose nonfermenting 4-like prot...    268   1e-82   Solanum tuberosum [potatoes]
gb|KDO75158.1|  hypothetical protein CISIN_1g010368mg                   266   1e-82   Citrus sinensis [apfelsine]
ref|XP_011016465.1|  PREDICTED: sucrose nonfermenting 4-like protein    261   4e-82   Populus euphratica
emb|CDO98887.1|  unnamed protein product                                266   5e-82   Coffea canephora [robusta coffee]
gb|KDO75154.1|  hypothetical protein CISIN_1g010368mg                   265   2e-81   Citrus sinensis [apfelsine]
gb|KDO75156.1|  hypothetical protein CISIN_1g010368mg                   265   2e-81   Citrus sinensis [apfelsine]
gb|KDO75157.1|  hypothetical protein CISIN_1g010368mg                   265   2e-81   Citrus sinensis [apfelsine]
ref|XP_006419618.1|  hypothetical protein CICLE_v10004799mg             265   2e-81   Citrus clementina [clementine]
ref|XP_003546378.1|  PREDICTED: sucrose nonfermenting 4-like prot...    264   5e-81   Glycine max [soybeans]
ref|XP_006597745.1|  PREDICTED: sucrose nonfermenting 4-like prot...    264   5e-81   Glycine max [soybeans]
gb|KHN47756.1|  Sucrose nonfermenting 4-like protein                    264   6e-81   Glycine soja [wild soybean]
ref|XP_006489115.1|  PREDICTED: sucrose nonfermenting 4-like prot...    263   9e-81   Citrus sinensis [apfelsine]
ref|XP_010098308.1|  Sucrose nonfermenting 4-like protein               261   4e-80   Morus notabilis
ref|XP_012069369.1|  PREDICTED: sucrose nonfermenting 4-like protein    261   8e-80   Jatropha curcas
gb|KDP40000.1|  hypothetical protein JCGZ_01998                         261   8e-80   Jatropha curcas
ref|XP_008458476.1|  PREDICTED: sucrose nonfermenting 4-like protein    261   1e-79   Cucumis melo [Oriental melon]
ref|XP_011044505.1|  PREDICTED: sucrose nonfermenting 4-like prot...    260   1e-79   Populus euphratica
ref|XP_011657174.1|  PREDICTED: sucrose nonfermenting 4-like protein    261   1e-79   Cucumis sativus [cucumbers]
ref|XP_002314455.2|  hypothetical protein POPTR_0010s02420g             257   1e-78   
ref|XP_006584037.1|  PREDICTED: sucrose nonfermenting 4-like prot...    257   2e-78   Glycine max [soybeans]
ref|XP_004296819.1|  PREDICTED: sucrose nonfermenting 4-like prot...    257   2e-78   Fragaria vesca subsp. vesca
ref|XP_011462705.1|  PREDICTED: sucrose nonfermenting 4-like prot...    257   2e-78   Fragaria vesca subsp. vesca
ref|XP_003550198.1|  PREDICTED: sucrose nonfermenting 4-like prot...    257   2e-78   Glycine max [soybeans]
ref|XP_008361991.1|  PREDICTED: sucrose nonfermenting 4-like protein    251   3e-78   
ref|XP_008340939.1|  PREDICTED: sucrose nonfermenting 4-like protein    250   3e-78   
ref|XP_004508285.1|  PREDICTED: sucrose nonfermenting 4-like prot...    256   3e-78   Cicer arietinum [garbanzo]
gb|KEH15994.1|  sucrose nonfermenting-like protein                      251   1e-77   Medicago truncatula
ref|XP_010551058.1|  PREDICTED: sucrose nonfermenting 4-like protein    254   3e-77   Tarenaya hassleriana [spider flower]
ref|XP_010104933.1|  Sucrose nonfermenting 4-like protein               250   5e-77   
ref|XP_008223132.1|  PREDICTED: sucrose nonfermenting 4-like prot...    252   1e-76   Prunus mume [ume]
ref|XP_009352235.1|  PREDICTED: sucrose nonfermenting 4-like prot...    253   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_009352236.1|  PREDICTED: sucrose nonfermenting 4-like prot...    253   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_006380178.1|  hypothetical protein POPTR_0008s22640g             252   2e-76   Populus trichocarpa [western balsam poplar]
ref|XP_008223131.1|  PREDICTED: sucrose nonfermenting 4-like prot...    252   2e-76   Prunus mume [ume]
ref|XP_007222344.1|  hypothetical protein PRUPE_ppa004800mg             252   2e-76   Prunus persica
ref|XP_008223130.1|  PREDICTED: sucrose nonfermenting 4-like prot...    252   2e-76   Prunus mume [ume]
ref|XP_002319007.1|  kinase family protein                              251   4e-76   
gb|KDO56296.1|  hypothetical protein CISIN_1g011558mg                   247   4e-76   Citrus sinensis [apfelsine]
gb|KDO56297.1|  hypothetical protein CISIN_1g011558mg                   248   4e-76   Citrus sinensis [apfelsine]
ref|XP_011014797.1|  PREDICTED: sucrose nonfermenting 4-like prot...    250   5e-76   Populus euphratica
ref|XP_006433347.1|  hypothetical protein CICLE_v10000984mg             247   6e-76   
ref|XP_011023639.1|  PREDICTED: sucrose nonfermenting 4-like protein    250   7e-76   Populus euphratica
ref|XP_011036820.1|  PREDICTED: sucrose nonfermenting 4-like protein    250   8e-76   Populus euphratica
ref|XP_011014792.1|  PREDICTED: sucrose nonfermenting 4-like prot...    250   1e-75   Populus euphratica
gb|KEH15992.1|  sucrose nonfermenting-like protein                      249   2e-75   Medicago truncatula
gb|AES91833.2|  sucrose nonfermenting-like protein                      249   3e-75   Medicago truncatula
ref|XP_010524503.1|  PREDICTED: sucrose nonfermenting 4-like protein    249   3e-75   Tarenaya hassleriana [spider flower]
ref|XP_008246396.1|  PREDICTED: sucrose nonfermenting 4-like protein    248   4e-75   Prunus mume [ume]
ref|XP_006433348.1|  hypothetical protein CICLE_v10000984mg             246   4e-75   
ref|XP_010659865.1|  PREDICTED: sucrose nonfermenting 4-like prot...    247   5e-75   Vitis vinifera
ref|XP_004494610.1|  PREDICTED: sucrose nonfermenting 4-like prot...    248   6e-75   
ref|XP_007154249.1|  hypothetical protein PHAVU_003G103000g             248   8e-75   Phaseolus vulgaris [French bean]
ref|XP_004494609.1|  PREDICTED: sucrose nonfermenting 4-like prot...    248   9e-75   Cicer arietinum [garbanzo]
ref|XP_006382512.1|  kinase family protein                              247   9e-75   Populus trichocarpa [western balsam poplar]
gb|KJB26425.1|  hypothetical protein B456_004G240500                    246   9e-75   Gossypium raimondii
ref|XP_003633645.1|  PREDICTED: sucrose nonfermenting 4-like prot...    247   2e-74   Vitis vinifera
gb|KJB26424.1|  hypothetical protein B456_004G240500                    246   2e-74   Gossypium raimondii
ref|XP_010938454.1|  PREDICTED: sucrose nonfermenting 4-like protein    246   4e-74   Elaeis guineensis
gb|EMT02275.1|  hypothetical protein F775_30701                         244   5e-74   
ref|XP_006433349.1|  hypothetical protein CICLE_v10000984mg             246   5e-74   Citrus clementina [clementine]
gb|EYU45566.1|  hypothetical protein MIMGU_mgv1a006371mg                244   6e-74   Erythranthe guttata [common monkey flower]
gb|KHF98317.1|  Sucrose nonfermenting 4-like protein                    245   8e-74   Gossypium arboreum [tree cotton]
ref|XP_008648222.1|  PREDICTED: AKINbetagamma-1 protein kinase is...    245   1e-73   
gb|EMS67514.1|  5'-AMP-activated protein kinase subunit gamma           244   2e-73   Triticum urartu
ref|XP_012089045.1|  PREDICTED: sucrose nonfermenting 4-like prot...    243   3e-73   Jatropha curcas
gb|KJB72640.1|  hypothetical protein B456_011G188600                    240   3e-73   Gossypium raimondii
ref|XP_007030947.1|  Sucrose nonfermenting 4                            243   3e-73   
ref|XP_010649750.1|  PREDICTED: sucrose nonfermenting 4-like prot...    242   3e-73   Vitis vinifera
ref|XP_002466066.1|  hypothetical protein SORBIDRAFT_01g000600          243   9e-73   
ref|NP_001051949.1|  Os03g0856400                                       242   1e-72   
ref|XP_006650929.1|  PREDICTED: sucrose nonfermenting 4-like prot...    242   1e-72   Oryza brachyantha
ref|XP_008789953.1|  PREDICTED: sucrose nonfermenting 4-like protein    242   2e-72   
gb|KJB72637.1|  hypothetical protein B456_011G188600                    240   2e-72   Gossypium raimondii
ref|XP_002274373.1|  PREDICTED: sucrose nonfermenting 4-like prot...    241   2e-72   Vitis vinifera
ref|XP_003559740.1|  PREDICTED: sucrose nonfermenting 4-like protein    241   3e-72   Brachypodium distachyon [annual false brome]
ref|XP_009791916.1|  PREDICTED: sucrose nonfermenting 4-like protein    241   4e-72   Nicotiana sylvestris
ref|XP_003554656.1|  PREDICTED: sucrose nonfermenting 4-like prot...    240   4e-72   Glycine max [soybeans]
ref|XP_003521702.1|  PREDICTED: sucrose nonfermenting 4-like prot...    240   4e-72   Glycine max [soybeans]
gb|AAG10141.1|AF250335_1  putative activator subunit of SNF1-rela...    238   5e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KHN43289.1|  Sucrose nonfermenting 4-like protein                    240   6e-72   Glycine soja [wild soybean]
ref|XP_003626272.1|  5'-AMP-activated protein kinase subunit beta-1     240   7e-72   Medicago truncatula
gb|AAO61673.1|  AKIN betagamma                                          240   7e-72   Medicago truncatula
ref|XP_010259699.1|  PREDICTED: sucrose nonfermenting 4-like prot...    238   7e-72   Nelumbo nucifera [Indian lotus]
ref|XP_007205127.1|  hypothetical protein PRUPE_ppa004966mg             240   8e-72   Prunus persica
gb|ACN35851.1|  unknown                                                 240   8e-72   Zea mays [maize]
ref|XP_011087405.1|  PREDICTED: sucrose nonfermenting 4-like protein    239   9e-72   Sesamum indicum [beniseed]
gb|KJB72641.1|  hypothetical protein B456_011G188600                    239   1e-71   Gossypium raimondii
ref|NP_001105005.1|  AKINbetagamma-1 protein kinase                     240   1e-71   
ref|XP_004230211.1|  PREDICTED: sucrose nonfermenting 4-like protein    239   1e-71   Solanum lycopersicum
gb|KJB72638.1|  hypothetical protein B456_011G188600                    239   1e-71   Gossypium raimondii
ref|XP_010528891.1|  PREDICTED: sucrose nonfermenting 4-like prot...    238   2e-71   Tarenaya hassleriana [spider flower]
gb|KHG04900.1|  Sucrose nonfermenting 4-like protein                    239   2e-71   Gossypium arboreum [tree cotton]
gb|AGA95983.1|  sucrose non-fermenting 4                                239   2e-71   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_007147040.1|  hypothetical protein PHAVU_006G091100g             239   2e-71   Phaseolus vulgaris [French bean]
gb|KFK43205.1|  hypothetical protein AALP_AA1G093900                    239   2e-71   Arabis alpina [alpine rockcress]
ref|XP_010475723.1|  PREDICTED: sucrose nonfermenting 4-like prot...    238   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010674700.1|  PREDICTED: sucrose nonfermenting 4-like protein    238   3e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB45263.1|  hypothetical protein B456_007G298100                    238   4e-71   Gossypium raimondii
ref|XP_010489630.1|  PREDICTED: sucrose nonfermenting 4-like protein    238   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006417620.1|  hypothetical protein EUTSA_v10007484mg             238   5e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010528890.1|  PREDICTED: sucrose nonfermenting 4-like prot...    238   5e-71   Tarenaya hassleriana [spider flower]
ref|XP_010259697.1|  PREDICTED: sucrose nonfermenting 4-like prot...    238   5e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010259698.1|  PREDICTED: sucrose nonfermenting 4-like prot...    238   6e-71   Nelumbo nucifera [Indian lotus]
emb|CDY32146.1|  BnaCnng06550D                                          238   7e-71   Brassica napus [oilseed rape]
ref|XP_007035544.1|  Sucrose nonfermenting 4                            238   8e-71   
emb|CDX95016.1|  BnaC05g06550D                                          237   9e-71   
emb|CDX93522.1|  BnaA06g05260D                                          237   9e-71   
ref|XP_009148157.1|  PREDICTED: sucrose nonfermenting 4-like protein    237   9e-71   Brassica rapa
ref|XP_002892477.1|  hypothetical protein ARALYDRAFT_470981             237   1e-70   
ref|NP_001105555.1|  protein kinase AKINbetagamma-2                     237   1e-70   
ref|XP_006344633.1|  PREDICTED: sucrose nonfermenting 4-like prot...    237   1e-70   Solanum tuberosum [potatoes]
ref|NP_563834.1|  putative activator subunit of SNF1-related prot...    237   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339832.1|  PREDICTED: sucrose nonfermenting 4-like prot...    237   2e-70   Pyrus x bretschneideri [bai li]
dbj|BAK02043.1|  predicted protein                                      237   2e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009339830.1|  PREDICTED: sucrose nonfermenting 4-like prot...    236   2e-70   Pyrus x bretschneideri [bai li]
emb|CDY22651.1|  BnaC08g42850D                                          236   2e-70   Brassica napus [oilseed rape]
emb|CDY06344.1|  BnaA09g48590D                                          236   2e-70   
dbj|BAO51911.1|  SnRK1 beta-gamma subunit                               236   3e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009588179.1|  PREDICTED: sucrose nonfermenting 4-like protein    236   3e-70   Nicotiana tomentosiformis
emb|CDY31116.1|  BnaA08g26660D                                          236   4e-70   Brassica napus [oilseed rape]
ref|XP_004980982.1|  PREDICTED: sucrose nonfermenting 4-like prot...    236   5e-70   Setaria italica
ref|XP_010458170.1|  PREDICTED: sucrose nonfermenting 4-like protein    235   5e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010024669.1|  PREDICTED: sucrose nonfermenting 4-like prot...    235   6e-70   Eucalyptus grandis [rose gum]
ref|XP_010024670.1|  PREDICTED: sucrose nonfermenting 4-like prot...    234   8e-70   Eucalyptus grandis [rose gum]
ref|XP_010921767.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   9e-70   
ref|XP_009376653.1|  PREDICTED: sucrose nonfermenting 4-like prot...    234   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_009376652.1|  PREDICTED: sucrose nonfermenting 4-like prot...    234   1e-69   Pyrus x bretschneideri [bai li]
gb|KJB45988.1|  hypothetical protein B456_007G342100                    234   1e-69   Gossypium raimondii
ref|XP_010921766.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   4e-69   Elaeis guineensis
ref|XP_010921764.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   4e-69   Elaeis guineensis
ref|XP_010921765.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   4e-69   Elaeis guineensis
ref|XP_009369133.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   5e-69   Pyrus x bretschneideri [bai li]
ref|XP_009369131.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   5e-69   Pyrus x bretschneideri [bai li]
ref|XP_010549774.1|  PREDICTED: sucrose nonfermenting 4-like prot...    229   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_010921763.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   7e-69   Elaeis guineensis
ref|XP_010921762.1|  PREDICTED: sucrose nonfermenting 4-like prot...    233   7e-69   Elaeis guineensis
ref|XP_010269444.1|  PREDICTED: sucrose nonfermenting 4-like prot...    231   4e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010269446.1|  PREDICTED: sucrose nonfermenting 4-like prot...    230   4e-68   Nelumbo nucifera [Indian lotus]
ref|XP_002512390.1|  AMP-activated protein kinase, gamma regulato...    231   5e-68   
ref|XP_010549766.1|  PREDICTED: sucrose nonfermenting 4-like prot...    229   1e-67   Tarenaya hassleriana [spider flower]
gb|KJB28630.1|  hypothetical protein B456_005G059200                    227   1e-67   Gossypium raimondii
gb|KHG18811.1|  Sucrose nonfermenting 4-like protein                    228   1e-67   Gossypium arboreum [tree cotton]
ref|XP_008388557.1|  PREDICTED: sucrose nonfermenting 4-like protein    228   2e-67   
emb|CDP15501.1|  unnamed protein product                                228   4e-67   Coffea canephora [robusta coffee]
ref|XP_006307327.1|  hypothetical protein CARUB_v10008946mg             228   4e-67   
gb|KJB28629.1|  hypothetical protein B456_005G059200                    227   6e-67   Gossypium raimondii
ref|XP_012089047.1|  PREDICTED: sucrose nonfermenting 4-like prot...    227   6e-67   
ref|XP_008802115.1|  PREDICTED: sucrose nonfermenting 4-like protein    227   1e-66   
ref|XP_010904802.1|  PREDICTED: sucrose nonfermenting 4-like prot...    226   2e-66   
ref|XP_012089046.1|  PREDICTED: sucrose nonfermenting 4-like prot...    225   2e-66   
ref|XP_008813370.1|  PREDICTED: sucrose nonfermenting 4-like prot...    225   3e-66   Phoenix dactylifera
ref|XP_008813368.1|  PREDICTED: sucrose nonfermenting 4-like prot...    226   3e-66   Phoenix dactylifera
gb|KHG20472.1|  Sucrose nonfermenting 4-like protein                    225   3e-66   Gossypium arboreum [tree cotton]
ref|XP_010904800.1|  PREDICTED: sucrose nonfermenting 4-like prot...    225   4e-66   Elaeis guineensis
ref|XP_012089044.1|  PREDICTED: sucrose nonfermenting 4-like prot...    225   9e-66   Jatropha curcas
ref|XP_009381016.1|  PREDICTED: sucrose nonfermenting 4-like protein    223   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG02417.1|  Sucrose nonfermenting 4-like protein                    223   3e-65   Gossypium arboreum [tree cotton]
gb|KHN20226.1|  Sucrose nonfermenting 4-like protein                    222   5e-65   Glycine soja [wild soybean]
ref|XP_003609636.1|  5'-AMP-activated protein kinase subunit gamma      222   6e-65   
ref|XP_003555605.1|  PREDICTED: sucrose nonfermenting 4-like prot...    222   6e-65   Glycine max [soybeans]
ref|XP_006419619.1|  hypothetical protein CICLE_v10004799mg             221   2e-64   
ref|XP_004293513.1|  PREDICTED: sucrose nonfermenting 4-like protein    220   3e-64   Fragaria vesca subsp. vesca
gb|KDO75159.1|  hypothetical protein CISIN_1g010368mg                   221   3e-64   Citrus sinensis [apfelsine]
ref|XP_010931610.1|  PREDICTED: sucrose nonfermenting 4-like prot...    218   3e-64   Elaeis guineensis
ref|XP_007138886.1|  hypothetical protein PHAVU_009G246000g             219   4e-64   Phaseolus vulgaris [French bean]
ref|XP_006307328.1|  hypothetical protein CARUB_v10008946mg             219   7e-64   
gb|KJB38630.1|  hypothetical protein B456_006G264100                    219   8e-64   Gossypium raimondii
ref|XP_010931608.1|  PREDICTED: sucrose nonfermenting 4-like prot...    219   8e-64   Elaeis guineensis
ref|XP_010931609.1|  PREDICTED: sucrose nonfermenting 4-like prot...    219   1e-63   Elaeis guineensis
ref|XP_009393220.1|  PREDICTED: sucrose nonfermenting 4-like prot...    218   2e-63   
ref|XP_009393223.1|  PREDICTED: sucrose nonfermenting 4-like prot...    218   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302417.1|  PREDICTED: sucrose nonfermenting 4-like protein    218   2e-63   Fragaria vesca subsp. vesca
gb|KHG04062.1|  Sucrose nonfermenting 4-like protein                    218   7e-63   Gossypium arboreum [tree cotton]
ref|XP_006855487.1|  PREDICTED: sucrose nonfermenting 4-like prot...    214   1e-61   Amborella trichopoda
ref|XP_011627434.1|  PREDICTED: sucrose nonfermenting 4-like prot...    213   1e-61   Amborella trichopoda
ref|XP_009387018.1|  PREDICTED: sucrose nonfermenting 4-like prot...    211   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412087.1|  PREDICTED: sucrose nonfermenting 4-like protein    208   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH32278.1|  sucrose nonfermenting-like protein                      204   2e-58   Medicago truncatula
ref|XP_007144724.1|  hypothetical protein PHAVU_007G179400g             196   3e-55   Phaseolus vulgaris [French bean]
gb|AAB70406.1|  Contains similarity to Rattus AMP-activated prote...    192   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004496022.1|  PREDICTED: sucrose nonfermenting 4-like prot...    195   1e-54   
ref|XP_002991046.1|  hypothetical protein SELMODRAFT_229585             194   3e-54   Selaginella moellendorffii
ref|XP_002991688.1|  hypothetical protein SELMODRAFT_161836             194   3e-54   Selaginella moellendorffii
ref|XP_010475724.1|  PREDICTED: sucrose nonfermenting 4-like prot...    191   2e-53   Camelina sativa [gold-of-pleasure]
gb|KJB45989.1|  hypothetical protein B456_007G342100                    190   5e-53   Gossypium raimondii
ref|XP_009369134.1|  PREDICTED: sucrose nonfermenting 4-like prot...    185   3e-51   
ref|XP_009369135.1|  PREDICTED: sucrose nonfermenting 4-like prot...    185   3e-51   
ref|XP_009384400.1|  PREDICTED: sucrose nonfermenting 4-like prot...    186   4e-51   
ref|XP_010249339.1|  PREDICTED: sucrose nonfermenting 4-like prot...    178   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010249336.1|  PREDICTED: sucrose nonfermenting 4-like prot...    178   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010249337.1|  PREDICTED: sucrose nonfermenting 4-like prot...    178   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010097910.1|  Sucrose nonfermenting 4-like protein               168   3e-46   
gb|KDO75160.1|  hypothetical protein CISIN_1g010368mg                   171   5e-46   Citrus sinensis [apfelsine]
gb|AES61373.2|  sucrose nonfermenting-like protein                      171   8e-46   Medicago truncatula
ref|XP_011044506.1|  PREDICTED: sucrose nonfermenting 4-like prot...    165   5e-44   Populus euphratica
ref|XP_002516895.1|  AMP-activated protein kinase, gamma regulato...    164   4e-43   
gb|KEH32279.1|  sucrose nonfermenting-like protein                      162   1e-42   Medicago truncatula
ref|XP_008776278.1|  PREDICTED: sucrose nonfermenting 4-like protein    158   5e-41   Phoenix dactylifera
ref|XP_003591122.1|  5'-AMP-activated protein kinase subunit beta-1     158   5e-41   
ref|XP_006382517.1|  kinase family protein                              151   8e-41   
ref|XP_001770299.1|  predicted protein                                  156   3e-40   
gb|AFW66924.1|  hypothetical protein ZEAMMB73_799257                    155   4e-40   
gb|KJB72643.1|  hypothetical protein B456_011G188600                    153   3e-39   Gossypium raimondii
gb|KDO56289.1|  hypothetical protein CISIN_1g011558mg                   151   7e-39   Citrus sinensis [apfelsine]
ref|XP_011073279.1|  PREDICTED: sucrose nonfermenting 4-like protein    152   8e-39   Sesamum indicum [beniseed]
ref|XP_010318679.1|  PREDICTED: sucrose nonfermenting 4-like prot...    151   8e-39   Solanum lycopersicum
gb|KJB45264.1|  hypothetical protein B456_007G298100                    150   2e-38   Gossypium raimondii
ref|XP_004235851.1|  PREDICTED: sucrose nonfermenting 4-like prot...    150   2e-38   
emb|CDO98288.1|  unnamed protein product                                148   2e-37   Coffea canephora [robusta coffee]
ref|XP_009778506.1|  PREDICTED: sucrose nonfermenting 4-like prot...    146   6e-37   Nicotiana sylvestris
ref|XP_009778502.1|  PREDICTED: sucrose nonfermenting 4-like prot...    146   7e-37   Nicotiana sylvestris
ref|XP_009778504.1|  PREDICTED: sucrose nonfermenting 4-like prot...    146   8e-37   Nicotiana sylvestris
ref|XP_009778505.1|  PREDICTED: sucrose nonfermenting 4-like prot...    146   9e-37   Nicotiana sylvestris
ref|XP_006341458.1|  PREDICTED: sucrose nonfermenting 4-like prot...    142   1e-35   Solanum tuberosum [potatoes]
ref|XP_006341457.1|  PREDICTED: sucrose nonfermenting 4-like prot...    142   4e-35   Solanum tuberosum [potatoes]
ref|XP_010942339.1|  PREDICTED: sucrose nonfermenting 4-like prot...    141   4e-35   Elaeis guineensis
ref|XP_010942338.1|  PREDICTED: sucrose nonfermenting 4-like prot...    141   5e-35   Elaeis guineensis
dbj|BAH00327.1|  unnamed protein product                                139   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052687.2|  Os04g0401300                                       139   1e-34   
ref|XP_009604833.1|  PREDICTED: sucrose nonfermenting 4-like prot...    139   3e-34   Nicotiana tomentosiformis
ref|XP_009604834.1|  PREDICTED: sucrose nonfermenting 4-like prot...    139   3e-34   Nicotiana tomentosiformis
ref|XP_009604831.1|  PREDICTED: sucrose nonfermenting 4-like prot...    139   3e-34   Nicotiana tomentosiformis
gb|EAY93966.1|  hypothetical protein OsI_15744                          139   4e-34   Oryza sativa Indica Group [Indian rice]
emb|CAD40779.1|  OSJNBb0012E08.3                                        139   4e-34   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66402.1|  OSIGBa0155K12.5                                        138   6e-34   Oryza sativa [red rice]
ref|NP_001145809.1|  SNF4                                               133   2e-33   
gb|ACF84839.1|  unknown                                                 133   2e-33   Zea mays [maize]
ref|XP_003579641.1|  PREDICTED: sucrose nonfermenting 4-like protein    136   3e-33   Brachypodium distachyon [annual false brome]
gb|KHN16117.1|  Sucrose nonfermenting 4-like protein                    129   9e-33   Glycine soja [wild soybean]
ref|XP_004975479.1|  PREDICTED: sucrose nonfermenting 4-like prot...    134   1e-32   Setaria italica
ref|XP_008661809.1|  PREDICTED: uncharacterized protein LOC100279...    132   8e-32   Zea mays [maize]
ref|XP_008661808.1|  PREDICTED: uncharacterized protein LOC100279...    132   9e-32   
ref|XP_009387023.1|  PREDICTED: sucrose nonfermenting 4-like prot...    128   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008668069.1|  PREDICTED: SNF4 isoform X2                         125   2e-29   Zea mays [maize]
ref|NP_001150464.1|  SNF4                                               124   2e-29   Zea mays [maize]
ref|XP_008668068.1|  PREDICTED: SNF4 isoform X1                         124   5e-29   Zea mays [maize]
ref|XP_005842864.1|  hypothetical protein CHLNCDRAFT_142561             122   6e-28   Chlorella variabilis
ref|XP_006590155.1|  PREDICTED: sucrose nonfermenting 4-like prot...    117   1e-27   
ref|XP_003058117.1|  carbohydrate-binding module family 48 protein      118   6e-27   Micromonas pusilla CCMP1545
gb|KJB45265.1|  hypothetical protein B456_007G298100                    114   8e-26   Gossypium raimondii
ref|XP_010921768.1|  PREDICTED: sucrose nonfermenting 4-like prot...    112   6e-25   
ref|XP_009778507.1|  PREDICTED: sucrose nonfermenting 4-like prot...    112   6e-25   Nicotiana sylvestris
ref|XP_001703192.1|  hypothetical protein CHLREDRAFT_140612             112   9e-25   Chlamydomonas reinhardtii
gb|ABA12451.1|  AKINbetagammaI                                          110   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005650760.1|  hypothetical protein COCSUDRAFT_46541              113   3e-24   Coccomyxa subellipsoidea C-169
ref|XP_006307326.1|  hypothetical protein CARUB_v10008946mg             110   4e-24   
ref|XP_009384403.1|  PREDICTED: sucrose nonfermenting 4-like prot...    105   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384402.1|  PREDICTED: sucrose nonfermenting 4-like prot...    105   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009604835.1|  PREDICTED: sucrose nonfermenting 4-like prot...    105   3e-22   Nicotiana tomentosiformis
ref|XP_002953462.1|  hypothetical protein VOLCADRAFT_63727              103   9e-22   Volvox carteri f. nagariensis
ref|XP_011399865.1|  5'-AMP-activated protein kinase subunit gamma-1    102   4e-21   Auxenochlorella protothecoides
gb|KIZ04631.1|  hypothetical protein MNEG_3330                          100   5e-21   Monoraphidium neglectum
gb|EMT18845.1|  hypothetical protein F775_32563                         101   5e-21   
ref|XP_001419967.1|  predicted protein                                98.6    7e-20   Ostreococcus lucimarinus CCE9901
ref|XP_002499707.1|  carbohydrate-binding module family 48 protein    99.4    8e-20   Micromonas commoda
ref|XP_001776518.1|  predicted protein                                94.7    1e-19   
ref|XP_003081623.1|  protein kinase, putative (ISS)                   97.4    2e-19   
emb|CEF99376.1|  CBS domain                                           97.4    3e-19   Ostreococcus tauri
gb|EEC76571.1|  hypothetical protein OsI_14403                        90.9    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006597748.1|  PREDICTED: sucrose nonfermenting 4-like prot...  92.8    4e-18   
gb|KEH15993.1|  sucrose nonfermenting-like protein                    90.9    2e-17   Medicago truncatula
ref|XP_006382523.1|  hypothetical protein POPTR_0005s02970g           85.5    6e-17   
gb|KJB72644.1|  hypothetical protein B456_011G188600                  88.6    1e-16   Gossypium raimondii
ref|XP_011681132.1|  PREDICTED: 5'-AMP-activated protein kinase s...  87.0    2e-16   Strongylocentrotus purpuratus [purple urchin]
ref|XP_010783609.1|  PREDICTED: 5'-AMP-activated protein kinase s...  87.8    3e-16   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011681130.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.7    9e-16   Strongylocentrotus purpuratus [purple urchin]
ref|XP_011681131.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.7    9e-16   Strongylocentrotus purpuratus [purple urchin]
ref|XP_011681129.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.7    9e-16   Strongylocentrotus purpuratus [purple urchin]
ref|XP_010783608.1|  PREDICTED: 5'-AMP-activated protein kinase s...  87.0    1e-15   
ref|XP_011681128.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.7    1e-15   
ref|XP_011681127.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.3    1e-15   
ref|XP_011681125.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.3    1e-15   
ref|XP_011681123.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.3    1e-15   
ref|XP_011681126.1|  PREDICTED: 5'-AMP-activated protein kinase s...  86.3    1e-15   
ref|XP_007559458.1|  PREDICTED: 5'-AMP-activated protein kinase s...  83.2    4e-15   
ref|XP_007559459.1|  PREDICTED: 5'-AMP-activated protein kinase s...  83.2    4e-15   
ref|XP_004068542.1|  PREDICTED: 5'-AMP-activated protein kinase s...  83.2    4e-15   
ref|XP_006629515.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.4    5e-15   
ref|XP_010021772.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    5e-15   
gb|ABM55509.1|  AMP-activated protein kinase gamma2                   82.8    6e-15   
ref|XP_008432313.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.4    6e-15   
ref|XP_010162985.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    6e-15   
ref|XP_009680230.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    8e-15   
ref|XP_010303394.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    9e-15   
ref|XP_009680248.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    9e-15   
ref|XP_005796153.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    9e-15   
ref|XP_010710675.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    1e-14   
ref|XP_005512536.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    1e-14   
ref|XP_009896139.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    1e-14   
ref|XP_010203404.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    1e-14   
ref|NP_001118109.1|  5'-AMP-activated protein kinase gamma-1 subunit  82.0    1e-14   
gb|KFO05412.1|  5'-AMP-activated protein kinase subunit gamma-2       81.6    1e-14   
ref|XP_005424405.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    1e-14   
ref|XP_009465848.1|  PREDICTED: 5'-AMP-activated protein kinase s...  82.0    1e-14   
emb|CDQ66667.1|  unnamed protein product                              81.6    1e-14   
ref|XP_006273606.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    1e-14   
ref|NP_001026136.1|  5'-AMP-activated protein kinase subunit gamm...  81.6    1e-14   
ref|XP_009575009.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.9    1e-14   
pdb|2UV4|A  Chain A, Crystal Structure Of A Cbs Domain Pair From ...  78.6    2e-14   
ref|XP_009465847.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    2e-14   
ref|XP_005527810.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    2e-14   
ref|XP_008944105.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.9    2e-14   
gb|KFQ34946.1|  5'-AMP-activated protein kinase subunit gamma-2       80.9    2e-14   
gb|KDO56290.1|  hypothetical protein CISIN_1g011558mg                 81.6    2e-14   
ref|XP_007528578.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.9    2e-14   
ref|XP_010134411.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    3e-14   
gb|KGL91796.1|  5'-AMP-activated protein kinase subunit gamma-1       80.1    3e-14   
ref|XP_006264694.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    3e-14   
emb|CAG06768.1|  unnamed protein product                              80.5    3e-14   
ref|XP_010118078.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    3e-14   
ref|XP_008290403.1|  PREDICTED: 5'-AMP-activated protein kinase s...  81.6    3e-14   
ref|XP_006035253.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    3e-14   
ref|XP_008254631.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    3e-14   
ref|XP_010564853.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    4e-14   
ref|XP_008175921.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    4e-14   
ref|XP_004863109.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    4e-14   
ref|XP_008254633.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    4e-14   
ref|XP_010883227.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    4e-14   
ref|XP_009881491.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    5e-14   
ref|XP_005476393.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    5e-14   
ref|XP_010883218.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    5e-14   
emb|CDQ59348.1|  unnamed protein product                              79.7    5e-14   
ref|XP_007559456.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.9    6e-14   
ref|XP_006752074.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    6e-14   
ref|XP_005912792.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    6e-14   
ref|XP_008175920.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    6e-14   
ref|XP_002711135.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    6e-14   
ref|XP_005269077.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    6e-14   
gb|KGB39661.1|  5'-AMP-activated protein kinase subunit gamma-1       79.3    6e-14   
ref|XP_010883209.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    7e-14   
gb|KGL79103.1|  5'-AMP-activated protein kinase subunit gamma-2       80.5    7e-14   
ref|XP_004880769.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    7e-14   
ref|XP_005611128.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    7e-14   
ref|XP_010764820.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    7e-14   
ref|XP_004863108.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    7e-14   
ref|XP_008432312.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.5    8e-14   
ref|XP_006035254.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    8e-14   
ref|XP_003252249.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    8e-14   
pdb|2UV6|A  Chain A, Crystal Structure Of A Cbs Domain Pair From ...  76.6    8e-14   
gb|ETE63423.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    8e-14   
ref|XP_005912791.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    8e-14   
pdb|4RER|G  Chain G, Crystal Structure Of The Phosphorylated Huma...  79.0    9e-14   
ref|XP_004388343.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    9e-14   
gb|ABQ59297.1|  AMP-activated protein kinase gamma A                  79.3    9e-14   
ref|XP_004863110.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    9e-14   
ref|XP_007666061.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_004388342.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    1e-13   
ref|XP_004429028.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_008495078.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-AMP-activ...  80.5    1e-13   
ref|XP_009423770.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    1e-13   
ref|NP_001157455.1|  5'-AMP-activated protein kinase subunit gamma-1  79.3    1e-13   
ref|XP_005570799.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    1e-13   
ref|XP_004880770.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_005527809.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.5    1e-13   
ref|NP_001193639.1|  5'-AMP-activated protein kinase subunit gamm...  78.6    1e-13   
ref|XP_006202994.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    1e-13   
ref|XP_008851898.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    1e-13   
ref|XP_006177743.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_009465846.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    1e-13   
ref|XP_006177742.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    1e-13   
ref|XP_011570596.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    1e-13   
ref|XP_010004303.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-AMP-activ...  80.1    1e-13   
ref|XP_010621906.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_003510783.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_009084044.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    1e-13   
ref|XP_010897662.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    1e-13   
ref|XP_543685.2|  PREDICTED: 5'-AMP-activated protein kinase subu...  79.0    1e-13   
ref|XP_008949400.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_008318214.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    1e-13   
ref|XP_002188667.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    1e-13   
gb|ABA62106.1|  5'-AMP-activated protein kinase gamma-2 non-catal...  80.1    1e-13   
ref|NP_001265072.1|  5'-AMP-activated protein kinase subunit gamm...  80.1    1e-13   
ref|XP_004778950.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
gb|AAI09016.1|  Prkag1 protein                                        77.8    1e-13   
gb|ABC70458.1|  AMPK-activated protein kinase gamma-1 subunit         79.0    1e-13   
ref|XP_007666064.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_006202993.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_005155301.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...  80.1    1e-13   
ref|XP_007504706.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_012029742.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    1e-13   
ref|XP_007179352.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    1e-13   
ref|XP_005067260.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    1e-13   
gb|KFO33460.1|  5'-AMP-activated protein kinase subunit gamma-1       79.3    1e-13   
ref|NP_001001642.1|  5'-AMP-activated protein kinase subunit gamma-1  79.0    1e-13   
ref|XP_005480491.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    1e-13   
ref|XP_008702757.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_004880768.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_007073032.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_004778949.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_003252248.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_010728298.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    1e-13   
gb|ERE81174.1|  5'-AMP-activated protein kinase subunit gamma-1       79.0    1e-13   
ref|XP_005241003.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    1e-13   
ref|XP_007559455.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    1e-13   
ref|XP_006755531.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_003988685.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.0    1e-13   
ref|XP_010383721.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_006974446.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_006916879.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_005354002.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_008290402.1|  PREDICTED: 5'-AMP-activated protein kinase s...  80.1    2e-13   
ref|XP_005067259.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|XP_005067258.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_006168274.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|NP_002724.1|  5'-AMP-activated protein kinase subunit gamma-1...  78.6    2e-13   
ref|XP_011366562.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_004429027.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_005324958.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_006000976.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_008069073.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_008138853.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
gb|AAK19307.1|AF329081_1  AMP-activated protein kinase gamma-1        78.6    2e-13   
ref|XP_004088686.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_509039.3|  PREDICTED: 5'-AMP-activated protein kinase subu...  78.6    2e-13   
ref|NP_001252961.1|  5'-AMP-activated protein kinase subunit gamma-1  78.6    2e-13   
ref|XP_004400926.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_005424404.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    2e-13   
ref|XP_006000977.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_011597601.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_005896446.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
gb|KFU95874.1|  5'-AMP-activated protein kinase subunit gamma-2       79.7    2e-13   
ref|XP_005680063.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|NP_777011.2|  5'-AMP-activated protein kinase subunit gamma-1     78.6    2e-13   
ref|XP_006091573.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_006257393.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
dbj|BAJ88150.1|  predicted protein                                    78.6    2e-13   
ref|XP_008702755.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_006902560.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_008851897.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_008138851.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_005981047.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
gb|KFV65282.1|  5'-AMP-activated protein kinase subunit gamma-2       79.7    2e-13   
ref|XP_007179351.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_005877409.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_010856049.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_011485178.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    2e-13   
ref|XP_004400925.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_003973255.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_008949399.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    2e-13   
ref|XP_006933725.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
gb|EOA98220.1|  5'-AMP-activated protein kinase subunit gamma-2       79.7    2e-13   
ref|NP_001135234.1|  5-AMP-activated protein kinase subunit gamma-1   78.2    2e-13   
ref|XP_010594644.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
gb|EPQ14635.1|  5'-AMP-activated protein kinase subunit gamma-1       78.2    2e-13   
ref|XP_006168275.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|XP_009680265.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    2e-13   
gb|ELR55918.1|  5'-AMP-activated protein kinase subunit gamma-1       78.2    2e-13   
ref|XP_007179350.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|XP_007936049.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|XP_003939165.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
gb|ELK36346.1|  5'-AMP-activated protein kinase subunit gamma-1       78.6    2e-13   
ref|XP_004594453.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
gb|EHH20691.1|  5'-AMP-activated protein kinase subunit gamma-1       78.2    2e-13   
ref|XP_005023819.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.7    2e-13   
ref|XP_008318212.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|NP_001193638.1|  5'-AMP-activated protein kinase subunit gamm...  78.2    2e-13   
ref|XP_004053114.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|XP_004692846.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    2e-13   
ref|XP_011243822.1|  PREDICTED: 5'-AMP-activated protein kinase s...  77.8    2e-13   
ref|XP_009885071.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    2e-13   
ref|XP_008641355.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    2e-13   
ref|XP_004594454.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    3e-13   
gb|KGL94722.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    3e-13   
ref|XP_004447006.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    3e-13   
gb|KFW66034.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    3e-13   
ref|XP_009556601.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    3e-13   
ref|NP_998326.1|  5'-AMP-activated protein kinase subunit gamma-1     78.2    3e-13   
ref|XP_007439708.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    3e-13   
gb|KFM13268.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    3e-13   
ref|XP_010745125.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    3e-13   
gb|KFV73763.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    3e-13   
ref|XP_005040622.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    3e-13   
ref|NP_037142.1|  5'-AMP-activated protein kinase subunit gamma-1     77.8    3e-13   
ref|XP_011570588.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    3e-13   
ref|XP_004429026.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.2    3e-13   
ref|XP_011570582.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    3e-13   
gb|KFP03217.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    3e-13   
ref|XP_005527808.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    3e-13   
gb|EMC81546.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    3e-13   
gb|AAC52580.1|  5'-AMP-activated protein kinase, gamma-1 subunit      77.8    3e-13   
pdb|2UV7|A  Chain A, Crystal Structure Of A Cbs Domain Pair From ...  75.1    3e-13   
gb|EDL04164.1|  protein kinase, AMP-activated, gamma 1 non-cataly...  77.8    3e-13   
ref|XP_005241002.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    3e-13   
gb|KFQ99549.1|  5'-AMP-activated protein kinase subunit gamma-2       79.3    3e-13   
ref|XP_010621905.1|  PREDICTED: 5'-AMP-activated protein kinase s...  77.8    3e-13   
ref|XP_010393305.1|  PREDICTED: 5'-AMP-activated protein kinase s...  79.3    3e-13   
gb|ABA62105.1|  5'-AMP-activated protein kinase gamma-2 non-catal...  79.3    3e-13   
ref|XP_010883202.1|  PREDICTED: 5'-AMP-activated protein kinase s...  78.6    3e-13   
ref|NP_001265071.1|  5'-AMP-activated protein kinase subunit gamm...  79.3    3e-13   



>ref|XP_009621368.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nicotiana 
tomentosiformis]
Length=441

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 156/163 (96%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP SLPILQLPI AIPLGTWVPKIGEPNR+PLAMLRPTASL+AAL+LL+QAQV AIP
Sbjct  276  FKHSPESLPILQLPIGAIPLGTWVPKIGEPNRQPLAMLRPTASLNAALDLLVQAQVSAIP  335

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAKDKIYTHI+L+EM+IH+ALQL EEPYAS Y + +++CHM
Sbjct  336  IVDDNDSLLDIYSRSDITALAKDKIYTHISLEEMSIHQALQLAEEPYAS-YGLSSQKCHM  394

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLH+VM++LS+PGVRRL++VEAGSKRVEGIISLSD+F+
Sbjct  395  CLRSDPLHEVMERLSRPGVRRLLVVEAGSKRVEGIISLSDIFK  437



>ref|XP_009801936.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nicotiana 
sylvestris]
Length=441

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 155/163 (95%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP SLPILQLPI +IPLGTWVPKIGEPNR+PLAMLRPTASL+AAL+LL+QAQV AIP
Sbjct  276  FKHSPESLPILQLPIGSIPLGTWVPKIGEPNRQPLAMLRPTASLNAALDLLVQAQVSAIP  335

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAKDKIYTHI+L+EM+IH+ALQL EEPYAS Y   +++CHM
Sbjct  336  IVDDNDSLLDIYSRSDITALAKDKIYTHISLEEMSIHQALQLAEEPYAS-YGSSSQKCHM  394

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLH+VM++LS+PGVRRLV+VEAGSKRVEGIISLSD+F+
Sbjct  395  CLRSDPLHEVMERLSRPGVRRLVVVEAGSKRVEGIISLSDIFK  437



>ref|XP_009621367.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
tomentosiformis]
Length=486

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 156/163 (96%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP SLPILQLPI AIPLGTWVPKIGEPNR+PLAMLRPTASL+AAL+LL+QAQV AIP
Sbjct  321  FKHSPESLPILQLPIGAIPLGTWVPKIGEPNRQPLAMLRPTASLNAALDLLVQAQVSAIP  380

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAKDKIYTHI+L+EM+IH+ALQL EEPYAS Y + +++CHM
Sbjct  381  IVDDNDSLLDIYSRSDITALAKDKIYTHISLEEMSIHQALQLAEEPYAS-YGLSSQKCHM  439

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLH+VM++LS+PGVRRL++VEAGSKRVEGIISLSD+F+
Sbjct  440  CLRSDPLHEVMERLSRPGVRRLLVVEAGSKRVEGIISLSDIFK  482



>ref|XP_009801935.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
sylvestris]
Length=486

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 155/163 (95%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP SLPILQLPI +IPLGTWVPKIGEPNR+PLAMLRPTASL+AAL+LL+QAQV AIP
Sbjct  321  FKHSPESLPILQLPIGSIPLGTWVPKIGEPNRQPLAMLRPTASLNAALDLLVQAQVSAIP  380

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAKDKIYTHI+L+EM+IH+ALQL EEPYAS Y   +++CHM
Sbjct  381  IVDDNDSLLDIYSRSDITALAKDKIYTHISLEEMSIHQALQLAEEPYAS-YGSSSQKCHM  439

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLH+VM++LS+PGVRRLV+VEAGSKRVEGIISLSD+F+
Sbjct  440  CLRSDPLHEVMERLSRPGVRRLVVVEAGSKRVEGIISLSDIFK  482



>ref|XP_004229201.1| PREDICTED: sucrose nonfermenting 4-like protein [Solanum lycopersicum]
 ref|XP_010321096.1| PREDICTED: sucrose nonfermenting 4-like protein [Solanum lycopersicum]
Length=487

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 154/163 (94%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP SLPILQLPI AIPLGTWVPKIGEPNR+PLAMLRPTASL+AALNLL+QAQV AIP
Sbjct  322  FKHSPESLPILQLPIGAIPLGTWVPKIGEPNRQPLAMLRPTASLNAALNLLVQAQVSAIP  381

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAKDKIYTHINL+EM+IH+ALQL EEPYA+ Y + +++CHM
Sbjct  382  IVDDNDSLLDIYSRSDITALAKDKIYTHINLEEMSIHQALQLAEEPYAT-YGLSSQKCHM  440

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL+SD LH+VM++LS+PGVRRLV+VEAGSKRVEGIIS+ D+F+
Sbjct  441  CLQSDSLHEVMERLSRPGVRRLVVVEAGSKRVEGIISVGDIFK  483



>ref|XP_011090936.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=490

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP+SLP+LQ P+ AIP+GTWVPKIGEPNRRPLAMLRP ASLS+ALNLLIQAQV +IP
Sbjct  324  FKHSPSSLPVLQFPLFAIPVGTWVPKIGEPNRRPLAMLRPNASLSSALNLLIQAQVSSIP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD+YSRSDIT LAKDKIYTHINL+E TIH+ALQ  ++P+++ Y   N+RCHM
Sbjct  384  IVDDNDSLLDVYSRSDITTLAKDKIYTHINLEETTIHQALQYRDDPFST-YGYTNQRCHM  442

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKV+++LS+PGVRRLVI+EAGSKRVEGII+LSD+FR
Sbjct  443  CLRSDPLHKVLERLSQPGVRRLVIIEAGSKRVEGIITLSDIFR  485



>ref|XP_011071458.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=490

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP+SLP+LQ PI AIPLGTWVPKIG+PNRRPLAMLRP+ASLSAALNLLIQAQV +IP
Sbjct  324  FKHSPSSLPVLQFPIGAIPLGTWVPKIGDPNRRPLAMLRPSASLSAALNLLIQAQVSSIP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD+YSRSDIT+LAKD+IYTHINL+E TIH+ALQ  ++P+ S Y   N+RC M
Sbjct  384  IVDDNDSLLDVYSRSDITSLAKDRIYTHINLEETTIHQALQYRDDPF-SMYGSNNQRCFM  442

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKV+++LS+PGVRRL++VEAGSK VEGIISL DVFR
Sbjct  443  CLRSDPLHKVLERLSQPGVRRLIVVEAGSKHVEGIISLGDVFR  485



>ref|XP_003533466.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
Length=492

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 150/163 (92%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLP+LQLPI AIP+GTWVPKIGE NRRPLAMLRPTASL++ALNLL+QAQV +IP
Sbjct  326  FRHCSSSLPVLQLPICAIPVGTWVPKIGESNRRPLAMLRPTASLASALNLLVQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK++ YTHINLDEMT+H+ALQLG++ Y SPY + ++RC M
Sbjct  386  IVDDNDSLLDIYCRSDITALAKNRAYTHINLDEMTVHQALQLGQDAY-SPYELRSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  445  CLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  487



>ref|XP_006586934.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006586935.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 ref|XP_006586936.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X4 [Glycine max]
Length=493

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 150/163 (92%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLP+LQLPI AIP+GTWVPKIGE NRRPLAMLRPTASL++ALNLL+QAQV +IP
Sbjct  327  FRHCSSSLPVLQLPICAIPVGTWVPKIGESNRRPLAMLRPTASLASALNLLVQAQVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK++ YTHINLDEMT+H+ALQLG++ Y SPY + ++RC M
Sbjct  387  IVDDNDSLLDIYCRSDITALAKNRAYTHINLDEMTVHQALQLGQDAY-SPYELRSQRCQM  445

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  446  CLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  488



>gb|EYU43924.1| hypothetical protein MIMGU_mgv1a007064mg [Erythranthe guttata]
Length=421

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP+SLPILQ P+ A+P+GTWVPKIGEPNR+PLAMLRP+ASL AALNLL+QAQV +IP
Sbjct  255  FKHSPSSLPILQYPLCAVPVGTWVPKIGEPNRQPLAMLRPSASLGAALNLLLQAQVSSIP  314

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD+YSRSDIT LAKDKIY H+NL+E+TIH+ALQ  ++P+ S Y   N++CHM
Sbjct  315  IVDDNDSLLDVYSRSDITTLAKDKIYAHVNLEEITIHQALQYRDDPF-STYGYNNQKCHM  373

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDP+HK++++LS+PGVRRLVIVEAGSKRVEGIIS+ D+FR
Sbjct  374  CLRSDPIHKILERLSQPGVRRLVIVEAGSKRVEGIISVGDIFR  416



>gb|KHN26574.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=558

 Score =   270 bits (691),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 150/163 (92%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLP+LQLPI AIP+GTWVPKIGE NRRPLAMLRPTASL++ALNLL+QAQV +IP
Sbjct  392  FRHCSSSLPVLQLPICAIPVGTWVPKIGESNRRPLAMLRPTASLASALNLLVQAQVSSIP  451

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK++ YTHINLDEMT+H+ALQLG++ Y SPY + ++RC M
Sbjct  452  IVDDNDSLLDIYCRSDITALAKNRAYTHINLDEMTVHQALQLGQDAY-SPYELRSQRCQM  510

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  511  CLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  553



>ref|XP_006342753.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006342754.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Solanum tuberosum]
Length=486

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 154/163 (94%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP SLPILQLPI AIPLGTWVPKIGEPNR+PLAMLRPTASL+AALNLL+QAQV AIP
Sbjct  321  FKHSPESLPILQLPIGAIPLGTWVPKIGEPNRQPLAMLRPTASLNAALNLLVQAQVSAIP  380

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAKDKIYTHINL+EM+IH+ALQL EEPYA+ Y + +++CHM
Sbjct  381  IVDDNDSLLDIYSRSDITALAKDKIYTHINLEEMSIHQALQLAEEPYAT-YGLSSQKCHM  439

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LH+VM++LS+PGVRR+V+VEAGSKRVEGIIS+ D+F+
Sbjct  440  CLRSDSLHEVMERLSRPGVRRVVVVEAGSKRVEGIISVGDIFK  482



>gb|KDO75158.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=429

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  264  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  323

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  324  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  382

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  383  CLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  425



>ref|XP_011016465.1| PREDICTED: sucrose nonfermenting 4-like protein [Populus euphratica]
Length=292

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   +LP+LQLPI AIP+G+WVP IGEP+ RPLAMLRP+ASLS+ALNLLIQAQV +IP
Sbjct  127  FRHCSGTLPMLQLPIGAIPVGSWVPSIGEPSGRPLAMLRPSASLSSALNLLIQAQVSSIP  186

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL+DIY RSDITALAKDKIYTHINL+EMTI++ALQLG++ Y+S Y + ++RC M
Sbjct  187  IVDENDSLIDIYCRSDITALAKDKIYTHINLNEMTINQALQLGQDVYSS-YDLRSQRCQM  245

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI++LSD+FR
Sbjct  246  CLRSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVTLSDIFR  288



>emb|CDO98887.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+S   LP+LQLP+ AI LGTWVPKIGE NR+P AMLRP+ASLS ALNLL+QAQV +IP
Sbjct  306  FRYSLGLLPVLQLPVCAIGLGTWVPKIGESNRQPFAMLRPSASLSEALNLLVQAQVSSIP  365

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD+YSRSDITALAKDK YT+INL+EMT+H+ALQLGEEPY SPY +  +RCHM
Sbjct  366  IVDDNDSLLDVYSRSDITALAKDKSYTNINLEEMTVHRALQLGEEPY-SPYGISQQRCHM  424

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL +DPLHK+M++LSKPGVRRLVIVEAGSKRVEGI++LSD+FR
Sbjct  425  CLPTDPLHKIMERLSKPGVRRLVIVEAGSKRVEGIVTLSDIFR  467



>gb|KDO75154.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=471

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  306  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  365

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  366  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  424

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  425  CLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  467



>gb|KDO75156.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=500

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  335  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  394

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  395  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  453

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  454  CLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  496



>gb|KDO75157.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=512

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  347  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  406

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  407  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  465

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  466  CLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  508



>ref|XP_006419618.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
 gb|ESR32858.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
 gb|KDO75155.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=495

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  330  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  389

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  390  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  448

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  449  CLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  491



>ref|XP_003546378.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
Length=491

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLP+LQLPI AIP+GTWVPKIGE NR+PLAMLRPTASL++ALNLL+QAQV +IP
Sbjct  325  FRHCSSSLPVLQLPICAIPVGTWVPKIGESNRQPLAMLRPTASLASALNLLVQAQVSSIP  384

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK++ Y HINLDEMT+H+ALQLG++ Y SPY + ++RC M
Sbjct  385  IVDDNDSLLDIYCRSDITALAKNRAYAHINLDEMTVHQALQLGQDAY-SPYELRSQRCQM  443

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGI+SL D+F+
Sbjct  444  CLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLRDIFK  486



>ref|XP_006597745.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006597746.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 ref|XP_006597747.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X4 [Glycine max]
Length=492

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLP+LQLPI AIP+GTWVPKIGE NR+PLAMLRPTASL++ALNLL+QAQV +IP
Sbjct  326  FRHCSSSLPVLQLPICAIPVGTWVPKIGESNRQPLAMLRPTASLASALNLLVQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK++ Y HINLDEMT+H+ALQLG++ Y SPY + ++RC M
Sbjct  386  IVDDNDSLLDIYCRSDITALAKNRAYAHINLDEMTVHQALQLGQDAY-SPYELRSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGI+SL D+F+
Sbjct  445  CLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLRDIFK  487



>gb|KHN47756.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=491

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLP+LQLPI AIP+GTWVPKIGE NR+PLAMLRPTASL++ALNLL+QAQV +IP
Sbjct  325  FRHCSSSLPVLQLPICAIPVGTWVPKIGESNRQPLAMLRPTASLASALNLLVQAQVSSIP  384

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK++ Y HINLDEMT+H+ALQLG++ Y SPY + ++RC M
Sbjct  385  IVDDNDSLLDIYCRSDITALAKNRAYAHINLDEMTVHQALQLGQDAY-SPYELRSQRCQM  443

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGI+SL D+F+
Sbjct  444  CLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLRDIFK  486



>ref|XP_006489115.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Citrus 
sinensis]
Length=495

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  330  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  389

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  390  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  448

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SL D+F+
Sbjct  449  CLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLGDIFK  491



>ref|XP_010098308.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
 gb|EXB74812.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
Length=493

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H  +SLPILQLPI AIP+GTWVPKIGE N+RP AMLRP+ASLS+ALNLL+QAQV +IP
Sbjct  328  FKHCSSSLPILQLPIGAIPVGTWVPKIGEANQRPFAMLRPSASLSSALNLLVQAQVSSIP  387

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD+ YTHINL+EMTIH+ALQ G++ Y SP+   ++RC M
Sbjct  388  IVDDNDSLLDIYCRSDITALAKDRAYTHINLNEMTIHQALQFGQDSY-SPFEPKSQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  447  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  489



>ref|XP_012069369.1| PREDICTED: sucrose nonfermenting 4-like protein [Jatropha curcas]
Length=488

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  A+LPILQLPI AIP+GTWVPKIGE NRRPLAMLRP+A LS+ALNLLIQAQV +IP
Sbjct  323  FRHCSATLPILQLPICAIPVGTWVPKIGESNRRPLAMLRPSAPLSSALNLLIQAQVSSIP  382

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD++YTHIN++EMTIH++LQLG++ Y +PY + ++RC M
Sbjct  383  IVDDNDSLLDIYCRSDITALAKDRVYTHININEMTIHQSLQLGQDSY-TPYELRSQRCQM  441

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRRL+IVEAGSKRVEGI++LSD+F+
Sbjct  442  CLRSDTLQKVMERLANPGVRRLIIVEAGSKRVEGIVTLSDIFK  484



>gb|KDP40000.1| hypothetical protein JCGZ_01998 [Jatropha curcas]
Length=483

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  A+LPILQLPI AIP+GTWVPKIGE NRRPLAMLRP+A LS+ALNLLIQAQV +IP
Sbjct  318  FRHCSATLPILQLPICAIPVGTWVPKIGESNRRPLAMLRPSAPLSSALNLLIQAQVSSIP  377

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD++YTHIN++EMTIH++LQLG++ Y +PY + ++RC M
Sbjct  378  IVDDNDSLLDIYCRSDITALAKDRVYTHININEMTIHQSLQLGQDSY-TPYELRSQRCQM  436

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRRL+IVEAGSKRVEGI++LSD+F+
Sbjct  437  CLRSDTLQKVMERLANPGVRRLIIVEAGSKRVEGIVTLSDIFK  479



>ref|XP_008458476.1| PREDICTED: sucrose nonfermenting 4-like protein [Cucumis melo]
Length=491

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  + LP+LQLPI AIP+GTWVPKIGE N RPLAMLRP+ASLS+ALNLLIQAQV +IP
Sbjct  326  FRHCSSLLPVLQLPIFAIPVGTWVPKIGESNGRPLAMLRPSASLSSALNLLIQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD+Y RSDITALAKD+ YTHINLDEMTIH+ALQLG++ + S Y   ++RC M
Sbjct  386  IVDDNDSLLDVYCRSDITALAKDRAYTHINLDEMTIHQALQLGQDSF-SLYEPRSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVMD+L+ PGVRRLVIVEAGSKRVEGIISLSD+F+
Sbjct  445  CLRSDSLHKVMDRLANPGVRRLVIVEAGSKRVEGIISLSDIFK  487



>ref|XP_011044505.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
Length=480

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   +LP+LQLPI AIP+G+WVP IGEP+ RPLAMLRP+ASLS+ALNLLIQAQV +IP
Sbjct  315  FRHCSGTLPMLQLPIGAIPVGSWVPSIGEPSGRPLAMLRPSASLSSALNLLIQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL+DIY RSDITALAKDKIYTHINL+EMTI++ALQLG++ Y+S Y + ++RC M
Sbjct  375  IVDENDSLIDIYCRSDITALAKDKIYTHINLNEMTINQALQLGQDVYSS-YDLRSQRCQM  433

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI++LSD+FR
Sbjct  434  CLRSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVTLSDIFR  476



>ref|XP_011657174.1| PREDICTED: sucrose nonfermenting 4-like protein [Cucumis sativus]
 gb|KGN47196.1| hypothetical protein Csa_6G198240 [Cucumis sativus]
Length=491

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  + LP+LQLPI AIP+GTWVPKIGE N RPLAMLRP+ASLS+ALNLLIQAQV +IP
Sbjct  326  FRHCSSLLPVLQLPIFAIPVGTWVPKIGESNGRPLAMLRPSASLSSALNLLIQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD+Y RSDITALAKD+ YTHINLDEMTIH+ALQLG++ + S Y   ++RC M
Sbjct  386  IVDDNDSLLDVYCRSDITALAKDRAYTHINLDEMTIHQALQLGQDSF-SLYEPRSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVMD+L+ PGVRRLVIVEAGSKRVEGIISLSD+F+
Sbjct  445  CLRSDSLHKVMDRLANPGVRRLVIVEAGSKRVEGIISLSDIFK  487



>ref|XP_002314455.2| hypothetical protein POPTR_0010s02420g [Populus trichocarpa]
 gb|EEF00626.2| hypothetical protein POPTR_0010s02420g [Populus trichocarpa]
Length=463

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   ++P+LQLPI AIP+G+WVP IGEP+ RPLAMLRP+ASLS+ALNLLIQAQV +IP
Sbjct  298  FRHCSGTVPMLQLPIGAIPVGSWVPSIGEPSGRPLAMLRPSASLSSALNLLIQAQVSSIP  357

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL+DIY RSDITALAKDKIYTHINL+EMTI++ALQLG++ Y+S Y + ++RC M
Sbjct  358  IVDENDSLIDIYCRSDITALAKDKIYTHINLNEMTINQALQLGQDVYSS-YDLRSQRCQM  416

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGS RVEGI++LSD+FR
Sbjct  417  CLRSDTLHKVMERLANPGVRRLVIVEAGSNRVEGIVTLSDIFR  459



>ref|XP_006584037.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
 ref|XP_006584038.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 gb|KHN02987.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=482

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+  +SLPILQLPI AIP+GTWVPKIGE NRRPLAMLRP ASL++ALNLL+QAQV +IP
Sbjct  314  FRNCSSSLPILQLPICAIPVGTWVPKIGESNRRPLAMLRPNASLTSALNLLVQAQVSSIP  373

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD++DSLLDIY RSDITALAKD+ YTHINLDEMT+H+ALQLG++ Y + Y + ++RC M
Sbjct  374  IVDDSDSLLDIYCRSDITALAKDRTYTHINLDEMTVHQALQLGQDSYNT-YELRSQRCQM  432

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLR+D LHKVM++L+ PGVRRLVIVEAGSKRVEGII+LSD+F
Sbjct  433  CLRTDSLHKVMERLANPGVRRLVIVEAGSKRVEGIIALSDIF  474



>ref|XP_004296819.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462704.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Fragaria 
vesca subsp. vesca]
Length=491

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPILQ PI A+P+GTWVP+IGE NRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  326  FRHCSSSLPILQAPICALPVGTWVPEIGESNRRPLAMLRPSASLSAALNLLVQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            +VD+NDSLLDIY RSDITALAKD+ Y HINL+EMTI +ALQLG++ Y SP+   ++RC M
Sbjct  386  VVDDNDSLLDIYCRSDITALAKDRAYAHINLNEMTIQQALQLGQDSY-SPFEQRSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  445  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  487



>ref|XP_011462705.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462706.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPILQ PI A+P+GTWVP+IGE NRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  325  FRHCSSSLPILQAPICALPVGTWVPEIGESNRRPLAMLRPSASLSAALNLLVQAQVSSIP  384

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            +VD+NDSLLDIY RSDITALAKD+ Y HINL+EMTI +ALQLG++ Y SP+   ++RC M
Sbjct  385  VVDDNDSLLDIYCRSDITALAKDRAYAHINLNEMTIQQALQLGQDSY-SPFEQRSQRCQM  443

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  444  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  486



>ref|XP_003550198.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
 ref|XP_006600341.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006600342.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 gb|KHN03377.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=482

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+  +SLPILQLPI AIP+GTWVPKIGE NRRPLAMLRP ASL++ALNLL+QAQV +IP
Sbjct  314  FRNCSSSLPILQLPICAIPVGTWVPKIGESNRRPLAMLRPNASLTSALNLLVQAQVSSIP  373

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD++DSLLDIY RSDITALAKD+ YTHINLDEMT+H+ALQLG++ Y + Y +  +RC M
Sbjct  374  IVDDSDSLLDIYCRSDITALAKDRTYTHINLDEMTVHQALQLGQDSYNT-YELSCQRCQM  432

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLR+D LHKVM++L+ PGVRRLVIVEAGSKRVEGII+LSD+F
Sbjct  433  CLRTDSLHKVMERLASPGVRRLVIVEAGSKRVEGIIALSDIF  474



>ref|XP_008361991.1| PREDICTED: sucrose nonfermenting 4-like protein [Malus domestica]
Length=305

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI A+ +GTWVP+IGE NRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  140  FRHSSSSLPILQAPICALNVGTWVPEIGEXNRRPLAMLRPSASLSAALNLLVQAQVSSIP  199

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+ +SLLDIY RSDITALAKD+ Y HINL+EM+I  ALQLG++ + SPY    +RC M
Sbjct  200  IVDDTNSLLDIYCRSDITALAKDRAYAHINLNEMSIQXALQLGQDSF-SPYEPRGQRCQM  258

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  259  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  301



>ref|XP_008340939.1| PREDICTED: sucrose nonfermenting 4-like protein [Malus domestica]
Length=275

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI A+ +GTWVP+IGE NRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  110  FRHSSSSLPILQAPICALNVGTWVPEIGEXNRRPLAMLRPSASLSAALNLLVQAQVSSIP  169

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+ +SLLDIY RSDITALAKD+ Y HINL+EM+I  ALQLG++ + SPY    +RC M
Sbjct  170  IVDDTNSLLDIYCRSDITALAKDRAYAHINLNEMSIQXALQLGQDSF-SPYEPRGQRCQM  228

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  229  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  271



>ref|XP_004508285.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cicer arietinum]
Length=476

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+  +SLPILQ PI AIP+GTWVPKIGE NRRPLAMLRP ASL++AL+LLIQAQV +IP
Sbjct  311  FRNCSSSLPILQFPICAIPVGTWVPKIGESNRRPLAMLRPNASLTSALSLLIQAQVSSIP  370

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD++DSLLDIY RSDITALAKD+ YTHINLDEMT+H+ALQLG++ + +PY + ++RC M
Sbjct  371  IVDDSDSLLDIYCRSDITALAKDRAYTHINLDEMTVHQALQLGQDAF-NPYELRSQRCQM  429

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++L+ PGVRRLVIVEAGSKRVEGIISL+D+F+
Sbjct  430  CLRTDSLHKVMERLANPGVRRLVIVEAGSKRVEGIISLTDIFK  472



>gb|KEH15994.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=370

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPILQLPI AIP+GTWVPKIGE NRRPLA+LRP++SL++ALNLL+QAQ  +IP
Sbjct  205  FRHCSSSLPILQLPICAIPVGTWVPKIGESNRRPLAVLRPSSSLASALNLLVQAQASSIP  264

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDI ALAKD+ YTHINLDEMT+ +ALQLG++   SPY   ++RC M
Sbjct  265  IVDDNDSLLDIYCRSDIMALAKDRAYTHINLDEMTVQQALQLGQD-VCSPYEPRSQRCQM  323

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKV+++L+ PGVRR+VIVEAGSKR+EGI+SLSD+F+
Sbjct  324  CLRSDSLHKVIERLANPGVRRIVIVEAGSKRLEGIVSLSDIFK  366



>ref|XP_010551058.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
 ref|XP_010551059.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
Length=490

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPILQLPI A+P+GTWVPKIGE N RPLAMLRP ASLS ALNLLIQAQV A+P
Sbjct  323  FRHCSSSLPILQLPICALPVGTWVPKIGEANGRPLAMLRPNASLSQALNLLIQAQVSAVP  382

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK+Y +INL E TI +ALQLG++ Y  PY +  +RC M
Sbjct  383  IVDDNDSLLDIYCRSDITALAKDKVYANINLGETTIQRALQLGQDSYY-PYEMRTQRCQM  441

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++L+ PGVRRLV+VEAGSKRVEGIISLSD+FR
Sbjct  442  CLRTDSLHKVMERLANPGVRRLVVVEAGSKRVEGIISLSDIFR  484



>ref|XP_010104933.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
 gb|EXC02381.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
Length=359

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI AIPLGTWVPKIGE +RRPLAMLRP  SLSAAL+LL+QA+V ++P
Sbjct  191  FRHSSSSLPILQQPICAIPLGTWVPKIGESSRRPLAMLRPNTSLSAALSLLVQAEVSSVP  250

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDIT LAKDK Y  I+LDEM+IH+ALQLG++   SPY V N +RC 
Sbjct  251  IVDDNDSLLDIYSRSDITDLAKDKAYARISLDEMSIHEALQLGQDA-NSPYGVFNGQRCQ  309

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCL SDPLHKVM++LS P VRRLVIVEAGSKRVEGI+SLSDVFR
Sbjct  310  MCLPSDPLHKVMERLSNPRVRRLVIVEAGSKRVEGIVSLSDVFR  353



>ref|XP_008223132.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Prunus 
mume]
Length=470

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI  + +GTWVP+IGE N RPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  305  FRHSSSSLPILQAPICELHVGTWVPEIGESNCRPLAMLRPSASLSAALNLLVQAQVSSIP  364

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD+ Y HINL+EMTIH+ALQLG++ Y SP+   ++RC M
Sbjct  365  IVDDNDSLLDIYCRSDITALAKDRAYAHINLNEMTIHQALQLGQDSY-SPFEPRSQRCQM  423

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  424  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  466



>ref|XP_009352235.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=492

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI A+ +GTWVP+IGE NRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  327  FRHSSSSLPILQAPICALNVGTWVPEIGETNRRPLAMLRPSASLSAALNLLVQAQVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLLDIY RSDITALAKD+ Y HINL+EMTI +ALQLG++ + SP+    +RC M
Sbjct  387  IVDDNNSLLDIYCRSDITALAKDRAYAHINLNEMTIQQALQLGQDSF-SPFEPRGQRCQM  445

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  446  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  488



>ref|XP_009352236.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=491

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI A+ +GTWVP+IGE NRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  326  FRHSSSSLPILQAPICALNVGTWVPEIGETNRRPLAMLRPSASLSAALNLLVQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLLDIY RSDITALAKD+ Y HINL+EMTI +ALQLG++ + SP+    +RC M
Sbjct  386  IVDDNNSLLDIYCRSDITALAKDRAYAHINLNEMTIQQALQLGQDSF-SPFEPRGQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  445  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  487



>ref|XP_006380178.1| hypothetical protein POPTR_0008s22640g [Populus trichocarpa]
 gb|ERP57975.1| hypothetical protein POPTR_0008s22640g [Populus trichocarpa]
Length=480

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  ++LPILQLPI AIP+G+WVP IGEP+  PL MLRP+ASLS+ALNLLIQAQV +IP
Sbjct  315  FRHCSSTLPILQLPIGAIPVGSWVPSIGEPSGCPLVMLRPSASLSSALNLLIQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL+DIY RSDITALAKDKIYTHINL+EMTI++ALQLG++ Y+S + + ++RC M
Sbjct  375  IVDENDSLVDIYCRSDITALAKDKIYTHINLNEMTINQALQLGQDAYSS-HELRSQRCQM  433

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI++L D+F+
Sbjct  434  CLRSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVTLRDIFK  476



>ref|XP_008223131.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Prunus 
mume]
Length=491

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI  + +GTWVP+IGE N RPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  326  FRHSSSSLPILQAPICELHVGTWVPEIGESNCRPLAMLRPSASLSAALNLLVQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD+ Y HINL+EMTIH+ALQLG++ Y SP+   ++RC M
Sbjct  386  IVDDNDSLLDIYCRSDITALAKDRAYAHINLNEMTIHQALQLGQDSY-SPFEPRSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  445  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  487



>ref|XP_007222344.1| hypothetical protein PRUPE_ppa004800mg [Prunus persica]
 gb|EMJ23543.1| hypothetical protein PRUPE_ppa004800mg [Prunus persica]
Length=491

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI  + +GTWVP+IGE N RPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  326  FRHSSSSLPILQAPIGELHVGTWVPEIGESNCRPLAMLRPSASLSAALNLLVQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+DIY RSDITALAKD+ Y HINL+EMTIH+ALQLG++ Y SP+   ++RC M
Sbjct  386  IVDDNDSLVDIYCRSDITALAKDRAYAHINLNEMTIHQALQLGQDSY-SPFEPRSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  445  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  487



>ref|XP_008223130.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Prunus 
mume]
Length=492

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI  + +GTWVP+IGE N RPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  327  FRHSSSSLPILQAPICELHVGTWVPEIGESNCRPLAMLRPSASLSAALNLLVQAQVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD+ Y HINL+EMTIH+ALQLG++ Y SP+   ++RC M
Sbjct  387  IVDDNDSLLDIYCRSDITALAKDRAYAHINLNEMTIHQALQLGQDSY-SPFEPRSQRCQM  445

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSD+F+
Sbjct  446  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFK  488



>ref|XP_002319007.1| kinase family protein [Populus trichocarpa]
 gb|EEE94930.1| kinase family protein [Populus trichocarpa]
Length=488

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLPILQ PI +IPLGTWVPKIGEPNRRP AML+P ASL AAL+LL+QA V +IP
Sbjct  320  FRHSAGSLPILQQPICSIPLGTWVPKIGEPNRRPFAMLKPNASLGAALSLLVQANVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IV++NDSLLD+YSRSDITALAKDK Y  I+LDE++IH+ALQLG++  +S      +RC M
Sbjct  380  IVNDNDSLLDVYSRSDITALAKDKAYAQIHLDEISIHQALQLGQDANSSYGFFNGQRCQM  439

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++L+ PGVRRL+IVEAGSKRVEG+ISLSDVFR
Sbjct  440  CLRTDSLHKVMERLANPGVRRLLIVEAGSKRVEGVISLSDVFR  482



>gb|KDO56296.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=358

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ P+++I LGTWVP+IGE N RP AMLRPTASL +AL LL+QA V +IP
Sbjct  192  FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP  251

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDEM IH+ALQLG++  A+P +  N +RC 
Sbjct  252  IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQD--ANPSLGFNGQRCQ  309

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  310  MCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  353



>gb|KDO56297.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=381

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ P+++I LGTWVP+IGE N RP AMLRPTASL +AL LL+QA V +IP
Sbjct  215  FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP  274

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDEM IH+ALQLG++  A+P +  N +RC 
Sbjct  275  IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQD--ANPSLGFNGQRCQ  332

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  333  MCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  376



>ref|XP_011014797.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Populus 
euphratica]
Length=448

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  ++LPILQLPI AIP+G+WVP IGEP+  PL MLRP+ASLS+ALNLLIQAQV +IP
Sbjct  283  FRHCSSTLPILQLPIGAIPVGSWVPSIGEPSGCPLVMLRPSASLSSALNLLIQAQVSSIP  342

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL+DIY RSDITALAKDKIYTHINL+EMTI++ALQLG++ Y S + + ++RC M
Sbjct  343  IVDENDSLVDIYCRSDITALAKDKIYTHINLNEMTINQALQLGQDAY-SFHELRSQRCQM  401

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHK M++L+ PGVRRLVIVEAGSKRVEGI++LSD+F+
Sbjct  402  CLRSDTLHKEMERLANPGVRRLVIVEAGSKRVEGIVTLSDIFK  444



>ref|XP_006433347.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 gb|ESR46587.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 gb|KDO56295.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=376

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ P+++I LGTWVP+IGE N RP AMLRPTASL +AL LL+QA V +IP
Sbjct  210  FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP  269

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDEM IH+ALQLG++  A+P +  N +RC 
Sbjct  270  IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQD--ANPSLGFNGQRCQ  327

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  328  MCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  371



>ref|XP_011023639.1| PREDICTED: sucrose nonfermenting 4-like protein [Populus euphratica]
Length=476

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLPILQ PI +IPLGTWVPKIGEPNRRP AML+P ASL AAL+LL+QA V +IP
Sbjct  308  FRHSAGSLPILQQPICSIPLGTWVPKIGEPNRRPFAMLKPNASLGAALSLLVQANVSSIP  367

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IV++NDSLLD+YSRSDITALAKDK Y  I+LDE++IH+ALQLG++  +S      +RC M
Sbjct  368  IVNDNDSLLDVYSRSDITALAKDKAYAQIHLDEISIHQALQLGQDANSSYGFFNGQRCQM  427

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++L+ PGVRRL+IVEAGSKRVEGIISLSDVF+
Sbjct  428  CLRTDSLHKVMERLANPGVRRLLIVEAGSKRVEGIISLSDVFK  470



>ref|XP_011036820.1| PREDICTED: sucrose nonfermenting 4-like protein [Populus euphratica]
 ref|XP_011036821.1| PREDICTED: sucrose nonfermenting 4-like protein [Populus euphratica]
Length=475

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLPILQ PI +IPLGTWVPKIGEPNRRP AMLRP ASL AAL+LL QA V +IP
Sbjct  308  FRHSAGSLPILQQPICSIPLGTWVPKIGEPNRRPFAMLRPNASLGAALSLLAQANVSSIP  367

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IV++NDSLLD+YSRSDITALAKDK Y  I+LDE++IH+ALQLG+   +S      +RC M
Sbjct  368  IVNDNDSLLDVYSRSDITALAKDKAYAQIHLDEISIHQALQLGQNANSSNAFYNGQRCQM  427

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++L+ PGVRRL+IVEAGSKRVEG+ISLSDVFR
Sbjct  428  CLRTDSLHKVMERLANPGVRRLLIVEAGSKRVEGVISLSDVFR  470



>ref|XP_011014792.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
 ref|XP_011014793.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
 ref|XP_011014795.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
 ref|XP_011014796.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Populus 
euphratica]
Length=478

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  ++LPILQLPI AIP+G+WVP IGEP+  PL MLRP+ASLS+ALNLLIQAQV +IP
Sbjct  313  FRHCSSTLPILQLPIGAIPVGSWVPSIGEPSGCPLVMLRPSASLSSALNLLIQAQVSSIP  372

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL+DIY RSDITALAKDKIYTHINL+EMTI++ALQLG++ Y S + + ++RC M
Sbjct  373  IVDENDSLVDIYCRSDITALAKDKIYTHINLNEMTINQALQLGQDAY-SFHELRSQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHK M++L+ PGVRRLVIVEAGSKRVEGI++LSD+F+
Sbjct  432  CLRSDTLHKEMERLANPGVRRLVIVEAGSKRVEGIVTLSDIFK  474



>gb|KEH15992.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=485

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPILQLPI AIP+GTWVPKIGE NRRPLA+LRP++SL++ALNLL+QAQ  +IP
Sbjct  320  FRHCSSSLPILQLPICAIPVGTWVPKIGESNRRPLAVLRPSSSLASALNLLVQAQASSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDI ALAKD+ YTHINLDEMT+ +ALQLG++   SPY   ++RC M
Sbjct  380  IVDDNDSLLDIYCRSDIMALAKDRAYTHINLDEMTVQQALQLGQD-VCSPYEPRSQRCQM  438

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKV+++L+ PGVRR+VIVEAGSKR+EGI+SLSD+F+
Sbjct  439  CLRSDSLHKVIERLANPGVRRIVIVEAGSKRLEGIVSLSDIFK  481



>gb|AES91833.2| sucrose nonfermenting-like protein [Medicago truncatula]
Length=481

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR   +SLPILQLPI AIP+GTW+PKIGE NRRPLA LRP ASL++ALNLL+QAQV +IP
Sbjct  316  FRSCSSSLPILQLPICAIPVGTWMPKIGETNRRPLATLRPNASLASALNLLVQAQVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDE+DSLLDIY RSDITALAKD+ YTHINLDEMT+H+ALQL ++ + +P    ++RC M
Sbjct  376  IVDESDSLLDIYCRSDITALAKDRAYTHINLDEMTVHQALQLSQDAF-NPNESRSQRCQM  434

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++L+ PGVRRLVIVEAGSKRVEGIISL+D+F+
Sbjct  435  CLRTDSLHKVMERLANPGVRRLVIVEAGSKRVEGIISLTDIFK  477



>ref|XP_010524503.1| PREDICTED: sucrose nonfermenting 4-like protein [Tarenaya hassleriana]
Length=490

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPI Q PI A+P+GTWVPKIGE N RPLAMLRP ASLS ALNLLIQAQVGAIP
Sbjct  323  FRHCSSSLPIFQRPICALPVGTWVPKIGESNGRPLAMLRPNASLSQALNLLIQAQVGAIP  382

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDIT L KDK+Y HINL E TI +ALQL ++ Y  PY + ++RC M
Sbjct  383  IVDDNDSLLDIYCRSDITTLVKDKVYAHINLGETTIQQALQLVQDSYY-PYEMRSQRCQM  441

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++L+ PGVRRLV+VEAGSKRVEGIISL D+FR
Sbjct  442  CLRTDSLHKVMERLANPGVRRLVVVEAGSKRVEGIISLGDIFR  484



>ref|XP_008246396.1| PREDICTED: sucrose nonfermenting 4-like protein [Prunus mume]
Length=483

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI+  P+GTWVP IGEPN RPLAMLRP +SL+ AL+LL+QA+V +IP
Sbjct  317  FRHSSSSLPILQHPISEFPIGTWVPNIGEPNGRPLAMLRPNSSLADALSLLVQAEVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            IVDENDSLLDIYSRSDITALA+DK YT I+LDE++IH+ LQLG++   SPY  +  +RC 
Sbjct  377  IVDENDSLLDIYSRSDITALARDKAYTQIHLDELSIHQTLQLGQDA-NSPYGFLSGQRCQ  435

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKV+++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  436  MCLRSDPLHKVIERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  479



>ref|XP_006433348.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 ref|XP_006472035.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Citrus sinensis]
 gb|ESR46588.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 gb|KDO56294.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=413

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ P+++I LGTWVP+IGE N RP AMLRPTASL +AL LL+QA V +IP
Sbjct  247  FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP  306

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDEM IH+ALQLG++  A+P +  N +RC 
Sbjct  307  IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQD--ANPSLGFNGQRCQ  364

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  365  MCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  408



>ref|XP_010659865.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Vitis 
vinifera]
Length=452

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IP+GTWVPKIGE N +P AMLRP ASL AAL+LL+QA+V +IP
Sbjct  286  FRHSSSSLPILQQPICSIPVGTWVPKIGESNGQPFAMLRPNASLGAALSLLVQAEVSSIP  345

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            IVD+NDSLLDIYSRSDITALAKD+ Y  I+LD M+IH+ALQLG++   SPY  +  +RC 
Sbjct  346  IVDDNDSLLDIYSRSDITALAKDRAYAQIHLDNMSIHQALQLGQDA-NSPYGFISGQRCQ  404

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEG+ISLSDVFR
Sbjct  405  MCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGVISLSDVFR  448



>ref|XP_004494610.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Cicer arietinum]
Length=484

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS  SLPILQLPI +IPLGTWVPK+G+PN +PLAMLRP ASL AAL++ +QA+V +IP
Sbjct  318  FKHSAGSLPILQLPIGSIPLGTWVPKVGDPNGQPLAMLRPNASLGAALSMFVQAKVSSIP  377

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDE++IH+AL LG++   SPY + N  RCH
Sbjct  378  IVDDNDSLLDIYSRSDITALAKDKAYARISLDEISIHQALLLGQDA-NSPYGLYNGHRCH  436

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  437  MCLRSDSLHKVMERLASPGVRRLVIVEAGSKRVEGIISLSDVFR  480



>ref|XP_007154249.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 ref|XP_007154250.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 ref|XP_007154251.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 ref|XP_007154252.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26243.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26244.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26245.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
 gb|ESW26246.1| hypothetical protein PHAVU_003G103000g [Phaseolus vulgaris]
Length=480

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+  +SL ILQLPI AIP+GTWVPKIGE N +PLAMLRP ASL++ALNLL+QAQV +IP
Sbjct  315  FRNCTSSLAILQLPICAIPVGTWVPKIGESNCQPLAMLRPNASLTSALNLLVQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD++DSLLDIY RSDITALAKD+ YTHINL+EMT+H+ALQLG++ Y+S +   ++RC M
Sbjct  375  IVDDSDSLLDIYCRSDITALAKDRTYTHINLNEMTVHQALQLGQDFYSS-FEPRSQRCQM  433

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D LHKVM++LS PGVRRLVIVEAGSKRVEGIIS+SD+F+
Sbjct  434  CLRTDSLHKVMERLSHPGVRRLVIVEAGSKRVEGIISVSDIFK  476



>ref|XP_004494609.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Cicer arietinum]
Length=486

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS  SLPILQLPI +IPLGTWVPK+G+PN +PLAMLRP ASL AAL++ +QA+V +IP
Sbjct  320  FKHSAGSLPILQLPIGSIPLGTWVPKVGDPNGQPLAMLRPNASLGAALSMFVQAKVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDE++IH+AL LG++   SPY + N  RCH
Sbjct  380  IVDDNDSLLDIYSRSDITALAKDKAYARISLDEISIHQALLLGQDA-NSPYGLYNGHRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  439  MCLRSDSLHKVMERLASPGVRRLVIVEAGSKRVEGIISLSDVFR  482



>ref|XP_006382512.1| kinase family protein [Populus trichocarpa]
 gb|ERP60309.1| kinase family protein [Populus trichocarpa]
Length=475

 Score =   247 bits (631),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLPILQ PI +IPLGTWVPKIGEPNRRP AMLRP ASL AAL+LL QA V +IP
Sbjct  308  FRHSAGSLPILQQPICSIPLGTWVPKIGEPNRRPFAMLRPNASLGAALSLLAQANVSSIP  367

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IV++NDSLLD+YSRSDITALAKDK Y  I+LDE++IH+ALQLG+   +S      +RC M
Sbjct  368  IVNDNDSLLDVYSRSDITALAKDKAYAQIHLDEISIHQALQLGQNANSSNAFYNGQRCQM  427

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D L KVM++L+ PGVRRL+IVEAGSKRVEG+ISLSDVFR
Sbjct  428  CLRTDSLQKVMERLANPGVRRLLIVEAGSKRVEGVISLSDVFR  470



>gb|KJB26425.1| hypothetical protein B456_004G240500 [Gossypium raimondii]
Length=449

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGTWVP IGEPN RPLAMLRPTA+L AAL+LLIQA+V +IP
Sbjct  286  FKHSASSLPILQQPICSIPLGTWVPNIGEPNGRPLAMLRPTATLGAALSLLIQAEVSSIP  345

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLDIYSRSDITALAKDK Y  I+LDEM++H+ALQLG++          +RC M
Sbjct  346  IVDENDSLLDIYSRSDITALAKDKAYAQIHLDEMSVHQALQLGQD----ANFFNGQRCQM  401

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAG+KRVEGI+SLSDVFR
Sbjct  402  CLGSDTLHKVMERLANPGVRRLVIVEAGTKRVEGIVSLSDVFR  444



>ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Vitis 
vinifera]
 emb|CBI36807.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IP+GTWVPKIGE N +P AMLRP ASL AAL+LL+QA+V +IP
Sbjct  316  FRHSSSSLPILQQPICSIPVGTWVPKIGESNGQPFAMLRPNASLGAALSLLVQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            IVD+NDSLLDIYSRSDITALAKD+ Y  I+LD M+IH+ALQLG++   SPY  +  +RC 
Sbjct  376  IVDDNDSLLDIYSRSDITALAKDRAYAQIHLDNMSIHQALQLGQDA-NSPYGFISGQRCQ  434

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEG+ISLSDVFR
Sbjct  435  MCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGVISLSDVFR  478



>gb|KJB26424.1| hypothetical protein B456_004G240500 [Gossypium raimondii]
Length=479

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGTWVP IGEPN RPLAMLRPTA+L AAL+LLIQA+V +IP
Sbjct  316  FKHSASSLPILQQPICSIPLGTWVPNIGEPNGRPLAMLRPTATLGAALSLLIQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLDIYSRSDITALAKDK Y  I+LDEM++H+ALQLG++          +RC M
Sbjct  376  IVDENDSLLDIYSRSDITALAKDKAYAQIHLDEMSVHQALQLGQD----ANFFNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAG+KRVEGI+SLSDVFR
Sbjct  432  CLGSDTLHKVMERLANPGVRRLVIVEAGTKRVEGIVSLSDVFR  474



>ref|XP_010938454.1| PREDICTED: sucrose nonfermenting 4-like protein [Elaeis guineensis]
 ref|XP_010938455.1| PREDICTED: sucrose nonfermenting 4-like protein [Elaeis guineensis]
Length=502

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H  +SLPILQ PI  IPLGTWVPKIGEPN RPLAMLRP A+LSAAL+LL+QA+V +IP
Sbjct  327  FKHCSSSLPILQQPICTIPLGTWVPKIGEPNGRPLAMLRPNATLSAALSLLVQARVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKD+ Y +I+LDEM+IH+ALQLG++  A       +RC M
Sbjct  387  IVDDNDSLLDTYSRSDITALAKDRAYAYIHLDEMSIHQALQLGQDATAPFGFFNGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  447  CLRSDTLQKVMERLASPGVRRVIIVEAGSKRVEGIISLSDVFR  489



>gb|EMT02275.1| hypothetical protein F775_30701 [Aegilops tauschii]
Length=444

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  SLPIL  P+ +IPLGTWVPKIGEPN  PLAMLRP  SLS+ALNLL+QA V +IP
Sbjct  278  FKNSTGSLPILNQPVCSIPLGTWVPKIGEPNGHPLAMLRPNTSLSSALNLLVQAGVSSIP  337

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+D YSRSDITALAKDK+YTHI LDEMTIH+ALQLG++  +   +   +RC M
Sbjct  338  IVDDNDSLIDTYSRSDITALAKDKVYTHIRLDEMTIHQALQLGQDANSPFGLFNGQRCQM  397

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEG+ISLSD+F+
Sbjct  398  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGVISLSDIFK  440



>ref|XP_006433349.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 ref|XP_006472034.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Citrus sinensis]
 gb|ESR46589.1| hypothetical protein CICLE_v10000984mg [Citrus clementina]
 gb|KDO56288.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=483

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ P+++I LGTWVP+IGE N RP AMLRPTASL +AL LL+QA V +IP
Sbjct  317  FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDEM IH+ALQLG++  A+P +  N +RC 
Sbjct  377  IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQD--ANPSLGFNGQRCQ  434

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  435  MCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  478



>gb|EYU45566.1| hypothetical protein MIMGU_mgv1a006371mg [Erythranthe guttata]
Length=446

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HSP+SLP+LQ PI AIPLGTWVPKIGEPNRR LAMLRP+ASLSAAL+LLIQAQV +IP
Sbjct  280  FKHSPSSLPVLQFPICAIPLGTWVPKIGEPNRRTLAMLRPSASLSAALSLLIQAQVSSIP  339

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD+YSRSDIT LAKDK+YTHINL+E TIH+ALQ  ++P+ S     N+RC M
Sbjct  340  IVDDNDSLLDVYSRSDITTLAKDKLYTHINLEETTIHQALQYRDDPF-SALGSNNQRCFM  398

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKV+++LS+PGVRRL++VEAGSK VEGIISL DVFR
Sbjct  399  CLRSDPLHKVLERLSQPGVRRLIVVEAGSKHVEGIISLGDVFR  441



>gb|KHF98317.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=479

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGTWVP IGEPN RPLAMLRP A+L AAL+LLIQA+V +IP
Sbjct  316  FKHSASSLPILQQPICSIPLGTWVPNIGEPNGRPLAMLRPNATLGAALSLLIQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLDIYSRSDITALAKDK Y  I+LDEM++H+ALQLG++          +RC M
Sbjct  376  IVDENDSLLDIYSRSDITALAKDKAYAQIHLDEMSVHQALQLGQD----ANFFNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD LHKVM++L+ PGVRRLVIVEAG+KRVEGI+SLSDVFR
Sbjct  432  CLGSDTLHKVMERLANPGVRRLVIVEAGTKRVEGIVSLSDVFR  474



>ref|XP_008648222.1| PREDICTED: AKINbetagamma-1 protein kinase isoform X1 [Zea mays]
 gb|ACL53758.1| unknown [Zea mays]
 tpg|DAA52575.1| TPA: protein kinase AKINbetagamma-1 [Zea mays]
Length=497

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+ +IPLG+WVPKIG+PN RPLAMLRP ASLS+ALN+L+QA V +IP
Sbjct  330  FKNSTGNLPILNQPVCSIPLGSWVPKIGDPNSRPLAMLRPNASLSSALNMLVQAGVSSIP  389

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLD YSRSDITALAKDK+YTH+ LDEMTIH+ALQLG++          +RC M
Sbjct  390  IVDENDSLLDTYSRSDITALAKDKVYTHVRLDEMTIHQALQLGQDANTPFGFFNGQRCQM  449

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  450  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDIFK  492



>gb|EMS67514.1| 5'-AMP-activated protein kinase subunit gamma [Triticum urartu]
Length=483

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  SLPIL  P+ +IPLGTWVPKIGEPN  PLAMLRP  SLS+ALNLL+QA V +IP
Sbjct  317  FKNSTGSLPILNQPVCSIPLGTWVPKIGEPNGHPLAMLRPNTSLSSALNLLVQAGVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+D YSRSDITALAKDK+YTHI LDEMTIH+ALQLG++  +   +   +RC M
Sbjct  377  IVDDNDSLIDTYSRSDITALAKDKVYTHIRLDEMTIHQALQLGQDANSPFGLFNGQRCQM  436

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEG+ISLSD+F+
Sbjct  437  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGVISLSDIFK  479



>ref|XP_012089045.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Jatropha 
curcas]
 gb|KDP23504.1| hypothetical protein JCGZ_23337 [Jatropha curcas]
Length=472

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ PI  IPLGTWVPKIGE N RP AMLRP ASL  AL+LL+QA+V +IP
Sbjct  308  FRHSASSLPVLQQPICTIPLGTWVPKIGESNLRPFAMLRPNASLGDALSLLVQAEVSSIP  367

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LDE++IH+ALQLG++  +SP+  G +RCHM
Sbjct  368  IVDDNDSLVDIYSRSDITALAKDKAYAQIHLDEISIHQALQLGQDA-SSPFYNG-QRCHM  425

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SDPLHKVM++L+ PGVRR++IVEAG+KRVEGIISLSDVFR
Sbjct  426  CLGSDPLHKVMERLAIPGVRRILIVEAGTKRVEGIISLSDVFR  468



>gb|KJB72640.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=360

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   SLP+LQLPI AIPLGTWVP+IGE + RP AMLRPTASLS+ALN+L+QA+V +IP
Sbjct  196  FKHCSGSLPVLQLPIYAIPLGTWVPRIGESSSRPFAMLRPTASLSSALNMLVQARVSSIP  255

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK + YTH NL+EMTI++ALQLG++   +PY + ++RC M
Sbjct  256  IVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEMTIYQALQLGQDS-NTPYEMRSQRCQM  313

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D L KVM++L+ PGVRRLVIVEAGS RVEG++SL+DVFR
Sbjct  314  CLRTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGVVSLTDVFR  356



>ref|XP_007030947.1| Sucrose nonfermenting 4 [Theobroma cacao]
 gb|EOY11449.1| Sucrose nonfermenting 4 [Theobroma cacao]
Length=479

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGTWVPKIGE N RPLAMLRP ASL AAL+LL+QA+V +IP
Sbjct  316  FKHSSSSLPILQQPICSIPLGTWVPKIGESNGRPLAMLRPNASLGAALSLLVQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLDIYSRSDITALA +K Y  I+LDEM+IH+ALQLG++  +       +RC M
Sbjct  376  IVDENDSLLDIYSRSDITALANNKAYAQIHLDEMSIHQALQLGQDANS----FNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PG RRLVIVEAGSKRVEGIISLSDVFR
Sbjct  432  CLRSDTLHKVMERLANPGARRLVIVEAGSKRVEGIISLSDVFR  474



>ref|XP_010649750.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Vitis 
vinifera]
Length=425

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLP+LQLPI AIP+GTWV +IGE N+RPLA L P+ASLS+AL+LL+QAQV +IP
Sbjct  260  FRHSSNSLPVLQLPIFAIPVGTWVSEIGEANQRPLAKLHPSASLSSALSLLVQAQVSSIP  319

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK+++Y HINLD+MTIH+ALQLG++PY SPY   ++RC M
Sbjct  320  IVDDNDSLLDIYSRSDITALAKNRVYAHINLDDMTIHQALQLGQDPY-SPYEFNSQRCQM  378

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+DPLH+VMD+L+ PGVRRLVIVEAGS+RVEGI+SL D+F+
Sbjct  379  CLRTDPLHEVMDRLANPGVRRLVIVEAGSRRVEGIVSLRDIFK  421



>ref|XP_002466066.1| hypothetical protein SORBIDRAFT_01g000600 [Sorghum bicolor]
 gb|EER93064.1| hypothetical protein SORBIDRAFT_01g000600 [Sorghum bicolor]
Length=496

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+ +IPLG+WVPKIG+PN RPLAMLRP ASLS+ALN+L+QA V ++P
Sbjct  329  FKNSTCNLPILNQPVCSIPLGSWVPKIGDPNSRPLAMLRPNASLSSALNMLVQAGVSSVP  388

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDEND+LLD YSRSDITALAKDK+YTH+ LDEMTIH+ALQLG++          +RC M
Sbjct  389  IVDENDALLDTYSRSDITALAKDKVYTHVRLDEMTIHQALQLGQDANTPFGFFNGQRCQM  448

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  449  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDIFK  491



>ref|NP_001051949.1| Os03g0856400 [Oryza sativa Japonica Group]
 gb|AAP21389.1| putative protein kinase AKINbetagamma [Oryza sativa Japonica 
Group]
 gb|AAS01982.1| putative protein kinase AKINbetagamma-2 [Oryza sativa Japonica 
Group]
 gb|ABF99987.1| protein kinase AKINbetagamma-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13863.1| Os03g0856400 [Oryza sativa Japonica Group]
 dbj|BAG95656.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76569.1| hypothetical protein OsI_14400 [Oryza sativa Indica Group]
 gb|EEE60333.1| hypothetical protein OsJ_13432 [Oryza sativa Japonica Group]
Length=493

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+  IPLGTWVPKIG+PN RPLAMLRP  SLSAALNLL+QA V +IP
Sbjct  327  FKNSQGNLPILSQPVCTIPLGTWVPKIGDPNGRPLAMLRPNTSLSAALNLLVQAGVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKDK+YTHI LDEMTIH+ALQLG++  +       +RC M
Sbjct  387  IVDDNDSLLDTYSRSDITALAKDKVYTHIRLDEMTIHQALQLGQDANSPFGFFNGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  447  CLRSDTLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDIFK  489



>ref|XP_006650929.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Oryza brachyantha]
Length=487

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  PI  IPLGTWVPKIG+PN RPLAMLRP  SLS+ALNLL+QA V +IP
Sbjct  321  FKNSTGNLPILNQPICTIPLGTWVPKIGDPNGRPLAMLRPNTSLSSALNLLVQAGVSSIP  380

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKDK+YTHI LDEMTIH+ALQLG++  +       +RC M
Sbjct  381  IVDDNDSLLDTYSRSDITALAKDKVYTHIRLDEMTIHQALQLGQDANSPFGFFNGQRCQM  440

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  441  CLRSDTLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDIFK  483



>ref|XP_008789953.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008789954.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008789955.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008789956.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
Length=501

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H  ++LP+LQ PI  IPLGTWVPKIGEPN RPLAMLRP A+LSAAL+LL+QA+V +IP
Sbjct  327  FKHC-STLPVLQQPICTIPLGTWVPKIGEPNGRPLAMLRPNATLSAALSLLVQARVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKD+ Y+HI+LDEM+IH+ALQLG++  A       +RC M
Sbjct  386  IVDDNDSLLDTYSRSDITALAKDRAYSHIHLDEMSIHQALQLGQDVSAPFGFFNGQRCQM  445

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PG+RR++IVEAGSKRVEGIISLSDVFR
Sbjct  446  CLRSDTLQKVMERLANPGIRRVIIVEAGSKRVEGIISLSDVFR  488



>gb|KJB72637.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
 gb|KJB72642.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=431

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   SLP+LQLPI AIPLGTWVP+IGE + RP AMLRPTASLS+ALN+L+QA+V +IP
Sbjct  267  FKHCSGSLPVLQLPIYAIPLGTWVPRIGESSSRPFAMLRPTASLSSALNMLVQARVSSIP  326

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK + YTH NL+EMTI++ALQLG++   +PY + ++RC M
Sbjct  327  IVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEMTIYQALQLGQDS-NTPYEMRSQRCQM  384

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D L KVM++L+ PGVRRLVIVEAGS RVEG++SL+DVFR
Sbjct  385  CLRTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGVVSLTDVFR  427



>ref|XP_002274373.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Vitis 
vinifera]
 emb|CBI26085.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLP+LQLPI AIP+GTWV +IGE N+RPLA L P+ASLS+AL+LL+QAQV +IP
Sbjct  326  FRHSSNSLPVLQLPIFAIPVGTWVSEIGEANQRPLAKLHPSASLSSALSLLVQAQVSSIP  385

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK+++Y HINLD+MTIH+ALQLG++PY SPY   ++RC M
Sbjct  386  IVDDNDSLLDIYSRSDITALAKNRVYAHINLDDMTIHQALQLGQDPY-SPYEFNSQRCQM  444

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+DPLH+VMD+L+ PGVRRLVIVEAGS+RVEGI+SL D+F+
Sbjct  445  CLRTDPLHEVMDRLANPGVRRLVIVEAGSRRVEGIVSLRDIFK  487



>ref|XP_003559740.1| PREDICTED: sucrose nonfermenting 4-like protein [Brachypodium 
distachyon]
Length=494

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  SLPIL  P+  IPLGTWVPKIG+PN  PLAMLRP  SLS+ALNLL+QA V +IP
Sbjct  328  FKNSTGSLPILNQPVCTIPLGTWVPKIGDPNGHPLAMLRPNTSLSSALNLLVQAGVSSIP  387

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD++DSLLD YSRSDITALAKDK+YTHI LDEMTIH+ALQLG++  +   +   +RC M
Sbjct  388  IVDDSDSLLDTYSRSDITALAKDKVYTHIRLDEMTIHQALQLGQDANSPFGLFNGQRCQM  447

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEGIISLSDVF+
Sbjct  448  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDVFK  490



>ref|XP_009791916.1| PREDICTED: sucrose nonfermenting 4-like protein [Nicotiana sylvestris]
Length=484

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI AIP+GTWVPKIGE + +P+AMLRP ASL AAL+LL+QA+V ++P
Sbjct  317  FKHSSSSLPILQQPICAIPIGTWVPKIGEASGKPVAMLRPNASLGAALSLLVQAEVSSVP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIY RSDITALAKD+ Y  I LDE++IH+A+QLG++  +SPY + N +RC 
Sbjct  377  IVDDNDSLLDIYCRSDITALAKDRAYAQIRLDELSIHQAIQLGQDA-SSPYGLFNGQRCQ  435

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PG RRLVIVEAGSKRVEGI+S+SDVFR
Sbjct  436  MCLRSDPLHKVMERLAVPGARRLVIVEAGSKRVEGIVSVSDVFR  479



>ref|XP_003554656.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
1 [Glycine max]
Length=478

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQLP+ +IPLGTW+P++GEPN RPLAML P+ASL AAL++ +QA+V +IP
Sbjct  312  FKHSLSSLPILQLPVASIPLGTWMPRVGEPNGRPLAMLMPSASLGAALSMFVQAKVSSIP  371

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD NDSLLDIYSRSDITALAKDK Y  I+LDE++IH+AL LG++  +   +   +RCHM
Sbjct  372  IVDANDSLLDIYSRSDITALAKDKAYARISLDEISIHQALLLGQDATSPSGIYNGQRCHM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRS+ L+KVM++L+ PGVRRLV+VEAGSKRVEGIISLSDVFR
Sbjct  432  CLRSESLYKVMERLANPGVRRLVVVEAGSKRVEGIISLSDVFR  474



>ref|XP_003521702.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoformX1 
[Glycine max]
 ref|XP_006577235.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
 ref|XP_006577236.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Glycine max]
 gb|KHN03985.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=478

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +S PILQLP+ +IPLGTW+P++GEPN RPLAML P+ASL AAL++ +QA+V +IP
Sbjct  312  FKHSLSSFPILQLPVASIPLGTWMPRVGEPNGRPLAMLMPSASLGAALSMFVQAKVSSIP  371

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD NDSLLDIYSRSDITALAKDK Y  I+LDE++IH+AL LG++   SPY + N  RCH
Sbjct  372  IVDNNDSLLDIYSRSDITALAKDKAYARISLDEISIHQALLLGQDA-TSPYGLYNGHRCH  430

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L+KVM++L+ PGVRRLV VEAGSKRVEGIISLSDVFR
Sbjct  431  MCLRSDSLYKVMERLANPGVRRLVAVEAGSKRVEGIISLSDVFR  474



>gb|AAG10141.1|AF250335_1 putative activator subunit of SNF1-related protein kinase SNF4 
[Arabidopsis thaliana]
Length=382

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL LL+QA+V +IP
Sbjct  215  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALALLVQAEVSSIP  274

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  275  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  333

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  334  MCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  377



>gb|KHN43289.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=485

 Score =   240 bits (613),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQLP+ +IPLGTW+P++GEPN RPLAML P+ASL AAL++ +QA+V +IP
Sbjct  319  FKHSLSSLPILQLPVASIPLGTWMPRVGEPNGRPLAMLMPSASLGAALSMFVQAEVSSIP  378

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD NDSLLDIYSRSDITALAKDK Y  I+LDE++IH+AL LG++  +   +   +RCHM
Sbjct  379  IVDANDSLLDIYSRSDITALAKDKAYARISLDEISIHQALLLGQDATSPSGIYNGQRCHM  438

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRS+ L+KVM++L+ PGVRRLV+VEAGSKRVEGIISLSDVFR
Sbjct  439  CLRSESLYKVMERLANPGVRRLVVVEAGSKRVEGIISLSDVFR  481



>ref|XP_003626272.1| 5'-AMP-activated protein kinase subunit beta-1 [Medicago truncatula]
 gb|AES82490.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=485

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F HS  SLPILQLPI +IPLGTWVP +G+PN +PL  LRP ASL  AL++ +QA+V +IP
Sbjct  319  FEHSAGSLPILQLPIASIPLGTWVPNVGDPNGQPLIRLRPNASLGDALSMFVQAKVSSIP  378

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVDENDSLLDIYSRSDITALAKDK Y  I+LDE  IH+AL LG++   SPY + N  RCH
Sbjct  379  IVDENDSLLDIYSRSDITALAKDKAYARISLDETNIHQALILGQDA-NSPYGLNNGHRCH  437

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD LHKVM++L+KPGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  438  MCLRSDSLHKVMERLAKPGVRRLVIVEAGSKRVEGIISLSDVFR  481



>gb|AAO61673.1| AKIN betagamma [Medicago truncatula]
Length=485

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F HS  SLPILQLPI +IPLGTWVP +G+PN +PL  LRP ASL  AL++ +QA+V +IP
Sbjct  319  FEHSAGSLPILQLPIASIPLGTWVPNVGDPNGQPLIRLRPNASLGDALSMFVQAKVSSIP  378

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVDENDSLLDIYSRSDITALAKDK Y  I+LDE  IH+AL LG++   SPY + N  RCH
Sbjct  379  IVDENDSLLDIYSRSDITALAKDKAYARISLDETNIHQALILGQDA-NSPYGLNNGHRCH  437

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD LHKVM++L+KPGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  438  MCLRSDSLHKVMERLAKPGVRRLVIVEAGSKRVEGIISLSDVFR  481



>ref|XP_010259699.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Nelumbo 
nucifera]
Length=424

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVPKIGE +RRPLAMLRP ASLSAAL+LLIQAQV +IP
Sbjct  259  FRHSSSSLPILQQPICSIPLGTWVPKIGE-SRRPLAMLRPNASLSAALSLLIQAQVSSIP  317

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKD+ Y  I LDEMTIH+ALQLG++   SPY   N +RC 
Sbjct  318  IVDDNDSLLDIYSRSDITALAKDRAYAQIQLDEMTIHQALQLGQDG-NSPYGFFNGQRCQ  376

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLR+DPLHKVM++LS PGVRRLVIVEAGSKRVEGI+SLSDVFR
Sbjct  377  MCLRTDPLHKVMERLSNPGVRRLVIVEAGSKRVEGIVSLSDVFR  420



>ref|XP_007205127.1| hypothetical protein PRUPE_ppa004966mg [Prunus persica]
 gb|EMJ06326.1| hypothetical protein PRUPE_ppa004966mg [Prunus persica]
Length=483

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 140/164 (85%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI+  P+GTWVP I EPN RPLAMLRP +SL+ AL+LL+QA+V +IP
Sbjct  317  FRHSSSSLPILQHPISEFPIGTWVPNIAEPNGRPLAMLRPNSSLADALSLLVQAEVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            IVDENDSLLDIYSRSDITALA+DK YT I+LD ++I++ LQLG +   SPY  +  +RC 
Sbjct  377  IVDENDSLLDIYSRSDITALARDKAYTQIHLDGLSIYQTLQLGRDA-NSPYGFLSGQRCQ  435

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKV+++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  436  MCLRSDPLHKVIERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  479



>gb|ACN35851.1| unknown [Zea mays]
 gb|AFW66923.1| protein kinase AKINbetagamma-2 [Zea mays]
Length=496

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+ +IPLG+WVPKIG+ N RPLAMLRP ASLS+ALN+L+QA V +IP
Sbjct  329  FKNSTGNLPILNQPVCSIPLGSWVPKIGDLNSRPLAMLRPNASLSSALNMLVQAGVSSIP  388

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKDK+YTH+ LDEMTIH+ALQLG++          +RC M
Sbjct  389  IVDDNDSLLDTYSRSDITALAKDKVYTHVRLDEMTIHQALQLGQDANTPFGFFNGQRCQM  448

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  449  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDIFK  491



>ref|XP_011087405.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=478

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI++ PLGTWVPKIGE N +P+AMLRP ASL AAL+LLIQA V +IP
Sbjct  312  FKHSSSSLPILQQPISSFPLGTWVPKIGESNGKPIAMLRPNASLGAALSLLIQADVSSIP  371

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            +VDENDSL+D+Y RSDITALAKD+ YT + LD+++IH+ALQLG++  +       +RC M
Sbjct  372  VVDENDSLVDVYCRSDITALAKDRAYTQVRLDDLSIHQALQLGQDAISPRGFFNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLRSDPL KVM++LS PGVRR+VIVEAGSKRVEGIISLSDVF
Sbjct  432  CLRSDPLQKVMERLSIPGVRRVVIVEAGSKRVEGIISLSDVF  473



>gb|KJB72641.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=468

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   SLP+LQLPI AIPLGTWVP+IGE + RP AMLRPTASLS+ALN+L+QA+V +IP
Sbjct  304  FKHCSGSLPVLQLPIYAIPLGTWVPRIGESSSRPFAMLRPTASLSSALNMLVQARVSSIP  363

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK + YTH NL+EMTI++ALQLG++   +PY + ++RC M
Sbjct  364  IVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEMTIYQALQLGQDS-NTPYEMRSQRCQM  421

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D L KVM++L+ PGVRRLVIVEAGS RVEG++SL+DVFR
Sbjct  422  CLRTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGVVSLTDVFR  464



>ref|NP_001105005.1| AKINbetagamma-1 protein kinase [Zea mays]
 gb|AAG31751.1|AF276085_1 protein kinase AKINbetagamma-1 [Zea mays]
Length=497

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+ +IPLG+WVPKIG+PN RPLAMLRP ASLS+ALN+L+QA V +IP
Sbjct  330  FKNSTGNLPILNQPVCSIPLGSWVPKIGDPNSRPLAMLRPNASLSSALNMLVQAGVSSIP  389

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLD YSRSDITALAK K+YTH+ LDEM IH+ALQLG++          +RC M
Sbjct  390  IVDENDSLLDTYSRSDITALAKAKVYTHVRLDEMAIHQALQLGQDANTPFGFFNGQRCQM  449

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  450  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDIFK  492



>ref|XP_004230211.1| PREDICTED: sucrose nonfermenting 4-like protein [Solanum lycopersicum]
Length=483

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IP+GTWVPKIGE + +P+AMLRP ASL AAL+LL+QA+V AIP
Sbjct  316  FKHSSSSLPILQQPICSIPIGTWVPKIGESSGKPVAMLRPNASLGAALSLLVQAEVSAIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD+ Y  I LDE++IH+A+QLG++  +   +   +RC M
Sbjct  376  IVDDNDSLLDIYCRSDITALAKDRAYAQIRLDELSIHQAIQLGQDASSPHGLFNGQRCQM  435

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PG RRLVIVEAGSKRVEGIIS++DVFR
Sbjct  436  CLRSDPLHKVMERLAVPGARRLVIVEAGSKRVEGIISVTDVFR  478



>gb|KJB72638.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
 gb|KJB72639.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=488

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   SLP+LQLPI AIPLGTWVP+IGE + RP AMLRPTASLS+ALN+L+QA+V +IP
Sbjct  324  FKHCSGSLPVLQLPIYAIPLGTWVPRIGESSSRPFAMLRPTASLSSALNMLVQARVSSIP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK + YTH NL+EMTI++ALQLG++   +PY + ++RC M
Sbjct  384  IVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEMTIYQALQLGQDS-NTPYEMRSQRCQM  441

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D L KVM++L+ PGVRRLVIVEAGS RVEG++SL+DVFR
Sbjct  442  CLRTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGVVSLTDVFR  484



>ref|XP_010528891.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Tarenaya 
hassleriana]
Length=440

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+S +SLPILQ PI +IPLGTWVP IGE   RPLA L+P ASL +AL+LL+QA+V +IP
Sbjct  273  FRNSSSSLPILQQPICSIPLGTWVPSIGESTSRPLATLKPHASLGSALSLLVQAEVSSIP  332

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LD+MTIH+ALQLG++ Y     V  +RCHM
Sbjct  333  IVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTIHRALQLGQDAYPLYGFVNGQRCHM  392

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRRLVIVE GSKRVEGIIS+SDVFR
Sbjct  393  CLRSDSLQKVMERLANPGVRRLVIVEPGSKRVEGIISVSDVFR  435



>gb|KHG04900.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=479

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 137/163 (84%), Gaps = 4/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ P+ +IPLGTWVPKIGE N + LAMLRP ASL AAL+LL+QA V +IP
Sbjct  316  FKHSSSSLPILQQPVCSIPLGTWVPKIGESNGQLLAMLRPNASLGAALSLLVQANVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLD+YSRSDITALAKDK Y  I LDEM+IH+ALQL ++  +    +  +RC M
Sbjct  376  IVDENDSLLDVYSRSDITALAKDKAYAQIRLDEMSIHQALQLCQDANS----INGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  432  CLRSDTLHKVMERLASPGVRRLVIVEAGSKRVEGIISLSDVFR  474



>gb|AGA95983.1| sucrose non-fermenting 4 [Brassica rapa subsp. pekinensis]
Length=482

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 140/166 (84%), Gaps = 6/166 (4%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLG+WVP+IGE + +PLA LRP ASL +AL LL+QAQV +IP
Sbjct  315  FRHSSSSLPILQQPICSIPLGSWVPRIGESSSKPLATLRPNASLGSALTLLVQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEE---PYASPYMVGNER  436
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++   PY S   +  +R
Sbjct  375  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHRALQLGQDASPPYGS---LNGQR  431

Query  435  CHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            C MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  432  CQMCLRSDSLGKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  477



>ref|XP_007147040.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
 ref|XP_007147041.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
 gb|ESW19034.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
 gb|ESW19035.1| hypothetical protein PHAVU_006G091100g [Phaseolus vulgaris]
Length=478

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQL + +I LG W+PK+GE N RPLAMLRP+ASL AAL++ IQA+V +IP
Sbjct  312  FKHSLSSLPILQLQVGSIHLGAWMPKVGESNGRPLAMLRPSASLGAALSMFIQAEVSSIP  371

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y   +LDE++IH+AL LG++  +SPY + N  RCH
Sbjct  372  IVDDNDSLLDIYSRSDITALAKDKAYARTSLDEISIHQALLLGQDA-SSPYGLFNGHRCH  430

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD LHKVM++LS PGVRRLV+VEAGSKRVEGIISLSDVFR
Sbjct  431  MCLRSDSLHKVMERLSNPGVRRLVVVEAGSKRVEGIISLSDVFR  474



>gb|KFK43205.1| hypothetical protein AALP_AA1G093900 [Arabis alpina]
Length=487

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE N +PLA LRP ASL +AL LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESNSKPLATLRPHASLGSALALLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  439  MCLRSDSLLKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  482



>ref|XP_010475723.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Camelina 
sativa]
Length=487

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  439  MCLRSDSLLKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  482



>ref|XP_010674700.1| PREDICTED: sucrose nonfermenting 4-like protein [Beta vulgaris 
subsp. vulgaris]
Length=490

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI++IPLGTWVPKIGE +R PLAMLRP ASL  AL LL++A V ++P
Sbjct  324  FKHSSSSLPILQQPISSIPLGTWVPKIGESSRPPLAMLRPNASLGVALTLLVEADVSSVP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSLLD+YSRSDIT+LAKD+ Y  I LDEM+IH+ALQLG++  +   +   +RC M
Sbjct  384  IVDENDSLLDLYSRSDITSLAKDRAYAQIRLDEMSIHQALQLGQDANSPCGVFNGQRCQM  443

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SDPL KVM++L+ PGVRRLVIVEAGSKRVEGII+LSDVFR
Sbjct  444  CLSSDPLQKVMERLANPGVRRLVIVEAGSKRVEGIITLSDVFR  486



>gb|KJB45263.1| hypothetical protein B456_007G298100 [Gossypium raimondii]
Length=479

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 137/163 (84%), Gaps = 4/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGTWVPKIGE N + LAMLRP ASL AAL+LL+QA V +IP
Sbjct  316  FKHSSSSLPILQQPICSIPLGTWVPKIGELNGQSLAMLRPNASLGAALSLLVQADVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL+D+YSRSDITALAKDK Y  I LDEM+IH+ALQL ++  +    +  +RC M
Sbjct  376  IVDENDSLVDVYSRSDITALAKDKAYAQIRLDEMSIHQALQLCQDANS----INGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  432  CLRSDTLHKVMERLASPGVRRLVIVEAGSKRVEGIISLSDVFR  474



>ref|XP_010489630.1| PREDICTED: sucrose nonfermenting 4-like protein [Camelina sativa]
Length=487

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  439  MCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  482



>ref|XP_006417620.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
 ref|XP_006417621.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
 dbj|BAJ33729.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35973.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
 gb|ESQ35974.1| hypothetical protein EUTSA_v10007484mg [Eutrema salsugineum]
Length=487

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  439  MCLRSDSLLKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  482



>ref|XP_010528890.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Tarenaya 
hassleriana]
Length=488

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+S +SLPILQ PI +IPLGTWVP IGE   RPLA L+P ASL +AL+LL+QA+V +IP
Sbjct  321  FRNSSSSLPILQQPICSIPLGTWVPSIGESTSRPLATLKPHASLGSALSLLVQAEVSSIP  380

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LD+MTIH+ALQLG++ Y     V  +RCHM
Sbjct  381  IVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTIHRALQLGQDAYPLYGFVNGQRCHM  440

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRRLVIVE GSKRVEGIIS+SDVFR
Sbjct  441  CLRSDSLQKVMERLANPGVRRLVIVEPGSKRVEGIISVSDVFR  483



>ref|XP_010259697.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
Length=494

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVPKIGE +RRPLAMLRP ASLSAAL+LLIQAQV +IP
Sbjct  329  FRHSSSSLPILQQPICSIPLGTWVPKIGE-SRRPLAMLRPNASLSAALSLLIQAQVSSIP  387

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKD+ Y  I LDEMTIH+ALQLG++   SPY   N +RC 
Sbjct  388  IVDDNDSLLDIYSRSDITALAKDRAYAQIQLDEMTIHQALQLGQDG-NSPYGFFNGQRCQ  446

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLR+DPLHKVM++LS PGVRRLVIVEAGSKRVEGI+SLSDVFR
Sbjct  447  MCLRTDPLHKVMERLSNPGVRRLVIVEAGSKRVEGIVSLSDVFR  490



>ref|XP_010259698.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nelumbo 
nucifera]
Length=485

 Score =   238 bits (606),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVPKIGE +RRPLAMLRP ASLSAAL+LLIQAQV +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPKIGE-SRRPLAMLRPNASLSAALSLLIQAQVSSIP  378

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKD+ Y  I LDEMTIH+ALQLG++   SPY   N +RC 
Sbjct  379  IVDDNDSLLDIYSRSDITALAKDRAYAQIQLDEMTIHQALQLGQDG-NSPYGFFNGQRCQ  437

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLR+DPLHKVM++LS PGVRRLVIVEAGSKRVEGI+SLSDVFR
Sbjct  438  MCLRTDPLHKVMERLSNPGVRRLVIVEAGSKRVEGIVSLSDVFR  481



>emb|CDY32146.1| BnaCnng06550D [Brassica napus]
Length=482

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 139/166 (84%), Gaps = 6/166 (4%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL LL+QAQV +IP
Sbjct  315  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALTLLVQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEE---PYASPYMVGNER  436
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++   PY S   +   R
Sbjct  375  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDSSPPYGS---LNGPR  431

Query  435  CHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            C MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  432  CQMCLRSDSLGKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  477



>ref|XP_007035544.1| Sucrose nonfermenting 4 [Theobroma cacao]
 gb|EOY06470.1| Sucrose nonfermenting 4 [Theobroma cacao]
Length=489

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 140/163 (86%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   SLPILQLPI AIPLGTWVP+IGE + RP AMLRPTASLS+ALN+L+QAQV +IP
Sbjct  325  FKHCSGSLPILQLPIYAIPLGTWVPRIGESSSRPFAMLRPTASLSSALNMLVQAQVSSIP  384

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK + YTH NL+EMT+++ALQLG++   +PY   ++RC M
Sbjct  385  IVDDNDSLLDIYCRSDITALAKGRAYTH-NLNEMTVYQALQLGQDS-NTPYETRSQRCQM  442

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+D L KVM++L+ PGVRRLVIVEAG+ RVEGI+SL+D+FR
Sbjct  443  CLRTDTLLKVMEQLANPGVRRLVIVEAGTNRVEGIVSLADIFR  485



>emb|CDX95016.1| BnaC05g06550D [Brassica napus]
Length=483

 Score =   237 bits (605),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA V +IP
Sbjct  316  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAGVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  376  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  434

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KV+++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  435  MCLRSDSLGKVIERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  478



>emb|CDX93522.1| BnaA06g05260D [Brassica napus]
Length=484

 Score =   237 bits (605),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA V +IP
Sbjct  317  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAGVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  377  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  435

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KV+++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  436  MCLRSDSLGKVIERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  479



>ref|XP_009148157.1| PREDICTED: sucrose nonfermenting 4-like protein [Brassica rapa]
Length=484

 Score =   237 bits (605),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA V +IP
Sbjct  317  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAGVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  377  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  435

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KV+++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  436  MCLRSDSLGKVIERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  479



>ref|XP_002892477.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68736.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL LL+QA+V +IP
Sbjct  312  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALALLVQAEVSSIP  371

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  372  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDS-SPPYGIFNGQRCH  430

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  431  MCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  474



>ref|NP_001105555.1| protein kinase AKINbetagamma-2 [Zea mays]
 gb|AAG31752.1|AF276086_1 protein kinase AKINbetagamma-2 [Zea mays]
Length=496

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+ +IPLG+WVPKIG+ N RPLAMLRP ASLS+ALN+L+QA V +IP
Sbjct  329  FKNSTGNLPILNQPVCSIPLGSWVPKIGDLNSRPLAMLRPNASLSSALNMLVQAGVSSIP  388

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAK K+YTH+ LDEMTIH+ALQLG++          +RC M
Sbjct  389  IVDDNDSLLDTYSRSDITALAKAKVYTHVRLDEMTIHQALQLGQDANTPFGFFNGQRCQM  448

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++L+ PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  449  CLRSDPLLKVMERLANPGVRRVFIVEAGSKRVEGIISLSDIFK  491



>ref|XP_006344633.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Solanum 
tuberosum]
Length=483

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IP+GTWVPKIGE + + +AMLRP ASL AAL+LL+QA+V AIP
Sbjct  316  FKHSSSSLPILQQPICSIPIGTWVPKIGESSGKAIAMLRPNASLGAALSLLVQAEVSAIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKD+ Y  I LDE++IH+A+QLG++  +   +   +RC M
Sbjct  376  IVDDNDSLLDIYCRSDITALAKDRAYAQIRLDELSIHQAIQLGQDASSPHGLFNGQRCQM  435

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PG RRLVIVEAGSKRVEGIIS++DVFR
Sbjct  436  CLRSDPLHKVMERLAVPGARRLVIVEAGSKRVEGIISVTDVFR  478



>ref|NP_563834.1| putative activator subunit of SNF1-related protein kinase [Arabidopsis 
thaliana]
 sp|Q944A6.1|SNF4_ARATH RecName: Full=Sucrose nonfermenting 4-like protein; Short=SNF4; 
AltName: Full=CBS domain-containing protein CBSCBS3; AltName: 
Full=SNF1-related protein kinase regulatory subunit betagamma; 
Short=AKIN subunit betagamma; Short=AKINbetagamma [Arabidopsis 
thaliana]
 gb|AAL27498.1|AF439826_1 At1g09020/F7G19_11 [Arabidopsis thaliana]
 gb|AAN18191.1| At1g09020/F7G19_11 [Arabidopsis thaliana]
 gb|ABA12450.1| AKINbetagamma [Arabidopsis thaliana]
 gb|AEE28383.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana]
Length=487

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALALLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  439  MCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  482



>ref|XP_009339832.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=492

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPIL+ PI A+ +GTWVP+IGE N RPLAMLRP+ SLSAALNLL+QAQV +IP
Sbjct  327  FRHSSSSLPILRAPICALNVGTWVPEIGESNHRPLAMLRPSDSLSAALNLLVQAQVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLL+IY RSDITALAKD+ Y  INL+EM+I +ALQLG++ + S Y    +RC M
Sbjct  387  IVDDNNSLLEIYCRSDITALAKDRAYAGINLNEMSIQQALQLGQDSF-SLYEPRGQRCQM  445

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  446  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  488



>dbj|BAK02043.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04642.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  SLPIL  P+ +IPLGTW PK GEPN  PLAMLRP  SLS+ALNLL+QA V +IP
Sbjct  331  FKNSTGSLPILNQPVCSIPLGTWAPKSGEPNGHPLAMLRPNTSLSSALNLLVQAGVSSIP  390

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+D YSRSDITALAKDK+YTHI LDEMTIH+ALQLG++  +   +   +RC M
Sbjct  391  IVDDNDSLIDTYSRSDITALAKDKVYTHIRLDEMTIHQALQLGQDANSPFGLFNGQRCQM  450

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR+ IVEAGSKRVEG+ISLSD+F+
Sbjct  451  CLRSDTLMKVMERLANPGVRRVFIVEAGSKRVEGVISLSDIFK  493



>ref|XP_009339830.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339831.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=493

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPIL+ PI A+ +GTWVP+IGE N RPLAMLRP+ SLSAALNLL+QAQV +IP
Sbjct  328  FRHSSSSLPILRAPICALNVGTWVPEIGESNHRPLAMLRPSDSLSAALNLLVQAQVSSIP  387

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLL+IY RSDITALAKD+ Y  INL+EM+I +ALQLG++ + S Y    +RC M
Sbjct  388  IVDDNNSLLEIYCRSDITALAKDRAYAGINLNEMSIQQALQLGQDSF-SLYEPRGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  447  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDVFK  489



>emb|CDY22651.1| BnaC08g42850D [Brassica napus]
Length=482

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA+V AIP
Sbjct  315  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAEVSAIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY M   +RC 
Sbjct  375  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGMFNGQRCQ  433

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KV+++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  434  MCLRSDSLGKVIERLANPGVRRLVIVEAGSKRVEGIISLSDVFK  477



>emb|CDY06344.1| BnaA09g48590D [Brassica napus]
Length=482

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA+V AIP
Sbjct  315  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAEVSAIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY M   +RC 
Sbjct  375  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGMFNGQRCQ  433

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KV+++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  434  MCLRSDSLGKVIERLANPGVRRLVIVEAGSKRVEGIISLSDVFK  477



>dbj|BAO51911.1| SnRK1 beta-gamma subunit [Hordeum vulgare subsp. vulgare]
Length=497

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  SLPIL  P+ +IPLGTW PK GEPN  PLAMLRP  SLS+ALNLL+QA V +IP
Sbjct  331  FKNSTGSLPILNQPVCSIPLGTWAPKPGEPNGHPLAMLRPNTSLSSALNLLVQAGVSSIP  390

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+D YSRSDITALAKDK+YTHI LDEMTIH+ALQLG++  +   +   +RC M
Sbjct  391  IVDDNDSLIDTYSRSDITALAKDKVYTHIRLDEMTIHQALQLGQDANSPFGLFNGQRCQM  450

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR+ IVEAGSKRVEG+ISLSD+F+
Sbjct  451  CLRSDTLMKVMERLANPGVRRVFIVEAGSKRVEGVISLSDIFK  493



>ref|XP_009588179.1| PREDICTED: sucrose nonfermenting 4-like protein [Nicotiana tomentosiformis]
Length=484

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IP+GTWVP+IGE + +P+AMLR  ASL AAL+LL+QA+V ++P
Sbjct  317  FKHSSSSLPILQQPICSIPIGTWVPQIGEASGKPVAMLRRNASLGAALSLLVQAEVSSVP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKD+ Y  I+LDE++IH+A+QLG++  +SP+ + N +RC 
Sbjct  377  IVDDNDSLLDIYSRSDITALAKDRAYAQIHLDELSIHQAIQLGQDA-SSPFGLFNGQRCQ  435

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PG RRLVIVEAGSKRVEGI+S+SDVFR
Sbjct  436  MCLRSDPLHKVMERLAVPGARRLVIVEAGSKRVEGIVSVSDVFR  479



>emb|CDY31116.1| BnaA08g26660D [Brassica napus]
Length=482

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 6/166 (4%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLG+WV +IGE + +PLA LRP ASL +AL+LL+QAQV +IP
Sbjct  315  FRHSSSSLPILQQPICSIPLGSWVHRIGESSSKPLATLRPNASLGSALSLLVQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEE---PYASPYMVGNER  436
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++   PY S   +  +R
Sbjct  375  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDASPPYGS---LNGQR  431

Query  435  CHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            C MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  432  CQMCLRSDSLGKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  477



>ref|XP_004980982.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Setaria 
italica]
Length=494

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+  IPLG+WVPKIG+PN RPLAMLR TASLS+ALN+LIQA V +IP
Sbjct  327  FKNSTGNLPILNQPVCTIPLGSWVPKIGDPNSRPLAMLRRTASLSSALNMLIQAGVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+D YSRSDITALAKDK+YTH+ L+EM I +ALQLG++          +RC M
Sbjct  387  IVDDNDSLVDTYSRSDITALAKDKVYTHVRLEEMAIQQALQLGQDANTPFGYFNGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPL KVM++LS PGVRR+ IVEAGSKRVEGIISLSD+F+
Sbjct  447  CLRSDPLLKVMERLSNPGVRRVFIVEAGSKRVEGIISLSDIFK  489



>ref|XP_010458170.1| PREDICTED: sucrose nonfermenting 4-like protein [Camelina sativa]
Length=487

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + + LA LRP ASL +AL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKALATLRPHASLGSALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  439  MCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  482



>ref|XP_010024669.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Eucalyptus 
grandis]
 gb|KCW61111.1| hypothetical protein EUGRSUZ_H03882 [Eucalyptus grandis]
Length=483

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 8/162 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLP+LQLPI AI +GTW+P+IGEPNRRPLAML+P+ +LS+ALNLLIQAQV +IP
Sbjct  323  FRHCSTSLPVLQLPIYAIRIGTWIPEIGEPNRRPLAMLKPSDTLSSALNLLIQAQVSSIP  382

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRS+ITALAKDK YTHINL+EMTIH+ALQLG++          ++C M
Sbjct  383  IVDDNDSLLDIYSRSEITALAKDKAYTHINLNEMTIHQALQLGQD--------SCQKCQM  434

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CL SD LH+VM++L+ PG+RRLVIVEAGSK V+GI++L DVF
Sbjct  435  CLPSDSLHQVMERLANPGIRRLVIVEAGSKCVKGIVTLGDVF  476



>ref|XP_010024670.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Eucalyptus 
grandis]
 gb|KCW61110.1| hypothetical protein EUGRSUZ_H03882 [Eucalyptus grandis]
Length=480

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 138/162 (85%), Gaps = 8/162 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLP+LQLPI AI +GTW+P+IGEPNRRPLAML+P+ +LS+ALNLLIQAQV +IP
Sbjct  320  FRHCSTSLPVLQLPIYAIRIGTWIPEIGEPNRRPLAMLKPSDTLSSALNLLIQAQVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRS+ITALAKDK YTHINL+EMTIH+ALQLG++          ++C M
Sbjct  380  IVDDNDSLLDIYSRSEITALAKDKAYTHINLNEMTIHQALQLGQD--------SCQKCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CL SD LH+VM++L+ PG+RRLVIVEAGSK V+GI++L DVF
Sbjct  432  CLPSDSLHQVMERLANPGIRRLVIVEAGSKCVKGIVTLGDVF  473



>ref|XP_010921767.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X6 [Elaeis 
guineensis]
Length=440

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLPILQ PI  IP GTWVPKIGE N R LAMLRP A+L AAL+LL+QA V +IP
Sbjct  274  FRHCSGSLPILQQPICTIPFGTWVPKIGESNGRLLAMLRPNATLGAALSLLVQAGVSSIP  333

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSD+TALAKD+ Y  I+LDEM IH+ALQLG++  A       +RC M
Sbjct  334  IVDDNDSLLDTYSRSDVTALAKDRAYAKIHLDEMQIHQALQLGQDASAPYGFFNGQRCQM  393

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  394  CLHSDTLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  436



>ref|XP_009376653.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009376692.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=482

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI+   LGTWVP IGE N RPLAMLRP +SL+   +LLIQA V +IP
Sbjct  316  FRHSSSSLPILQCPISDFRLGTWVPNIGESNGRPLAMLRPNSSLADVFSLLIQADVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD NDSLLDIYSRSDITALA+DK YT I LDE++IH+AL LG++  +    +  +RC M
Sbjct  376  IVDGNDSLLDIYSRSDITALARDKAYTQIRLDELSIHQALLLGQDANSPSCFLSGQRCQM  435

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  436  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  478



>ref|XP_009376652.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376691.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=483

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI+   LGTWVP IGE N RPLAMLRP +SL+   +LLIQA V +IP
Sbjct  317  FRHSSSSLPILQCPISDFRLGTWVPNIGESNGRPLAMLRPNSSLADVFSLLIQADVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD NDSLLDIYSRSDITALA+DK YT I LDE++IH+AL LG++  +    +  +RC M
Sbjct  377  IVDGNDSLLDIYSRSDITALARDKAYTQIRLDELSIHQALLLGQDANSPSCFLSGQRCQM  436

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  437  CLRSDSLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  479



>gb|KJB45988.1| hypothetical protein B456_007G342100 [Gossypium raimondii]
Length=479

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 136/163 (83%), Gaps = 4/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGT VPKIGE NRRPLAMLRP ASL AAL+LL+QA+V +IP
Sbjct  316  FKHSSSSLPILQQPICSIPLGTRVPKIGESNRRPLAMLRPNASLGAALSLLVQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDEND+L+DIY+RSDIT LAKDK Y  I LDEM+IH+ALQL ++  +       +RC M
Sbjct  376  IVDENDALIDIYARSDITTLAKDKAYAQIRLDEMSIHQALQLEQDANS----FNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL+SD LHKVM++L+ PG RRLVIVEAGSKRVEGIISLSDVFR
Sbjct  432  CLQSDTLHKVMERLANPGTRRLVIVEAGSKRVEGIISLSDVFR  474



>ref|XP_010921766.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X5 [Elaeis 
guineensis]
Length=469

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLPILQ PI  IP GTWVPKIGE N R LAMLRP A+L AAL+LL+QA V +IP
Sbjct  303  FRHCSGSLPILQQPICTIPFGTWVPKIGESNGRLLAMLRPNATLGAALSLLVQAGVSSIP  362

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSD+TALAKD+ Y  I+LDEM IH+ALQLG++  A       +RC M
Sbjct  363  IVDDNDSLLDTYSRSDVTALAKDRAYAKIHLDEMQIHQALQLGQDASAPYGFFNGQRCQM  422

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  423  CLHSDTLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  465



>ref|XP_010921764.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Elaeis 
guineensis]
Length=482

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLPILQ PI  IP GTWVPKIGE N R LAMLRP A+L AAL+LL+QA V +IP
Sbjct  316  FRHCSGSLPILQQPICTIPFGTWVPKIGESNGRLLAMLRPNATLGAALSLLVQAGVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSD+TALAKD+ Y  I+LDEM IH+ALQLG++  A       +RC M
Sbjct  376  IVDDNDSLLDTYSRSDVTALAKDRAYAKIHLDEMQIHQALQLGQDASAPYGFFNGQRCQM  435

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  436  CLHSDTLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  478



>ref|XP_010921765.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Elaeis 
guineensis]
Length=478

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLPILQ PI  IP GTWVPKIGE N R LAMLRP A+L AAL+LL+QA V +IP
Sbjct  312  FRHCSGSLPILQQPICTIPFGTWVPKIGESNGRLLAMLRPNATLGAALSLLVQAGVSSIP  371

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSD+TALAKD+ Y  I+LDEM IH+ALQLG++  A       +RC M
Sbjct  372  IVDDNDSLLDTYSRSDVTALAKDRAYAKIHLDEMQIHQALQLGQDASAPYGFFNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  432  CLHSDTLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  474



>ref|XP_009369133.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=492

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS ++LPIL+ PI A+ +GTWVP+IGE N RPLA LRP+ SLSAALNLL+QAQV +IP
Sbjct  327  FRHSSSTLPILRAPICALNVGTWVPEIGESNHRPLATLRPSDSLSAALNLLVQAQVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLL+IY RSDITALAKD+ Y  INL+EM+I +ALQLG++ + S Y    +RC M
Sbjct  387  IVDDNNSLLEIYCRSDITALAKDRAYAGINLNEMSIQQALQLGQDSF-SLYEPRGQRCQM  445

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  446  CLRSDSLHKVMERLAHPGVRRLVIVEAGSKRVEGIVSLSDVFK  488



>ref|XP_009369131.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=493

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS ++LPIL+ PI A+ +GTWVP+IGE N RPLA LRP+ SLSAALNLL+QAQV +IP
Sbjct  328  FRHSSSTLPILRAPICALNVGTWVPEIGESNHRPLATLRPSDSLSAALNLLVQAQVSSIP  387

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLL+IY RSDITALAKD+ Y  INL+EM+I +ALQLG++ + S Y    +RC M
Sbjct  388  IVDDNNSLLEIYCRSDITALAKDRAYAGINLNEMSIQQALQLGQDSF-SLYEPRGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLVIVEAGSKRVEGI+SLSDVF+
Sbjct  447  CLRSDSLHKVMERLAHPGVRRLVIVEAGSKRVEGIVSLSDVFK  489



>ref|XP_010549774.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+S +SLPILQ PI +IPLGTWVP+IGE N RPLA L+P ASL +AL LL+QA+V +IP
Sbjct  216  FRNSSSSLPILQQPICSIPLGTWVPRIGESNGRPLATLKPHASLGSALALLVQAEVSSIP  275

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LD+M IH+ALQL ++          +RCHM
Sbjct  276  IVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMKIHQALQLCQDANPIYGFFNGQRCHM  335

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR+VIVEAGSKRVEGII++SDVFR
Sbjct  336  CLRSDSLQKVMERLANPGVRRVVIVEAGSKRVEGIITVSDVFR  378



>ref|XP_010921763.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=493

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLPILQ PI  IP GTWVPKIGE N R LAMLRP A+L AAL+LL+QA V +IP
Sbjct  327  FRHCSGSLPILQQPICTIPFGTWVPKIGESNGRLLAMLRPNATLGAALSLLVQAGVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSD+TALAKD+ Y  I+LDEM IH+ALQLG++  A       +RC M
Sbjct  387  IVDDNDSLLDTYSRSDVTALAKDRAYAKIHLDEMQIHQALQLGQDASAPYGFFNGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  447  CLHSDTLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  489



>ref|XP_010921762.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=502

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   SLPILQ PI  IP GTWVPKIGE N R LAMLRP A+L AAL+LL+QA V +IP
Sbjct  336  FRHCSGSLPILQQPICTIPFGTWVPKIGESNGRLLAMLRPNATLGAALSLLVQAGVSSIP  395

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSD+TALAKD+ Y  I+LDEM IH+ALQLG++  A       +RC M
Sbjct  396  IVDDNDSLLDTYSRSDVTALAKDRAYAKIHLDEMQIHQALQLGQDASAPYGFFNGQRCQM  455

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  456  CLHSDTLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  498



>ref|XP_010269444.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
 ref|XP_010269445.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
Length=495

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPIL+ PI +IPLGTW+PKIGE  RRPLAMLRP ASLS+AL+LL+QA+V +IP
Sbjct  330  FRHSSSSLPILKQPICSIPLGTWIPKIGEA-RRPLAMLRPNASLSSALSLLVQARVSSIP  388

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVDENDSLLDIY RSDITALAKD+ Y  ++LDEM+IH+ALQLG++   SPY + N +RC 
Sbjct  389  IVDENDSLLDIYCRSDITALAKDRAYAQVHLDEMSIHQALQLGQDA-NSPYGIFNGQRCQ  447

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLR+DPLHKVM++LS PGVRRLVIVEAGSKRVEGI+SLSD+FR
Sbjct  448  MCLRTDPLHKVMERLSNPGVRRLVIVEAGSKRVEGIVSLSDMFR  491



>ref|XP_010269446.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nelumbo 
nucifera]
Length=486

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPIL+ PI +IPLGTW+PKIGE  RRPLAMLRP ASLS+AL+LL+QA+V +IP
Sbjct  321  FRHSSSSLPILKQPICSIPLGTWIPKIGEA-RRPLAMLRPNASLSSALSLLVQARVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVDENDSLLDIY RSDITALAKD+ Y  ++LDEM+IH+ALQLG++   SPY + N +RC 
Sbjct  380  IVDENDSLLDIYCRSDITALAKDRAYAQVHLDEMSIHQALQLGQDA-NSPYGIFNGQRCQ  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLR+DPLHKVM++LS PGVRRLVIVEAGSKRVEGI+SLSD+FR
Sbjct  439  MCLRTDPLHKVMERLSNPGVRRLVIVEAGSKRVEGIVSLSDMFR  482



>ref|XP_002512390.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
 gb|EEF49842.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
Length=540

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ PI +IPLGTWVPKIGE N RP AMLRP ASL  AL+LL+QA+V +IP
Sbjct  310  FRHSASSLPVLQQPICSIPLGTWVPKIGESNVRPFAMLRPNASLGDALSLLVQAEVSSIP  369

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LD+++IH+ALQLG++   SPY   N +RC 
Sbjct  370  IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDKISIHQALQLGQDA-NSPYGFFNGQRCQ  428

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISL  313
            MCL SDPLHKVM++L+ PGVRRL+IVEAGSKRVEG+ISL
Sbjct  429  MCLGSDPLHKVMERLANPGVRRLLIVEAGSKRVEGVISL  467



>ref|XP_010549766.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Tarenaya 
hassleriana]
Length=489

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+S +SLPILQ PI +IPLGTWVP+IGE N RPLA L+P ASL +AL LL+QA+V +IP
Sbjct  322  FRNSSSSLPILQQPICSIPLGTWVPRIGESNGRPLATLKPHASLGSALALLVQAEVSSIP  381

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LD+M IH+ALQL ++          +RCHM
Sbjct  382  IVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMKIHQALQLCQDANPIYGFFNGQRCHM  441

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR+VIVEAGSKRVEGII++SDVFR
Sbjct  442  CLRSDSLQKVMERLANPGVRRVVIVEAGSKRVEGIITVSDVFR  484



>gb|KJB28630.1| hypothetical protein B456_005G059200 [Gossypium raimondii]
Length=420

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   S P+LQLPI AIPLGTWVP+IGE + R  AMLRPT+SLS+ALN+L+QA+V +IP
Sbjct  256  FKHCSGSFPMLQLPIYAIPLGTWVPRIGESSSRSFAMLRPTSSLSSALNMLVQARVSSIP  315

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK + YTH NL+EMT+++ALQLG++   SPY    +R  M
Sbjct  316  IVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEMTVYQALQLGQDS-NSPYEPRTQRFQM  373

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL +D L KVM++L+ PGVRRLVIVEAGS RVEGIISLSDVFR
Sbjct  374  CLHTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGIISLSDVFR  416



>gb|KHG18811.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=470

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   S P+LQLPI AIPLGTWVP+IGE + R  AMLRPT+SLS+ALN+L+QA+V +IP
Sbjct  306  FKHCSGSFPMLQLPIYAIPLGTWVPRIGESSSRSFAMLRPTSSLSSALNMLVQARVSSIP  365

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK ++YTH NL+EMT+++ALQLG++   SPY    +R  M
Sbjct  366  IVDDNDSLLDIYSRSDITALAKGRVYTH-NLNEMTVYQALQLGQDS-NSPYEPRTQRFQM  423

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL +D L KVM++L+ PGVRRLVIVEAGS RVEGIISLSDVFR
Sbjct  424  CLHTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGIISLSDVFR  466



>ref|XP_008388557.1| PREDICTED: sucrose nonfermenting 4-like protein [Malus domestica]
Length=480

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 131/163 (80%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPIL  PI+   LGTWVP IG+ N RPLAMLRP +SL+ A +LLIQA V +IP
Sbjct  315  FRHSSSSLPILLHPISEFRLGTWVPNIGQSNGRPLAMLRPNSSLADAFSLLIQADVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD NDSLLDIYSRSDITALA+DK YT I LDE++IH+AL LG+     PY    +RC M
Sbjct  375  IVDGNDSLLDIYSRSDITALARDKAYTQIRLDELSIHQALLLGQSE-NPPYXFNGQRCQM  433

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL+SD LH VM++L+ PGVRRLVIVEAGSKRVEGIISLSDVFR
Sbjct  434  CLQSDSLHXVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFR  476



>emb|CDP15501.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI++ PLGTWVPKIG+ + +PLAML   ASL+AAL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPISSFPLGTWVPKIGDSDGKPLAMLSSNASLNAALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDENDSL DIY RSDITALAKD+ Y  I L E++I +ALQLG++  A PY    +RC M
Sbjct  380  IVDENDSLQDIYCRSDITALAKDRAYAQIQLSELSIQEALQLGQDANA-PY--NGQRCQM  436

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SDPLHKVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  437  CLPSDPLHKVMERLALPGVRRLVIVEAGSKRVEGIISLSDVFK  479



>ref|XP_006307327.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
 gb|EOA40225.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
Length=484

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA L+P ASL +AL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLKPHASLGSALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+  Q    PY    +   +RCHM
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQLGQDASPPYG---IFNGQRCHM  436

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRRLVIVEAGSKRVEGIISLSDVF+
Sbjct  437  CLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQ  479



>gb|KJB28629.1| hypothetical protein B456_005G059200 [Gossypium raimondii]
Length=470

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   S P+LQLPI AIPLGTWVP+IGE + R  AMLRPT+SLS+ALN+L+QA+V +IP
Sbjct  306  FKHCSGSFPMLQLPIYAIPLGTWVPRIGESSSRSFAMLRPTSSLSSALNMLVQARVSSIP  365

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIYSRSDITALAK + YTH NL+EMT+++ALQLG++   SPY    +R  M
Sbjct  366  IVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEMTVYQALQLGQDS-NSPYEPRTQRFQM  423

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL +D L KVM++L+ PGVRRLVIVEAGS RVEGIISLSDVFR
Sbjct  424  CLHTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGIISLSDVFR  466



>ref|XP_012089047.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Jatropha 
curcas]
Length=463

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 135/163 (83%), Gaps = 11/163 (7%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ PI  IPLGTWVPKIGE N RP AMLRP ASL         A+V +IP
Sbjct  308  FRHSASSLPVLQQPICTIPLGTWVPKIGESNLRPFAMLRPNASL---------AEVSSIP  358

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LDE++IH+ALQLG++  +SP+  G +RCHM
Sbjct  359  IVDDNDSLVDIYSRSDITALAKDKAYAQIHLDEISIHQALQLGQDA-SSPFYNG-QRCHM  416

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SDPLHKVM++L+ PGVRR++IVEAG+KRVEGIISLSDVFR
Sbjct  417  CLGSDPLHKVMERLAIPGVRRILIVEAGTKRVEGIISLSDVFR  459



>ref|XP_008802115.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
 ref|XP_008802116.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
Length=502

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPILQ PI  +PLGTWVPK GE N R L+MLRP+A+L AAL+LL+QA V +IP
Sbjct  327  FRHCSSSLPILQRPICTVPLGTWVPKTGESNGRLLSMLRPSATLGAALSLLVQAGVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKD+ Y  I+LD+M IH+ALQLG++  A       +RC M
Sbjct  387  IVDDNDSLLDTYSRSDITALAKDRAYAKIHLDQMKIHQALQLGQDASAPYGFFNGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRR++IVEAG+K VEGIISLSDVFR
Sbjct  447  CLHSDTLQKVMERLANPGVRRVIIVEAGNKHVEGIISLSDVFR  489



>ref|XP_010904802.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=463

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ P+  IP+GTWVPKIG+PN R L MLRP+ASLS+AL+LL++A+V +IP
Sbjct  297  FRHSSSSLPVLQQPVCTIPVGTWVPKIGDPNGRALEMLRPSASLSSALSLLVKARVSSIP  356

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLD YSRSDITALAKD+ Y HI LDEM++H+ALQLG++   SPY   N +RC 
Sbjct  357  IVDDNDSLLDTYSRSDITALAKDRAYAHIRLDEMSVHQALQLGQDA-NSPYGFFNGQRCQ  415

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPL KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  416  MCLRSDPLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  459



>ref|XP_012089046.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Jatropha 
curcas]
Length=470

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 142/203 (70%), Gaps = 42/203 (21%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ PI  IPLGTWVPKIGE N RP AMLRP ASL  AL+LL+QA+V +IP
Sbjct  266  FRHSASSLPVLQQPICTIPLGTWVPKIGESNLRPFAMLRPNASLGDALSLLVQAEVSSIP  325

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIH-----------------------  496
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LDE++IH                       
Sbjct  326  IVDDNDSLVDIYSRSDITALAKDKAYAQIHLDEISIHQVISDFFFSFYKYISCNCRHPFC  385

Query  495  -----------------KALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSKPGVR  367
                             KALQLG++  +SP+  G +RCHMCL SDPLHKVM++L+ PGVR
Sbjct  386  QWPQSTNCMDCINLLVQKALQLGQDA-SSPFYNG-QRCHMCLGSDPLHKVMERLAIPGVR  443

Query  366  RLVIVEAGSKRVEGIISLSDVFR  298
            R++IVEAG+KRVEGIISLSDVFR
Sbjct  444  RILIVEAGTKRVEGIISLSDVFR  466



>ref|XP_008813370.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Phoenix 
dactylifera]
Length=484

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S +SLP+LQLP+  IPLGTWVPKIG+PN RPL MLRP ASLS+AL+LL++A+V +IP
Sbjct  318  FKYSSSSLPVLQLPVCTIPLGTWVPKIGDPNGRPLEMLRPNASLSSALSLLVKARVSSIP  377

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLD YSRSDITALAKD+ Y +I L+EM++H+ALQLG++   SPY + N +RC 
Sbjct  378  IVDDNDSLLDTYSRSDITALAKDRAYAYIRLEEMSVHQALQLGQDA-NSPYGIFNGQRCQ  436

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPL KVM++L+ PGVRR+VIVEAGSKRVEGIISLSDVFR
Sbjct  437  MCLRSDPLQKVMERLANPGVRRVVIVEAGSKRVEGIISLSDVFR  480



>ref|XP_008813368.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Phoenix 
dactylifera]
 ref|XP_008813369.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Phoenix 
dactylifera]
Length=493

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S +SLP+LQLP+  IPLGTWVPKIG+PN RPL MLRP ASLS+AL+LL++A+V +IP
Sbjct  327  FKYSSSSLPVLQLPVCTIPLGTWVPKIGDPNGRPLEMLRPNASLSSALSLLVKARVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLD YSRSDITALAKD+ Y +I L+EM++H+ALQLG++   SPY + N +RC 
Sbjct  387  IVDDNDSLLDTYSRSDITALAKDRAYAYIRLEEMSVHQALQLGQDA-NSPYGIFNGQRCQ  445

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPL KVM++L+ PGVRR+VIVEAGSKRVEGIISLSDVFR
Sbjct  446  MCLRSDPLQKVMERLANPGVRRVVIVEAGSKRVEGIISLSDVFR  489



>gb|KHG20472.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=489

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = -2

Query  783  RHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPI  604
            +H PASLPILQLPI AIPLGTWVP+IGE + RP AMLR TASLS+AL++L++A V +IPI
Sbjct  323  KHCPASLPILQLPIYAIPLGTWVPRIGESSSRPFAMLRLTASLSSALDMLVEAHVSSIPI  382

Query  603  VDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMC  424
            VD+NDSL+D+Y RSDI ALAK + YTH NL+EMT+H+ALQLG +    PY   ++RC MC
Sbjct  383  VDDNDSLVDVYCRSDIMALAKGRAYTH-NLNEMTVHQALQLGLDS-NPPYGTRSQRCQMC  440

Query  423  LRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            LR+D L KVM++L+ PGVRRLVIVEAGS RVEGIISL+D+FR
Sbjct  441  LRTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGIISLTDIFR  482



>ref|XP_010904800.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
 ref|XP_010904801.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=493

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ P+  IP+GTWVPKIG+PN R L MLRP+ASLS+AL+LL++A+V +IP
Sbjct  327  FRHSSSSLPVLQQPVCTIPVGTWVPKIGDPNGRALEMLRPSASLSSALSLLVKARVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVD+NDSLLD YSRSDITALAKD+ Y HI LDEM++H+ALQLG++   SPY   N +RC 
Sbjct  387  IVDDNDSLLDTYSRSDITALAKDRAYAHIRLDEMSVHQALQLGQDA-NSPYGFFNGQRCQ  445

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPL KVM++L+ PGVRR++IVEAGSKRVEGIISLSDVFR
Sbjct  446  MCLRSDPLQKVMERLANPGVRRVIIVEAGSKRVEGIISLSDVFR  489



>ref|XP_012089044.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Jatropha 
curcas]
Length=512

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 142/203 (70%), Gaps = 42/203 (21%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ PI  IPLGTWVPKIGE N RP AMLRP ASL  AL+LL+QA+V +IP
Sbjct  308  FRHSASSLPVLQQPICTIPLGTWVPKIGESNLRPFAMLRPNASLGDALSLLVQAEVSSIP  367

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIH-----------------------  496
            IVD+NDSL+DIYSRSDITALAKDK Y  I+LDE++IH                       
Sbjct  368  IVDDNDSLVDIYSRSDITALAKDKAYAQIHLDEISIHQVISDFFFSFYKYISCNCRHPFC  427

Query  495  -----------------KALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSKPGVR  367
                             KALQLG++  +SP+  G +RCHMCL SDPLHKVM++L+ PGVR
Sbjct  428  QWPQSTNCMDCINLLVQKALQLGQDA-SSPFYNG-QRCHMCLGSDPLHKVMERLAIPGVR  485

Query  366  RLVIVEAGSKRVEGIISLSDVFR  298
            R++IVEAG+KRVEGIISLSDVFR
Sbjct  486  RILIVEAGTKRVEGIISLSDVFR  508



>ref|XP_009381016.1| PREDICTED: sucrose nonfermenting 4-like protein [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI  IPLGTWVP+IG+ + RPLAMLRP ASLS AL+LL+QA+V +IP
Sbjct  327  FRHSSSSLPILQQPICKIPLGTWVPRIGDQSGRPLAMLRPNASLSLALSLLVQAEVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSL+D YSRSDITALAKD+IY  I+LDE++IH+ALQLG++  +       +RC M
Sbjct  387  IVDDNDSLVDTYSRSDITALAKDRIYAQIHLDEISIHQALQLGQDANSPNGFFNGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLR+DPL KVM+KL+ PGVRR++IVEAGSKRVEGIISLSDV R
Sbjct  447  CLRTDPLQKVMEKLANPGVRRVIIVEAGSKRVEGIISLSDVIR  489



>gb|KHG02417.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=505

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 142/189 (75%), Gaps = 28/189 (15%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQ-------  628
            F+H   SLP+LQLPI A+PLGTWVP+IGE + RP AMLRPTASLS+ALN+L+Q       
Sbjct  315  FKHCSDSLPVLQLPIYAMPLGTWVPRIGESSSRPFAMLRPTASLSSALNMLVQGMKEKIF  374

Query  627  -------------------AQVGAIPIVDENDSLLDIYSRSDITALAKDKIYTHINLDEM  505
                               A+V +IPIVD+NDSLLDIYSRSDITALAK + YTH NL+EM
Sbjct  375  VVLFEVVDKYNKVFPFVFTARVSSIPIVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEM  433

Query  504  TIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEG  325
            T+++ALQLG++   +PY + ++RC MCLR+D L KVM++L+ PGVRRLVIVEAGS RVEG
Sbjct  434  TVYQALQLGQDS-NTPYEMRSQRCQMCLRTDTLLKVMEQLANPGVRRLVIVEAGSNRVEG  492

Query  324  IISLSDVFR  298
            ++SL+DVFR
Sbjct  493  VVSLTDVFR  501



>gb|KHN20226.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=480

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F HS  SLPILQLPI +IP+GTWV K+GE N++PLAMLRP ASL  AL+LLIQA+V +IP
Sbjct  314  FEHSSDSLPILQLPIGSIPVGTWVSKVGESNKKPLAMLRPNASLGDALSLLIQAEVSSIP  373

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNE-RCH  430
            IVD NDSLLDIYSR DI AL KDK+Y  I+L   +IH+AL LG +    PY + N  RCH
Sbjct  374  IVDTNDSLLDIYSRRDIIALVKDKVYARISLAGFSIHQALLLGRDARF-PYGLRNGPRCH  432

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD LHKVM +L+ PGVRRLV+VEAGS+RVEGIIS+ DVFR
Sbjct  433  MCLRSDSLHKVMVRLANPGVRRLVVVEAGSRRVEGIISIGDVFR  476



>ref|XP_003609636.1| 5'-AMP-activated protein kinase subunit gamma [Medicago truncatula]
Length=489

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 135/176 (77%), Gaps = 14/176 (8%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLL---------  634
            FR   +SLPILQLPI AIP+GTW+PKIGE NRRPLA LRP A  S +  L          
Sbjct  311  FRSCSSSLPILQLPICAIPVGTWMPKIGETNRRPLATLRPNADGSGSGVLTPTLRRSVVL  370

Query  633  ----IQAQVGAIPIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPY  466
                +  QV +IPIVDE+DSLLDIY RSDITALAKD+ YTHINLDEMT+H+ALQL ++ +
Sbjct  371  GCDKLNTQVSSIPIVDESDSLLDIYCRSDITALAKDRAYTHINLDEMTVHQALQLSQDAF  430

Query  465  ASPYMVGNERCHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
             +P    ++RC MCLR+D LHKVM++L+ PGVRRLVIVEAGSKRVEGIISL+D+F+
Sbjct  431  -NPNESRSQRCQMCLRTDSLHKVMERLANPGVRRLVIVEAGSKRVEGIISLTDIFK  485



>ref|XP_003555605.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Glycine max]
 ref|XP_006606520.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Glycine max]
Length=486

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F HS  SLPILQLPI +IP+GTWV K+GE N++PLAMLRP ASL  AL+LLIQA+V +IP
Sbjct  320  FEHSSDSLPILQLPIGSIPVGTWVSKVGESNKKPLAMLRPNASLGDALSLLIQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNE-RCH  430
            IVD NDSLLDIYSR DI AL KDK+Y  I+L   +IH+AL LG +    PY + N  RCH
Sbjct  380  IVDTNDSLLDIYSRRDIIALVKDKVYARISLAGFSIHQALLLGRDARF-PYGLRNGPRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSD LHKVM +L+ PGVRRLV+VEAGS+RVEGIIS+ DVFR
Sbjct  439  MCLRSDSLHKVMVRLANPGVRRLVVVEAGSRRVEGIISIGDVFR  482



>ref|XP_006419619.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
 gb|ESR32859.1| hypothetical protein CICLE_v10004799mg [Citrus clementina]
Length=505

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  330  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  389

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  390  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  448

Query  426  CLRSDPLHKVMDKLSKPG  373
            CL SD LHKVM++L+ PG
Sbjct  449  CLPSDTLHKVMERLANPG  466



>ref|XP_004293513.1| PREDICTED: sucrose nonfermenting 4-like protein [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+S +SLPILQ PI+   +GTW P IGE N R LAMLRP +SL+ AL+LLIQA+V +IP
Sbjct  316  FRYSSSSLPILQHPISEFRIGTWAPNIGESNGRLLAMLRPNSSLADALSLLIQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDEN+ LLD+YSRSDITALA+D  YT I L+E+TIH+ LQL +   +    +  ++C M
Sbjct  376  IVDENNLLLDVYSRSDITALARDGAYTQIRLNELTIHQTLQLRQNASSPHGFISGQKCQM  435

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSDPLHKVM++L+ PGVRRLVIV+AGSKRVEGIISLSD+F+
Sbjct  436  CLRSDPLHKVMERLANPGVRRLVIVDAGSKRVEGIISLSDMFK  478



>gb|KDO75159.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=505

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  330  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  389

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+ALQLG++ Y SPY + ++RC M
Sbjct  390  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSY-SPYELRSQRCQM  448

Query  426  CLRSDPLHKVMDKLSKPG  373
            CL SD LHKVM++L+ PG
Sbjct  449  CLPSDTLHKVMERLANPG  466



>ref|XP_010931610.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Elaeis 
guineensis]
Length=428

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ P+  IPLGTWVPKIG+PN  PLAMLRPTASLS+AL+LL++A+V +IP
Sbjct  262  FRHSSSSLPILQQPVCKIPLGTWVPKIGDPNGCPLAMLRPTASLSSALSLLVEARVSSIP  321

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKD+ Y  I LDEM+IH+ALQLG++          +RC M
Sbjct  322  IVDDNDSLLDTYSRSDITALAKDRAYALIRLDEMSIHQALQLGQDTNFPYGFFNGKRCQM  381

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR++IVEAGSK VEGIISLSDVFR
Sbjct  382  CLRSDSLQKVMERLANPGVRRIIIVEAGSKHVEGIISLSDVFR  424



>ref|XP_007138886.1| hypothetical protein PHAVU_009G246000g [Phaseolus vulgaris]
 gb|ESW10880.1| hypothetical protein PHAVU_009G246000g [Phaseolus vulgaris]
Length=457

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLP+LQ PI+AIP+GTWVPKIGE NR+PLAMLRPTASL++ALNLL+QAQV +IP
Sbjct  319  FRHCSSSLPVLQFPISAIPVGTWVPKIGESNRQPLAMLRPTASLASALNLLVQAQVSSIP  378

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLDIY RSDITALAK++ YTHINLDEMT+H+ALQLG++ Y SPY + ++RC M
Sbjct  379  IVDDNDSLLDIYCRSDITALAKNRAYTHINLDEMTVHQALQLGQDAY-SPYELRSQRCQM  437

Query  426  CLRSDPLHKVMDKLSKP  376
            CLRSD LHKVM++L+ P
Sbjct  438  CLRSDSLHKVMERLANP  454



>ref|XP_006307328.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
 gb|EOA40226.1| hypothetical protein CARUB_v10008946mg [Capsella rubella]
Length=495

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA L+P ASL +AL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLKPHASLGSALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVE  328
            MCLRSD L KVM++L+ PGVRRLVIVEAGSKRVE
Sbjct  439  MCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVE  472



>gb|KJB38630.1| hypothetical protein B456_006G264100 [Gossypium raimondii]
Length=486

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = -2

Query  783  RHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPI  604
            +H P+SLPILQLPI AI LGTWVP+IGE + RP AMLR TASLS+AL++L++A V +IPI
Sbjct  323  KHCPSSLPILQLPIYAIRLGTWVPRIGESSSRPFAMLRLTASLSSALDMLVEAHVSSIPI  382

Query  603  VDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMC  424
            VD+NDSL+D+Y RSDI ALAK + YTH NL+EMT+H+ALQLG +    PY   ++RC MC
Sbjct  383  VDDNDSLVDVYCRSDIMALAKGRAYTH-NLNEMTVHQALQLGLDS-NPPYGTRSQRCQMC  440

Query  423  LRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            LR+D L KVM++L+ PGVRRLVIVEAGS RVEGI SL+D+FR
Sbjct  441  LRTDTLLKVMEQLANPGVRRLVIVEAGSNRVEGITSLTDIFR  482



>ref|XP_010931608.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=493

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ P+  IPLGTWVPKIG+PN  PLAMLRPTASLS+AL+LL++A+V +IP
Sbjct  327  FRHSSSSLPILQQPVCKIPLGTWVPKIGDPNGCPLAMLRPTASLSSALSLLVEARVSSIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKD+ Y  I LDEM+IH+ALQLG++          +RC M
Sbjct  387  IVDDNDSLLDTYSRSDITALAKDRAYALIRLDEMSIHQALQLGQDTNFPYGFFNGKRCQM  446

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR++IVEAGSK VEGIISLSDVFR
Sbjct  447  CLRSDSLQKVMERLANPGVRRIIIVEAGSKHVEGIISLSDVFR  489



>ref|XP_010931609.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=484

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ P+  IPLGTWVPKIG+PN  PLAMLRPTASLS+AL+LL++A+V +IP
Sbjct  318  FRHSSSSLPILQQPVCKIPLGTWVPKIGDPNGCPLAMLRPTASLSSALSLLVEARVSSIP  377

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+NDSLLD YSRSDITALAKD+ Y  I LDEM+IH+ALQLG++          +RC M
Sbjct  378  IVDDNDSLLDTYSRSDITALAKDRAYALIRLDEMSIHQALQLGQDTNFPYGFFNGKRCQM  437

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRR++IVEAGSK VEGIISLSDVFR
Sbjct  438  CLRSDSLQKVMERLANPGVRRIIIVEAGSKHVEGIISLSDVFR  480



>ref|XP_009393220.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393221.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393222.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI  IPLGTWVP++G+ + RP+ +L+P ASL   L+LL+QA+V +IP
Sbjct  324  FRHSSSSLPILQQPICRIPLGTWVPRVGDQSGRPIVVLKPNASLGLVLSLLVQAEVSSIP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVDEN+SL+D YSRSDIT LAKD  Y  I+LDEM+IH+ALQLG++   SPY + N +RC 
Sbjct  384  IVDENESLVDTYSRSDITTLAKDTAYAQIHLDEMSIHQALQLGQDA-NSPYGIFNGQRCQ  442

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRR++IVEAGSKRVEGIISL DVFR
Sbjct  443  MCLRSDPLHKVMERLANPGVRRVIIVEAGSKRVEGIISLGDVFR  486



>ref|XP_009393223.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=489

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI  IPLGTWVP++G+ + RP+ +L+P ASL   L+LL+QA+V +IP
Sbjct  323  FRHSSSSLPILQQPICRIPLGTWVPRVGDQSGRPIVVLKPNASLGLVLSLLVQAEVSSIP  382

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVDEN+SL+D YSRSDIT LAKD  Y  I+LDEM+IH+ALQLG++   SPY + N +RC 
Sbjct  383  IVDENESLVDTYSRSDITTLAKDTAYAQIHLDEMSIHQALQLGQDA-NSPYGIFNGQRCQ  441

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRR++IVEAGSKRVEGIISL DVFR
Sbjct  442  MCLRSDPLHKVMERLANPGVRRVIIVEAGSKRVEGIISLGDVFR  485



>ref|XP_004302417.1| PREDICTED: sucrose nonfermenting 4-like protein [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR+S +SLPILQ PI+   +GTWVP IGE N R LAMLRP +SL+ AL+LLIQA+V +IP
Sbjct  316  FRYSSSSLPILQHPISEFRIGTWVPNIGESNGRLLAMLRPNSSLADALSLLIQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDE +SLLD+YSRSDITALA+D+ YT I L+E+TI++ LQL +   +    V  ++CHM
Sbjct  376  IVDETNSLLDVYSRSDITALARDRAYTQIRLNELTIYQTLQLRQNANSPHGRV--QKCHM  433

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLRSDPLHKVM++L++PGVRRLVIVEAGSKRVEGIISLSDV 
Sbjct  434  CLRSDPLHKVMERLTEPGVRRLVIVEAGSKRVEGIISLSDVL  475



>gb|KHG04062.1| Sucrose nonfermenting 4-like protein [Gossypium arboreum]
Length=543

 Score =   218 bits (555),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 130/158 (82%), Gaps = 4/158 (3%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGT VPKIGE NRRPLAMLRP ASL AAL+L +QA+V +IP
Sbjct  316  FKHSSSSLPILQQPICSIPLGTRVPKIGESNRRPLAMLRPNASLGAALSLFVQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDEN++L+DIYSRSDIT LAKDK Y  + L++M+IH+ALQL ++  +       +RC M
Sbjct  376  IVDENNALIDIYSRSDITTLAKDKAYAQVRLEDMSIHQALQLEQDANS----FNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISL  313
            CL+SD LHKVM++L+ PG RRLVIVEAGSKRVEGIISL
Sbjct  432  CLQSDTLHKVMERLANPGTRRLVIVEAGSKRVEGIISL  469



>ref|XP_006855487.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Amborella 
trichopoda]
 gb|ERN16954.1| hypothetical protein AMTR_s00057p00193960 [Amborella trichopoda]
Length=490

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPIL+ PI ++ LGTWVPKIG+PN RPLAMLR  +SLSAAL+LL+QAQV +IP
Sbjct  324  FRHSSSSLPILEQPICSMGLGTWVPKIGDPNGRPLAMLRLNSSLSAALSLLLQAQVSSIP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            IV+++DSL+DIYSRSDITALAKD+ Y  I LDEM IH+ALQLG++   SPY  +  +RC 
Sbjct  384  IVNDSDSLVDIYSRSDITALAKDRAYAQIRLDEMNIHQALQLGQDA-NSPYSYLNGQRCQ  442

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRR+V+VEAG+KRVEGIISLSDVFR
Sbjct  443  MCLRSDPLHKVMERLAIPGVRRVVVVEAGTKRVEGIISLSDVFR  486



>ref|XP_011627434.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Amborella 
trichopoda]
Length=481

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPIL+ PI ++ LGTWVPKIG+PN RPLAMLR  +SLSAAL+LL+QAQV +IP
Sbjct  315  FRHSSSSLPILEQPICSMGLGTWVPKIGDPNGRPLAMLRLNSSLSAALSLLLQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPY-MVGNERCH  430
            IV+++DSL+DIYSRSDITALAKD+ Y  I LDEM IH+ALQLG++   SPY  +  +RC 
Sbjct  375  IVNDSDSLVDIYSRSDITALAKDRAYAQIRLDEMNIHQALQLGQDA-NSPYSYLNGQRCQ  433

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCLRSDPLHKVM++L+ PGVRR+V+VEAG+KRVEGIISLSDVFR
Sbjct  434  MCLRSDPLHKVMERLAIPGVRRVVVVEAGTKRVEGIISLSDVFR  477



>ref|XP_009387018.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387019.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387020.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387022.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLPILQ  I  IP+GTW+ +IGE N + LAMLRP  SLS+AL LL+QAQV +IP
Sbjct  316  FRHSSVSLPILQQAICTIPVGTWIQRIGESNGKHLAMLRPNESLSSALALLVQAQVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            I+D++D LLD YSRSDIT+LAKD  Y  I+LD+M I++ALQL +E  +       +RC M
Sbjct  376  IIDDHDCLLDAYSRSDITSLAKDNAYARIHLDDMRIYQALQLRQESNSHYGFYKGQRCEM  435

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CL SD L KVM++L+ PGVRRL +VEAGS RVEGIISLSDVFR
Sbjct  436  CLHSDSLQKVMEQLANPGVRRLFVVEAGSNRVEGIISLSDVFR  478



>ref|XP_009412087.1| PREDICTED: sucrose nonfermenting 4-like protein [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPIL  PI   PLGTW+P+IG+ + RP+ MLR  ASLS AL+LL+QA+V AIP
Sbjct  327  FKHSSSSLPILLQPICKFPLGTWLPRIGDQSGRPITMLRANASLSLALSLLVQAEVSAIP  386

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            IVDENDSL+D YSRSDITALAKD +Y  ++LDEM+IH+ALQLG++   SPY + N +RC 
Sbjct  387  IVDENDSLVDTYSRSDITALAKDTVYAKMHLDEMSIHQALQLGQDA-NSPYGIFNGQRCQ  445

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MCL SDPL KV+++L+ PGVRR++IVEAGSKRVEGIISL DVFR
Sbjct  446  MCLPSDPLQKVIERLANPGVRRVIIVEAGSKRVEGIISLGDVFR  489



>gb|KEH32278.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=459

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR   +SLPILQLPI AIP+GTW+PKIGE NRRPLA LRP ASL++ALNLL+QAQV +IP
Sbjct  316  FRSCSSSLPILQLPICAIPVGTWMPKIGETNRRPLATLRPNASLASALNLLVQAQVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDE+DSLLDIY RSDITALAKD+ YTHINLDEMT+H+ALQL ++ + +P    ++RC M
Sbjct  376  IVDESDSLLDIYCRSDITALAKDRAYTHINLDEMTVHQALQLSQDAF-NPNESRSQRCQM  434

Query  426  CLRSDPLHKVMDKLSKPG  373
            CLR+D LHKVM++L+ PG
Sbjct  435  CLRTDSLHKVMERLANPG  452



>ref|XP_007144724.1| hypothetical protein PHAVU_007G179400g [Phaseolus vulgaris]
 gb|ESW16718.1| hypothetical protein PHAVU_007G179400g [Phaseolus vulgaris]
Length=485

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS  SLPILQLPI++IP+GTWV K  E N++PLAML P ASL  AL+LLIQA + +IP
Sbjct  318  FKHSSDSLPILQLPISSIPIGTWVSKSEESNKQPLAMLWPHASLGEALSLLIQAGISSIP  377

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD N SLLDIYSR DI AL KDK+Y  INLD  ++H+AL L  +      +      ++
Sbjct  378  IVDVNYSLLDIYSRRDIIALVKDKMYARINLDVFSVHQALFLARDAGFPSALRNGPSYNI  437

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD LHKVM++L+ PGVRRLV+VEA ++RVEGIIS+ D+FR
Sbjct  438  CLRSDSLHKVMERLANPGVRRLVVVEASTRRVEGIISIGDIFR  480



>gb|AAB70406.1| Contains similarity to Rattus AMP-activated protein kinase (gb|X95577) 
[Arabidopsis thaliana]
Length=391

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL LL+QA+V +IP
Sbjct  249  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALALLVQAEVSSIP  308

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  309  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  367

Query  429  MCLRSDPLHKVMDKLSKPG  373
            MCLRSD L KVM++L+ PG
Sbjct  368  MCLRSDSLVKVMERLANPG  386



>ref|XP_004496022.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cicer arietinum]
Length=489

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 125/163 (77%), Gaps = 1/163 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S +SLPILQLPI++IPLGTW PK+GE N+  LAMLRP AS+S AL+L+IQA+V +IP
Sbjct  321  FKNSSSSLPILQLPIDSIPLGTWAPKVGEYNKLSLAMLRPNASVSTALSLMIQAEVSSIP  380

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IV++NDSLL IYSRSDITALAKD +Y  INLD+ +I +AL L E     PY    +R  M
Sbjct  381  IVNDNDSLLGIYSRSDITALAKDDLYARINLDKFSISQALFLREN-VKLPYRQNGQRFLM  439

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRS  LH VM++L+   +  +V+VE GS+ VEGIIS+ DVFR
Sbjct  440  CLRSHKLHVVMERLANSDIEEVVVVEPGSRHVEGIISIVDVFR  482



>ref|XP_002991046.1| hypothetical protein SELMODRAFT_229585 [Selaginella moellendorffii]
 gb|EFJ07854.1| hypothetical protein SELMODRAFT_229585 [Selaginella moellendorffii]
Length=481

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH P+ LP+L  P+ A+PLGTW P++G  N RPLAMLR +A LSAA +LL+QA V A+P
Sbjct  315  FRHVPSWLPLLLQPLYALPLGTWSPEVGGANCRPLAMLRASAPLSAAFSLLLQANVSALP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            I+D+N SL+D+Y+RSDIT+LA+D+ Y  ++L E+T+ +ALQ+G++   +       RCHM
Sbjct  375  ILDDNGSLIDVYTRSDITSLARDRAYATVHLHEITVGQALQMGQDNNRTGGSSVGTRCHM  434

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRS  L  V+++L+ PGVRR++ VEAGS+ VEGIISL DVFR
Sbjct  435  CLRSHTLRDVIERLATPGVRRVICVEAGSRHVEGIISLRDVFR  477



>ref|XP_002991688.1| hypothetical protein SELMODRAFT_161836 [Selaginella moellendorffii]
 gb|EFJ07259.1| hypothetical protein SELMODRAFT_161836 [Selaginella moellendorffii]
Length=481

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH P+ LP+L  P+ A+PLGTW P++G  N RPLAMLR +A LSAA +LL+QA V A+P
Sbjct  315  FRHVPSWLPLLLQPLYALPLGTWSPEVGGANCRPLAMLRASAPLSAAFSLLLQANVSALP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            I+D+N SL+D+Y+RSDIT+LA+D+ Y  ++L E+T+ +ALQ+G++   +       RCHM
Sbjct  375  ILDDNGSLIDVYTRSDITSLARDRAYATVHLHEITVGQALQMGQDNNRTGGSSVGTRCHM  434

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRS  L  V+++L+ PGVRR++ VEAGS+ VEGIISL DVFR
Sbjct  435  CLRSHTLRDVIERLATPGVRRVICVEAGSRHVEGIISLRDVFR  477



>ref|XP_010475724.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Camelina 
sativa]
Length=463

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 118/141 (84%), Gaps = 2/141 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLPILQ PI +IPLGTWVP+IGE + +PLA LRP ASL +AL+LL+QA+V +IP
Sbjct  320  FRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALSLLVQAEVSSIP  379

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCH  430
            +VD+NDSL+DIYSRSDITALAKDK Y  I+LD+MT+H+ALQLG++  + PY + N +RCH
Sbjct  380  VVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDA-SPPYGIFNGQRCH  438

Query  429  MCLRSDPLHKVMDKLSKPGVR  367
            MCLRSD L KVM++L+ P  R
Sbjct  439  MCLRSDSLLKVMERLANPDER  459



>gb|KJB45989.1| hypothetical protein B456_007G342100 [Gossypium raimondii]
Length=464

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 4/139 (3%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGT VPKIGE NRRPLAMLRP ASL AAL+LL+QA+V +IP
Sbjct  316  FKHSSSSLPILQQPICSIPLGTRVPKIGESNRRPLAMLRPNASLGAALSLLVQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVDEND+L+DIY+RSDIT LAKDK Y  I LDEM+IH+ALQL ++  +       +RC M
Sbjct  376  IVDENDALIDIYARSDITTLAKDKAYAQIRLDEMSIHQALQLEQDANS----FNGQRCQM  431

Query  426  CLRSDPLHKVMDKLSKPGV  370
            CL+SD LHKVM++L+ PG+
Sbjct  432  CLQSDTLHKVMERLANPGI  450



>ref|XP_009369134.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Pyrus 
x bretschneideri]
Length=467

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 1/137 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS ++LPIL+ PI A+ +GTWVP+IGE N RPLA LRP+ SLSAALNLL+QAQV +IP
Sbjct  328  FRHSSSTLPILRAPICALNVGTWVPEIGESNHRPLATLRPSDSLSAALNLLVQAQVSSIP  387

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLL+IY RSDITALAKD+ Y  INL+EM+I +ALQLG++ + S Y    +RC M
Sbjct  388  IVDDNNSLLEIYCRSDITALAKDRAYAGINLNEMSIQQALQLGQDSF-SLYEPRGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKP  376
            CLRSD LHKVM++L+ P
Sbjct  447  CLRSDSLHKVMERLAHP  463



>ref|XP_009369135.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Pyrus 
x bretschneideri]
Length=465

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 1/137 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS ++LPIL+ PI A+ +GTWVP+IGE N RPLA LRP+ SLSAALNLL+QAQV +IP
Sbjct  328  FRHSSSTLPILRAPICALNVGTWVPEIGESNHRPLATLRPSDSLSAALNLLVQAQVSSIP  387

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N+SLL+IY RSDITALAKD+ Y  INL+EM+I +ALQLG++ + S Y    +RC M
Sbjct  388  IVDDNNSLLEIYCRSDITALAKDRAYAGINLNEMSIQQALQLGQDSF-SLYEPRGQRCQM  446

Query  426  CLRSDPLHKVMDKLSKP  376
            CLRSD LHKVM++L+ P
Sbjct  447  CLRSDSLHKVMERLAHP  463



>ref|XP_009384400.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384401.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=485

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS +SLP+LQ  I   PLGTWVP+  E N++ L MLR   SLS+AL LL+QAQV ++P
Sbjct  317  FRHSSSSLPVLQQAICTTPLGTWVPRNAESNKKHLTMLRSNESLSSALALLLQAQVSSVP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD++D LLD YSRSDIT+LAKDK Y  I+LDE++I++ALQL ++          +RCHM
Sbjct  377  IVDDHDRLLDAYSRSDITSLAKDKAYAQIHLDEVSIYQALQLRQDANPHQGSHNGQRCHM  436

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            CLRSD L KVM++L+ PGVRRL +VEAGS RVEGIISL DVF+
Sbjct  437  CLRSDSLQKVMEQLANPGVRRLFVVEAGSNRVEGIISLGDVFK  479



>ref|XP_010249339.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Nelumbo 
nucifera]
Length=450

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 2/162 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             R+S   LP+LQ PI  +PLG WV + G  N   L  L+  + LSAALNLLI+AQ+ +IP
Sbjct  286  LRYSRGVLPLLQKPIGRLPLGAWVSEAGRANGCQLTTLQLDSPLSAALNLLIEAQISSIP  345

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            +VDE  SL+D+Y+RSDIT+LA + +Y HI LD+ ++ +AL+L  +   + Y   ++RC  
Sbjct  346  VVDEKGSLIDVYTRSDITSLANNSVYAHIRLDQTSLREALELVYKATDATY--AHKRCQT  403

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLRSD LH VM++LS P VRRL+++EAGSKRVEGIISL DVF
Sbjct  404  CLRSDSLHDVMERLSDPAVRRLIVIEAGSKRVEGIISLRDVF  445



>ref|XP_010249336.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nelumbo 
nucifera]
Length=474

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 2/162 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             R+S   LP+LQ PI  +PLG WV + G  N   L  L+  + LSAALNLLI+AQ+ +IP
Sbjct  310  LRYSRGVLPLLQKPIGRLPLGAWVSEAGRANGCQLTTLQLDSPLSAALNLLIEAQISSIP  369

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            +VDE  SL+D+Y+RSDIT+LA + +Y HI LD+ ++ +AL+L  +   + Y   ++RC  
Sbjct  370  VVDEKGSLIDVYTRSDITSLANNSVYAHIRLDQTSLREALELVYKATDATY--AHKRCQT  427

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLRSD LH VM++LS P VRRL+++EAGSKRVEGIISL DVF
Sbjct  428  CLRSDSLHDVMERLSDPAVRRLIVIEAGSKRVEGIISLRDVF  469



>ref|XP_010249337.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nelumbo 
nucifera]
Length=470

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 2/162 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             R+S   LP+LQ PI  +PLG WV + G  N   L  L+  + LSAALNLLI+AQ+ +IP
Sbjct  306  LRYSRGVLPLLQKPIGRLPLGAWVSEAGRANGCQLTTLQLDSPLSAALNLLIEAQISSIP  365

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            +VDE  SL+D+Y+RSDIT+LA + +Y HI LD+ ++ +AL+L  +   + Y   ++RC  
Sbjct  366  VVDEKGSLIDVYTRSDITSLANNSVYAHIRLDQTSLREALELVYKATDATY--AHKRCQT  423

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLRSD LH VM++LS P VRRL+++EAGSKRVEGIISL DVF
Sbjct  424  CLRSDSLHDVMERLSDPAVRRLIVIEAGSKRVEGIISLRDVF  465



>ref|XP_010097910.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
 gb|EXB72998.1| Sucrose nonfermenting 4-like protein [Morus notabilis]
Length=302

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 116/159 (73%), Gaps = 6/159 (4%)
 Frame = -2

Query  768  SLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNL-LIQAQVGAIPIVDEN  592
            +L I Q  ++ IP+     + G   +  L  L   ASLS  L    I ++V ++PIVD+N
Sbjct  142  ALKIFQNKVSTIPIIHSSSRDGSYFQSQLLHL---ASLSGILKWKQITSEVSSVPIVDDN  198

Query  591  DSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGN-ERCHMCLRS  415
            DSLLDIYSRSDIT LAKDK Y  I+LDEM+IH+ALQLG++   SPY V N +RC MCL S
Sbjct  199  DSLLDIYSRSDITDLAKDKAYARISLDEMSIHEALQLGQDA-NSPYGVFNGQRCQMCLPS  257

Query  414  DPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            DPLHKVM++LS P VRRLVIVEAGSKRVEGI+SLSDVFR
Sbjct  258  DPLHKVMERLSNPRVRRLVIVEAGSKRVEGIVSLSDVFR  296



>gb|KDO75160.1| hypothetical protein CISIN_1g010368mg [Citrus sinensis]
Length=435

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH  +SLPIL+LPI AIP+GTWVPKIGEPNRRPLAMLRP+ASLSAALNLL+QAQV +IP
Sbjct  330  FRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIP  389

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHK  493
            IVD+NDSLLDIY RSDITALAKDK Y HINL EMTIH+
Sbjct  390  IVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQ  427



>gb|AES61373.2| sucrose nonfermenting-like protein [Medicago truncatula]
Length=478

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 119/166 (72%), Gaps = 10/166 (6%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++   SLP+LQLPI +IPLGTW PK+GE N++P+A LRP ASLSAA++L+ QA+V +IP
Sbjct  316  FKNDYGSLPVLQLPIGSIPLGTWAPKVGESNKQPIATLRPNASLSAAISLMNQAEVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQL---GEEPYASPYMVGNER  436
            IVD++ SL D+YSRSD+TALA+ ++Y  I+LD   I +AL L   G+ PY          
Sbjct  376  IVDDSGSLYDVYSRSDLTALARCEMYARISLDSFNISEALNLRKNGKCPYGLILPT----  431

Query  435  CHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
               CLRSDPLH VM+ L+  GV  +V+V++  + VEGIIS+ DVF+
Sbjct  432  ---CLRSDPLHVVMECLANSGVGEVVVVKSACRSVEGIISIGDVFK  474



>ref|XP_011044506.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Populus 
euphratica]
Length=424

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   +LP+LQLPI AIP+G+WVP IGEP+ RPLAMLRP+ASLS+ALNLLIQAQV +IP
Sbjct  315  FRHCSGTLPMLQLPIGAIPVGSWVPSIGEPSGRPLAMLRPSASLSSALNLLIQAQVSSIP  374

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHK  493
            IVDENDSL+DIY RSDITALAKDKIYTHINL+EMTI++
Sbjct  375  IVDENDSLIDIYCRSDITALAKDKIYTHINLNEMTINQ  412



>ref|XP_002516895.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
 gb|EEF45509.1| AMP-activated protein kinase, gamma regulatory subunit, putative 
[Ricinus communis]
Length=485

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH   +LPILQLPI AIP+GTWVP+IGE NRRPL MLRP ASLS+ALNLLI AQV +IP
Sbjct  324  FRHCSGTLPILQLPICAIPVGTWVPRIGESNRRPLEMLRPNASLSSALNLLIHAQVSSIP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHK  493
            IVD ND+LLDIY RSDITALAKD++YTHIN++EMTIH+
Sbjct  384  IVDNNDALLDIYCRSDITALAKDRVYTHININEMTIHQ  421



>gb|KEH32279.1| sucrose nonfermenting-like protein [Medicago truncatula]
Length=415

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR   +SLPILQLPI AIP+GTW+PKIGE NRRPLA LRP ASL++ALNLL+QAQV +IP
Sbjct  316  FRSCSSSLPILQLPICAIPVGTWMPKIGETNRRPLATLRPNASLASALNLLVQAQVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHK  493
            IVDE+DSLLDIY RSDITALAKD+ YTHINLDEMT+H+
Sbjct  376  IVDESDSLLDIYCRSDITALAKDRAYTHINLDEMTVHQ  413



>ref|XP_008776278.1| PREDICTED: sucrose nonfermenting 4-like protein [Phoenix dactylifera]
Length=467

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 113/162 (70%), Gaps = 6/162 (4%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F     SLP+LQ  I  IP+GTW+P  G  + R LA+L+  A LS+AL+LL++A V +IP
Sbjct  307  FGEYIGSLPLLQYQIFRIPIGTWMPNTGRGSVRQLAILQRNAPLSSALDLLLEAGVSSIP  366

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD++ SL+D+YSRSDI ALAKD +Y  I LD+MT+ +AL   E+ Y +    G  RCH 
Sbjct  367  IVDDHGSLIDVYSRSDIMALAKDDMYARIQLDQMTMEQAL---EQVYQAN---GRRRCHT  420

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            CLRS    ++++ LS PGVRRLV+++  ++ VEG+ISL DVF
Sbjct  421  CLRSTSFGEILELLSDPGVRRLVVIDPRTRLVEGMISLRDVF  462



>ref|XP_003591122.1| 5'-AMP-activated protein kinase subunit beta-1 [Medicago truncatula]
Length=501

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (63%), Gaps = 33/189 (17%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQ-------  628
            F++   SLP+LQLPI +IPLGTW PK+GE N++P+A LRP ASLSAA++L+ Q       
Sbjct  316  FKNDYGSLPVLQLPIGSIPLGTWAPKVGESNKQPIATLRPNASLSAAISLMNQVISMLEA  375

Query  627  ----------------AQVGAIPIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIH  496
                            A+V +IPIVD++ SL D+YSRSD+TALA+ ++Y  I+LD   I 
Sbjct  376  KGIIDIEYSLSLLHFAAEVSSIPIVDDSGSLYDVYSRSDLTALARCEMYARISLDSFNIS  435

Query  495  KALQL---GEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEG  325
            +AL L   G+ PY             CLRSDPLH VM+ L+  GV  +V+V++  + VEG
Sbjct  436  EALNLRKNGKCPYGLILPT-------CLRSDPLHVVMECLANSGVGEVVVVKSACRSVEG  488

Query  324  IISLSDVFR  298
            IIS+ DVF+
Sbjct  489  IISIGDVFK  497



>ref|XP_006382517.1| kinase family protein [Populus trichocarpa]
 gb|ERP60314.1| kinase family protein [Populus trichocarpa]
Length=216

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLPILQ PI +IPLGTWVPK+ EPNRRPLAML P ASL AAL+LL QA V +IP
Sbjct  82   FRHSAGSLPILQQPICSIPLGTWVPKLEEPNRRPLAMLGPNASLGAALSLLAQANVSSIP  141

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQL  481
            IV++NDSLLD++SRS+ITALAKDK Y  I+LDE++IH+A+  
Sbjct  142  IVNDNDSLLDVFSRSNITALAKDKAYAQIHLDEISIHQAISF  183



>ref|XP_001770299.1| predicted protein [Physcomitrella patens]
 gb|EDQ64974.1| predicted protein, partial [Physcomitrella patens]
Length=466

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 116/164 (71%), Gaps = 1/164 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRH P+S+P+   PI  + +G WV  I EP  RPL +LR   SLS AL LL++A+V A+P
Sbjct  300  FRHVPSSVPLFSQPIGTLRIGNWVSGIAEPGSRPLQVLRRDESLSRALALLLEARVSALP  359

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLG-EEPYASPYMVGNERCH  430
            +VDEN    D+Y+R DITALA+D  YT   L+++T+ +ALQ+G  + +  P  +   R H
Sbjct  360  VVDENGVFQDVYARGDITALARDSTYTRPQLNDLTVSQALQIGAAQDWTGPGPLSGNRYH  419

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
            MC+RSD L  V+++L+ PGVRRL+ +EAGS++VEGII+L DVF+
Sbjct  420  MCIRSDSLRYVIERLALPGVRRLICIEAGSRQVEGIITLRDVFQ  463



>gb|AFW66924.1| hypothetical protein ZEAMMB73_799257 [Zea mays]
Length=440

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++S  +LPIL  P+ +IPLG+WVPKIG+ N RPLAMLRP ASLS+ALN+L+QA V +IP
Sbjct  329  FKNSTGNLPILNQPVCSIPLGSWVPKIGDLNSRPLAMLRPNASLSSALNMLVQAGVSSIP  388

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKAL  487
            IVD+NDSLLD YSRSDITALAKDK+YTH+ LDEMTIH+ L
Sbjct  389  IVDDNDSLLDTYSRSDITALAKDKVYTHVRLDEMTIHQCL  428



>gb|KJB72643.1| hypothetical protein B456_011G188600 [Gossypium raimondii]
Length=446

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+H   SLP+LQLPI AIPLGTWVP+IGE + RP AMLRPTASLS+ALN+L+QA+V +IP
Sbjct  324  FKHCSGSLPVLQLPIYAIPLGTWVPRIGESSSRPFAMLRPTASLSSALNMLVQARVSSIP  383

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHK  493
            IVD+NDSLLDIYSRSDITALAK + YTH NL+EMTI++
Sbjct  384  IVDDNDSLLDIYSRSDITALAKGRAYTH-NLNEMTIYQ  420



>gb|KDO56289.1| hypothetical protein CISIN_1g011558mg [Citrus sinensis]
Length=426

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ P+++I LGTWVP+IGE N RP AMLRPTASL +AL LL+QA V +IP
Sbjct  317  FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP  376

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKAL  487
            IVD+NDSLLDIYSRSDITALAKDK Y  I+LDEM IH+ +
Sbjct  377  IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQVI  416



>ref|XP_011073279.1| PREDICTED: sucrose nonfermenting 4-like protein [Sesamum indicum]
Length=470

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 109/162 (67%), Gaps = 7/162 (4%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F++    L +LQ P+  +PLGTW  ++     RPL  L P   LS+AL LL++AQ+ +IP
Sbjct  297  FKNHLGYLTLLQQPVGYLPLGTWSIEVRRALGRPLLTLHPNDPLSSALTLLLEAQISSIP  356

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD + + ++IYSRSDIT+LAKD IYT I L++MT+ +AL+L  E        G  R   
Sbjct  357  IVDHSGNFINIYSRSDITSLAKDNIYTRIQLNQMTVSQALELTAER-------GRSRYKT  409

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            C R D L++VM+ LS+P +RR+++VEA S+ VEGII+L DVF
Sbjct  410  CTRFDSLYRVMELLSEPDMRRVIVVEASSRHVEGIITLRDVF  451



>ref|XP_010318679.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Solanum 
lycopersicum]
Length=416

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LPI+Q P+  +P GTW  ++G   + R L  L     LS+AL LLI+ ++ +I
Sbjct  256  FRHSLEYLPIVQQPVGNLPFGTWTREVGGRGSSRVLLTLHSGDLLSSALKLLIEGEISSI  315

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PIVD+N +L+++YSRSDIT+LA+  +Y H  LD+M + + LQ+ +E          +RC 
Sbjct  316  PIVDDNGALINVYSRSDITSLARGSVYAHFRLDQMIMTQVLQVLDEA-------SRDRCR  368

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R DPL+++M+ LS P VRR+V+++  S+ VEGII+L DVF
Sbjct  369  TCTRFDPLYRIMEVLSDPTVRRVVVIDPNSRHVEGIITLRDVF  411



>gb|KJB45264.1| hypothetical protein B456_007G298100 [Gossypium raimondii]
Length=434

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            F+HS +SLPILQ PI +IPLGTWVPKIGE N + LAMLRP ASL AAL+LL+QA V +IP
Sbjct  316  FKHSSSSLPILQQPICSIPLGTWVPKIGELNGQSLAMLRPNASLGAALSLLVQADVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHK  493
            IVDENDSL+D+YSRSDITALAKDK Y  I LDEM+IH+
Sbjct  376  IVDENDSLVDVYSRSDITALAKDKAYAQIRLDEMSIHQ  413



>ref|XP_004235851.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Solanum 
lycopersicum]
Length=466

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LPI+Q P+  +P GTW  ++G   + R L  L     LS+AL LLI+ ++ +I
Sbjct  306  FRHSLEYLPIVQQPVGNLPFGTWTREVGGRGSSRVLLTLHSGDLLSSALKLLIEGEISSI  365

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PIVD+N +L+++YSRSDIT+LA+  +Y H  LD+M + + LQ+ +E          +RC 
Sbjct  366  PIVDDNGALINVYSRSDITSLARGSVYAHFRLDQMIMTQVLQVLDE-------ASRDRCR  418

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R DPL+++M+ LS P VRR+V+++  S+ VEGII+L DVF
Sbjct  419  TCTRFDPLYRIMEVLSDPTVRRVVVIDPNSRHVEGIITLRDVF  461



>emb|CDO98288.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 105/162 (65%), Gaps = 7/162 (4%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FR     LP+LQ P+  +PLGTW  +IG+   R L  LR +  LS+ALNLLIQA V ++P
Sbjct  296  FRRHLEFLPLLQQPVGNLPLGTWAREIGKSGDRLLLTLRASEPLSSALNLLIQACVSSVP  355

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHM  427
            IVD+N  L+D+Y RSDIT+LA    YT I LD+  I +AL++ +    S Y         
Sbjct  356  IVDDNGILVDVYCRSDITSLANSNGYTRIQLDQTIISQALEIADVTSQSRY-------QT  408

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
            C R D L++VM+ LS   VRR++++EA S++VEGII+L D+F
Sbjct  409  CTRFDSLYRVMELLSDQAVRRVIVIEASSRQVEGIITLRDIF  450



>ref|XP_009778506.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X4 [Nicotiana 
sylvestris]
Length=435

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LP+LQ P+  +PLGTW  ++G   + R L  L     LS+AL LLI+ Q+ +I
Sbjct  275  FRHSLEYLPLLQQPVGNLPLGTWAREVGGRASSRVLLTLYSRDPLSSALKLLIEGQISSI  334

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PI+D++ +L+++YSRSDIT+LA+  +Y    LD+MT+ + L++ +E       V  +RC 
Sbjct  335  PILDDDGALINVYSRSDITSLARGNVYARFRLDQMTMAQVLEVIDE-------VSRDRCR  387

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+K+M+ +S P VRR+V+++  S++VEGII+L DVF
Sbjct  388  TCTRFDSLYKIMELISDPIVRRIVVIDPNSRQVEGIITLRDVF  430



>ref|XP_009778502.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009778503.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LP+LQ P+  +PLGTW  ++G   + R L  L     LS+AL LLI+ Q+ +I
Sbjct  307  FRHSLEYLPLLQQPVGNLPLGTWAREVGGRASSRVLLTLYSRDPLSSALKLLIEGQISSI  366

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PI+D++ +L+++YSRSDIT+LA+  +Y    LD+MT+ + L++ +E       V  +RC 
Sbjct  367  PILDDDGALINVYSRSDITSLARGNVYARFRLDQMTMAQVLEVIDE-------VSRDRCR  419

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+K+M+ +S P VRR+V+++  S++VEGII+L DVF
Sbjct  420  TCTRFDSLYKIMELISDPIVRRIVVIDPNSRQVEGIITLRDVF  462



>ref|XP_009778504.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nicotiana 
sylvestris]
Length=459

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LP+LQ P+  +PLGTW  ++G   + R L  L     LS+AL LLI+ Q+ +I
Sbjct  299  FRHSLEYLPLLQQPVGNLPLGTWAREVGGRASSRVLLTLYSRDPLSSALKLLIEGQISSI  358

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PI+D++ +L+++YSRSDIT+LA+  +Y    LD+MT+ + L++ +E       V  +RC 
Sbjct  359  PILDDDGALINVYSRSDITSLARGNVYARFRLDQMTMAQVLEVIDE-------VSRDRCR  411

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+K+M+ +S P VRR+V+++  S++VEGII+L DVF
Sbjct  412  TCTRFDSLYKIMELISDPIVRRIVVIDPNSRQVEGIITLRDVF  454



>ref|XP_009778505.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Nicotiana 
sylvestris]
Length=454

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LP+LQ P+  +PLGTW  ++G   + R L  L     LS+AL LLI+ Q+ +I
Sbjct  294  FRHSLEYLPLLQQPVGNLPLGTWAREVGGRASSRVLLTLYSRDPLSSALKLLIEGQISSI  353

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PI+D++ +L+++YSRSDIT+LA+  +Y    LD+MT+ + L++ +E       V  +RC 
Sbjct  354  PILDDDGALINVYSRSDITSLARGNVYARFRLDQMTMAQVLEVIDE-------VSRDRCR  406

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+K+M+ +S P VRR+V+++  S++VEGII+L DVF
Sbjct  407  TCTRFDSLYKIMELISDPIVRRIVVIDPNSRQVEGIITLRDVF  449



>ref|XP_006341458.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006341459.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X3 [Solanum tuberosum]
Length=415

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FR S   LPI+Q P+  +P GTW  ++G   + R L  L     LS+AL LLI+ ++ +I
Sbjct  255  FRRSLEYLPIVQQPVGNLPFGTWTREVGGRASSRVLLTLHSGDLLSSALKLLIEGEISSI  314

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PIVD+N +L+++YSRSDIT+LA+  +Y    LD+M + + LQ+ +E          +RC 
Sbjct  315  PIVDDNGALINVYSRSDITSLARGNVYARFRLDQMIMTQVLQVLDEA-------SRDRCR  367

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+++M+ LS P VRR+V+++  S+ VEGII+L DVF
Sbjct  368  TCTRFDSLYRIMEVLSDPTVRRVVVIDPNSRHVEGIITLRDVF  410



>ref|XP_006341457.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 
X1 [Solanum tuberosum]
Length=465

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FR S   LPI+Q P+  +P GTW  ++G   + R L  L     LS+AL LLI+ ++ +I
Sbjct  305  FRRSLEYLPIVQQPVGNLPFGTWTREVGGRASSRVLLTLHSGDLLSSALKLLIEGEISSI  364

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PIVD+N +L+++YSRSDIT+LA+  +Y    LD+M + + LQ+ +E          +RC 
Sbjct  365  PIVDDNGALINVYSRSDITSLARGNVYARFRLDQMIMTQVLQVLDE-------ASRDRCR  417

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+++M+ LS P VRR+V+++  S+ VEGII+L DVF
Sbjct  418  TCTRFDSLYRIMEVLSDPTVRRVVVIDPNSRHVEGIITLRDVF  460



>ref|XP_010942339.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Elaeis 
guineensis]
Length=454

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -2

Query  768  SLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDEND  589
            S+P+L+  I +IPLGTW+P     + R LA+L+  ASLS+AL+LL++A V +IPIVD+  
Sbjct  300  SMPLLRYQIFSIPLGTWMPNTRRRSVRQLAILQRNASLSSALDLLLEAGVSSIPIVDDRG  359

Query  588  SLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDP  409
            SL+D+YSRSDI ALAKD +Y  I LD+MT+ +AL   E+ Y +    G  RCH CLRS  
Sbjct  360  SLIDVYSRSDILALAKDDMYARIQLDQMTMEQAL---EQVYQAN---GRRRCHTCLRSTS  413

Query  408  LHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
              +++++LS PGVRRLV+++  ++ VEGIISL DVF
Sbjct  414  FREILEQLSDPGVRRLVVIDPRTRLVEGIISLRDVF  449



>ref|XP_010942338.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Elaeis 
guineensis]
Length=467

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -2

Query  768  SLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDEND  589
            S+P+L+  I +IPLGTW+P     + R LA+L+  ASLS+AL+LL++A V +IPIVD+  
Sbjct  313  SMPLLRYQIFSIPLGTWMPNTRRRSVRQLAILQRNASLSSALDLLLEAGVSSIPIVDDRG  372

Query  588  SLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDP  409
            SL+D+YSRSDI ALAKD +Y  I LD+MT+ +AL   E+ Y +    G  RCH CLRS  
Sbjct  373  SLIDVYSRSDILALAKDDMYARIQLDQMTMEQAL---EQVYQAN---GRRRCHTCLRSTS  426

Query  408  LHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
              +++++LS PGVRRLV+++  ++ VEGIISL DVF
Sbjct  427  FREILEQLSDPGVRRLVVIDPRTRLVEGIISLRDVF  462



>dbj|BAH00327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=346

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 104/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             +  P     LQ  I ++P+GTW P  G+ + R L   RP+  L++ L+LL++ +V +IP
Sbjct  186  LQEQPEGYSFLQNQIVSMPIGTWSPHTGKASNRQLRTSRPSTPLNSCLDLLLEDRVSSIP  245

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMV-GNERCH  430
            IVD+N +LLD+YS SDI AL K+ +YT I L+++T+  AL+L        Y V G   CH
Sbjct  246  IVDDNGALLDVYSLSDIMALGKNDVYTRIELEQVTVEHALEL-------QYQVNGRRHCH  298

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             CL +    +V+++LS PGVRR+V++E  S+ V+GIISL D F
Sbjct  299  TCLSTSTFLEVLEQLSAPGVRRVVVIEPRSRFVQGIISLRDAF  341



>ref|NP_001052687.2| Os04g0401300 [Oryza sativa Japonica Group]
 dbj|BAF14601.2| Os04g0401300, partial [Oryza sativa Japonica Group]
Length=370

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 104/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             +  P     LQ  I ++P+GTW P  G+ + R L   RP+  L++ L+LL++ +V +IP
Sbjct  210  LQEQPEGYSFLQNQIVSMPIGTWSPHTGKASNRQLRTSRPSTPLNSCLDLLLEDRVSSIP  269

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMV-GNERCH  430
            IVD+N +LLD+YS SDI AL K+ +YT I L+++T+  AL+L        Y V G   CH
Sbjct  270  IVDDNGALLDVYSLSDIMALGKNDVYTRIELEQVTVEHALEL-------QYQVNGRRHCH  322

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             CL +    +V+++LS PGVRR+V++E  S+ V+GIISL D F
Sbjct  323  TCLSTSTFLEVLEQLSAPGVRRVVVIEPRSRFVQGIISLRDAF  365



>ref|XP_009604833.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Nicotiana 
tomentosiformis]
Length=496

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 106/163 (65%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LP+LQ P+  +PLGTW  ++G   + R L  L     LS+AL LLI+ Q+ +I
Sbjct  336  FRHSLEYLPLLQQPVGNLPLGTWAREVGGRASSRDLLTLYSRDPLSSALKLLIEGQISSI  395

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PI+D+N +L+++YSRSD+T+LA+  +Y    LD+M + + L++ +E          +RC 
Sbjct  396  PILDDNGALINVYSRSDVTSLARSNVYARFRLDQMIMAQVLEVLDEASC-------DRCR  448

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+K+M+ LS P  RR+V+++  ++ V+GII+L DVF
Sbjct  449  TCTRFDSLYKIMELLSDPITRRIVVIDPNTRHVKGIITLRDVF  491



>ref|XP_009604834.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X3 [Nicotiana 
tomentosiformis]
Length=477

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 106/163 (65%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LP+LQ P+  +PLGTW  ++G   + R L  L     LS+AL LLI+ Q+ +I
Sbjct  317  FRHSLEYLPLLQQPVGNLPLGTWAREVGGRASSRDLLTLYSRDPLSSALKLLIEGQISSI  376

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PI+D+N +L+++YSRSD+T+LA+  +Y    LD+M + + L++ +E          +RC 
Sbjct  377  PILDDNGALINVYSRSDVTSLARSNVYARFRLDQMIMAQVLEVLDEASC-------DRCR  429

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+K+M+ LS P  RR+V+++  ++ V+GII+L DVF
Sbjct  430  TCTRFDSLYKIMELLSDPITRRIVVIDPNTRHVKGIITLRDVF  472



>ref|XP_009604831.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009604832.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 106/163 (65%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIG-EPNRRPLAMLRPTASLSAALNLLIQAQVGAI  610
            FRHS   LP+LQ P+  +PLGTW  ++G   + R L  L     LS+AL LLI+ Q+ +I
Sbjct  349  FRHSLEYLPLLQQPVGNLPLGTWAREVGGRASSRDLLTLYSRDPLSSALKLLIEGQISSI  408

Query  609  PIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCH  430
            PI+D+N +L+++YSRSD+T+LA+  +Y    LD+M + + L++ +E          +RC 
Sbjct  409  PILDDNGALINVYSRSDVTSLARSNVYARFRLDQMIMAQVLEVLDEASC-------DRCR  461

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             C R D L+K+M+ LS P  RR+V+++  ++ V+GII+L DVF
Sbjct  462  TCTRFDSLYKIMELLSDPITRRIVVIDPNTRHVKGIITLRDVF  504



>gb|EAY93966.1| hypothetical protein OsI_15744 [Oryza sativa Indica Group]
Length=451

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 104/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             +  P     LQ  I ++P+GTW P  G+ + R L   RP+  L++ L+LL++ +V +IP
Sbjct  291  LQEQPEGYSFLQNQIVSMPIGTWSPHTGKASNRQLRTSRPSTPLNSCLDLLLEDRVSSIP  350

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMV-GNERCH  430
            IVD+N +LLD+YS SDI AL K+ +YT I L+++T+  AL+L        Y V G   CH
Sbjct  351  IVDDNGALLDVYSLSDIMALGKNDVYTRIELEQVTVEHALEL-------QYQVNGRRHCH  403

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             CL +    +V+++LS PGVRR+V++E  S+ V+GIISL D F
Sbjct  404  TCLSTSTFLEVLEQLSAPGVRRVVVIEPRSRFVQGIISLRDAF  446



>emb|CAD40779.1| OSJNBb0012E08.3 [Oryza sativa Japonica Group]
 gb|EAZ30607.1| hypothetical protein OsJ_14660 [Oryza sativa Japonica Group]
Length=451

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 104/163 (64%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             +  P     LQ  I ++P+GTW P  G+ + R L   RP+  L++ L+LL++ +V +IP
Sbjct  291  LQEQPEGYSFLQNQIVSMPIGTWSPHTGKASNRQLRTSRPSTPLNSCLDLLLEDRVSSIP  350

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMV-GNERCH  430
            IVD+N +LLD+YS SDI AL K+ +YT I L+++T+  AL+L        Y V G   CH
Sbjct  351  IVDDNGALLDVYSLSDIMALGKNDVYTRIELEQVTVEHALEL-------QYQVNGRRHCH  403

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             CL +    +V+++LS PGVRR+V++E  S+ V+GIISL D F
Sbjct  404  TCLSTSTFLEVLEQLSAPGVRRVVVIEPRSRFVQGIISLRDAF  446



>emb|CAH66402.1| OSIGBa0155K12.5 [Oryza sativa Indica Group]
Length=451

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 103/163 (63%), Gaps = 8/163 (5%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
             +  P     LQ  I ++P+GTW P  G+ + R L   RP+  L++ L+LL++ +V +IP
Sbjct  291  LQEQPEGYSFLQNQIVSMPIGTWSPHTGKASNRQLRTSRPSTPLNSCLDLLLEDRVSSIP  350

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMV-GNERCH  430
            IVD+N +LLD+YS SDI AL K+ +YT I LD++T   AL+L        Y V G   CH
Sbjct  351  IVDDNGALLDVYSLSDIMALGKNDVYTRIGLDQVTGEHALEL-------QYQVNGRRHCH  403

Query  429  MCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVF  301
             CL +    +V+++LS PGVRR+V++E  S+ V+GIISL D F
Sbjct  404  TCLSTSTFLEVLEQLSAPGVRRVVVIEPRSRFVQGIISLRDAF  446



>ref|NP_001145809.1| SNF4 [Zea mays]
 gb|ACL52633.1| unknown [Zea mays]
Length=255

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  738  AIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSD  559
            +IP+GTW P  G  + R L  L  ++ L+  L++L+Q +V +IPIVD+N SL D+YS SD
Sbjct  111  SIPIGTWSPHTGRSSSRQLRTLLLSSPLNTCLDILLQDRVSSIPIVDDNGSLRDVYSLSD  170

Query  558  ITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSK  379
            I ALAK+ +Y  I L+++T+  AL +  + +      G  +CH CL++  L +V++ LS 
Sbjct  171  IMALAKNDVYARIELEQVTVQNALDVQYQVH------GRRQCHTCLQTSTLLEVLEGLSI  224

Query  378  PGVRRLVIVEAGSKRVEGIISLSDVF  301
            PGVRRLV++E  ++ VEGIISL DVF
Sbjct  225  PGVRRLVVIEQSTRFVEGIISLRDVF  250



>gb|ACF84839.1| unknown [Zea mays]
 gb|AFW58137.1| hypothetical protein ZEAMMB73_812855 [Zea mays]
Length=266

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  738  AIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSD  559
            +IP+GTW P  G  + R L  L  ++ L+  L++L+Q +V +IPIVD+N SL D+YS SD
Sbjct  122  SIPIGTWSPHTGRSSSRQLRTLLLSSPLNTCLDILLQDRVSSIPIVDDNGSLRDVYSLSD  181

Query  558  ITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSK  379
            I ALAK+ +Y  I L+++T+  AL +  + +      G  +CH CL++  L +V++ LS 
Sbjct  182  IMALAKNDVYARIELEQVTVQNALDVQYQVH------GRRQCHTCLQTSTLLEVLEGLSI  235

Query  378  PGVRRLVIVEAGSKRVEGIISLSDVF  301
            PGVRRLV++E  ++ VEGIISL DVF
Sbjct  236  PGVRRLVVIEQSTRFVEGIISLRDVF  261



>ref|XP_003579641.1| PREDICTED: sucrose nonfermenting 4-like protein [Brachypodium 
distachyon]
Length=456

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 8/158 (5%)
 Frame = -2

Query  768  SLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDEND  589
              PILQ  I +IP+GTW P  G  + R L   R +A L + L+ L++ +V +IPIVD+N 
Sbjct  302  GFPILQNQIGSIPIGTWSPHTGRTSNRQLRTSRLSAPLISCLDFLLEDRVSSIPIVDDNG  361

Query  588  SLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNER-CHMCLRSD  412
            SLLD+YS SDI ALAK+ +YT I L+++T+  AL+L        Y V   R CH CL + 
Sbjct  362  SLLDVYSLSDIMALAKNDVYTRIELEQVTVEHALEL-------QYQVNGRRDCHTCLSTS  414

Query  411  PLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
             L +V+++LS PGVRRLV++E  ++ V+GIIS  D  +
Sbjct  415  TLLEVLEQLSVPGVRRLVVIEPMTRFVQGIISSRDAMK  452



>gb|KHN16117.1| Sucrose nonfermenting 4-like protein [Glycine soja]
Length=159

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = -2

Query  630  QAQVGAIPIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYM  451
            + +V +IPIVD NDSLLDI SR DI AL KDK+Y  I+L   +IH+AL LG +   S  +
Sbjct  47   EPEVSSIPIVDNNDSLLDINSRRDIIALVKDKVYARISLSGFSIHQALLLGRDARFSCRL  106

Query  450  VGNERCHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDVFR  298
                RCHMCLRSD LHK  ++L+ PGVR+LV++EAGS+ VEGIIS+ +VFR
Sbjct  107  HNGPRCHMCLRSDSLHK--ERLANPGVRQLVVIEAGSRLVEGIISIGNVFR  155



>ref|XP_004975479.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Setaria 
italica]
Length=453

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 100/145 (69%), Gaps = 6/145 (4%)
 Frame = -2

Query  735  IPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSDI  556
            IP+GTW P  G  + R L  LR ++ L++ L+LL+Q +V +IPIVD+N SL D+YS SDI
Sbjct  310  IPIGTWSPHTGRTSNRQLRTLRLSSPLNSCLDLLLQDRVSSIPIVDDNGSLRDVYSLSDI  369

Query  555  TALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSKP  376
             ALAK+ +Y  I L+++T+  AL +  +      + G  +CH CL++  L +V+++LS P
Sbjct  370  MALAKNDVYARIELEQVTVQNALDVQYQ------VQGRRQCHTCLQTSTLLEVLEELSIP  423

Query  375  GVRRLVIVEAGSKRVEGIISLSDVF  301
            GVRR+V++E  ++ VEGIISL D+F
Sbjct  424  GVRRVVVIEQSTRFVEGIISLRDIF  448



>ref|XP_008661809.1| PREDICTED: uncharacterized protein LOC100279316 isoform X2 [Zea 
mays]
Length=428

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  738  AIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSD  559
            +IP+GTW P  G  + R L  L  ++ L+  L++L+Q +V +IPIVD+N SL D+YS SD
Sbjct  284  SIPIGTWSPHTGRSSSRQLRTLLLSSPLNTCLDILLQDRVSSIPIVDDNGSLRDVYSLSD  343

Query  558  ITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSK  379
            I ALAK+ +Y  I L+++T+  AL +  + +      G  +CH CL++  L +V++ LS 
Sbjct  344  IMALAKNDVYARIELEQVTVQNALDVQYQVH------GRRQCHTCLQTSTLLEVLEGLSI  397

Query  378  PGVRRLVIVEAGSKRVEGIISLSDVF  301
            PGVRRLV++E  ++ VEGIISL DVF
Sbjct  398  PGVRRLVVIEQSTRFVEGIISLRDVF  423



>ref|XP_008661808.1| PREDICTED: uncharacterized protein LOC100279316 isoform X1 [Zea 
mays]
 gb|ACF88122.1| unknown [Zea mays]
 gb|ACG32376.1| SNF4 [Zea mays]
 gb|ACL52486.1| unknown [Zea mays]
 gb|AFW58139.1| SNF4 [Zea mays]
Length=448

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  738  AIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSD  559
            +IP+GTW P  G  + R L  L  ++ L+  L++L+Q +V +IPIVD+N SL D+YS SD
Sbjct  304  SIPIGTWSPHTGRSSSRQLRTLLLSSPLNTCLDILLQDRVSSIPIVDDNGSLRDVYSLSD  363

Query  558  ITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSK  379
            I ALAK+ +Y  I L+++T+  AL +  + +      G  +CH CL++  L +V++ LS 
Sbjct  364  IMALAKNDVYARIELEQVTVQNALDVQYQVH------GRRQCHTCLQTSTLLEVLEGLSI  417

Query  378  PGVRRLVIVEAGSKRVEGIISLSDVF  301
            PGVRRLV++E  ++ VEGIISL DVF
Sbjct  418  PGVRRLVVIEQSTRFVEGIISLRDVF  443



>ref|XP_009387023.1| PREDICTED: sucrose nonfermenting 4-like protein isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=418

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIP  607
            FRHS  SLPILQ  I  IP+GTW+ +IGE N + LAMLRP  SLS+AL LL+QAQV +IP
Sbjct  316  FRHSSVSLPILQQAICTIPVGTWIQRIGESNGKHLAMLRPNESLSSALALLVQAQVSSIP  375

Query  606  IVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHK  493
            I+D++D LLD YSRSDIT+LAKD  Y  I+LD+M I++
Sbjct  376  IIDDHDCLLDAYSRSDITSLAKDNAYARIHLDDMRIYQ  413



>ref|XP_008668069.1| PREDICTED: SNF4 isoform X2 [Zea mays]
Length=372

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  738  AIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSD  559
            +IP+GTW P  G  + R L  L  ++ L+  L+ L++ +V +IPIVD+  +L D+YS SD
Sbjct  228  SIPIGTWSPHTGRSSSRHLRTLLLSSPLNTCLDFLLEDRVSSIPIVDDKGALHDVYSLSD  287

Query  558  ITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSK  379
            I ALAK+ +Y  I L+++T+  AL +  + +      G  +C+ CL+++ L +V++ LS 
Sbjct  288  IMALAKNDVYARIELEQVTVQNALDVQYQVH------GRRQCYTCLQTNTLLEVLEGLSI  341

Query  378  PGVRRLVIVEAGSKRVEGIISLSDVF  301
            PGVRRLV++E  ++ VEGIISL D+F
Sbjct  342  PGVRRLVVIEQSTRFVEGIISLRDIF  367



>ref|NP_001150464.1| SNF4 [Zea mays]
 gb|ACG39195.1| SNF4 [Zea mays]
 tpg|DAA38028.1| TPA: SNF4 [Zea mays]
Length=355

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  738  AIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSD  559
            +IP+GTW P  G  + R L  L  ++ L+  L+ L++ +V +IPIVD+  +L D+YS SD
Sbjct  211  SIPIGTWSPHTGRSSSRHLRTLLLSSPLNTCLDFLLEDRVSSIPIVDDKGALHDVYSLSD  270

Query  558  ITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSK  379
            I ALAK+ +Y  I L+++T+  AL +  + +      G  +C+ CL+++ L +V++ LS 
Sbjct  271  IMALAKNDVYARIELEQVTVQNALDVQYQVH------GRRQCYTCLQTNTLLEVLEGLSI  324

Query  378  PGVRRLVIVEAGSKRVEGIISLSDVF  301
            PGVRRLV++E  ++ VEGIISL D+F
Sbjct  325  PGVRRLVVIEQSTRFVEGIISLRDIF  350



>ref|XP_008668068.1| PREDICTED: SNF4 isoform X1 [Zea mays]
 gb|ACN34638.1| unknown [Zea mays]
 tpg|DAA38027.1| TPA: hypothetical protein ZEAMMB73_994295 [Zea mays]
Length=452

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  738  AIPLGTWVPKIGEPNRRPLAMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSD  559
            +IP+GTW P  G  + R L  L  ++ L+  L+ L++ +V +IPIVD+  +L D+YS SD
Sbjct  308  SIPIGTWSPHTGRSSSRHLRTLLLSSPLNTCLDFLLEDRVSSIPIVDDKGALHDVYSLSD  367

Query  558  ITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMVGNERCHMCLRSDPLHKVMDKLSK  379
            I ALAK+ +Y  I L+++T+  AL +  + +      G  +C+ CL+++ L +V++ LS 
Sbjct  368  IMALAKNDVYARIELEQVTVQNALDVQYQVH------GRRQCYTCLQTNTLLEVLEGLSI  421

Query  378  PGVRRLVIVEAGSKRVEGIISLSDVF  301
            PGVRRLV++E  ++ VEGIISL D+F
Sbjct  422  PGVRRLVVIEQSTRFVEGIISLRDIF  447



>ref|XP_005842864.1| hypothetical protein CHLNCDRAFT_142561 [Chlorella variabilis]
 gb|EFN50752.1| hypothetical protein CHLNCDRAFT_142561 [Chlorella variabilis]
Length=548

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 109/221 (49%), Gaps = 60/221 (27%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVP------------------KIGEPNRR-------PL  682
            FR S ASLP+L  P++A+P+GTW P                    G+P  R        L
Sbjct  322  FRASLASLPLLAQPLSALPIGTWAPTSSLAAGVAQGEEQPRQTNGGDPRLRRQQRRVSKL  381

Query  681  AMLRPTASLSAALNLLIQAQVGAIPIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMT  502
            A +R    L+ AL LL++A V  +P+VD N  LLDIY+R+DIT LAK   Y  +  +++T
Sbjct  382  ACVRGDTPLTHALGLLLEAGVSCLPVVDANGVLLDIYARADITMLAKSNAYARLQFEDVT  441

Query  501  IHKAL-----------------------QLGEEPYASPYMVG------------NERCHM  427
            + +AL                       Q G  P  S   +G              R H+
Sbjct  442  VGQALALAGQALPPPQLAAGAGGGAPPPQWGGSPRGSASSLGADPGSQPPPGSKQHRLHV  501

Query  426  CLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDV  304
            C   D L  V+++LS PGVRRLV+V+  S+RVEGI+SLSDV
Sbjct  502  CTPHDALRTVVERLSVPGVRRLVVVDGESRRVEGIVSLSDV  542



>ref|XP_006590155.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine 
max]
Length=238

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = -2

Query  627  AQVGAIPIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYMV  448
            A+V +IPIVD NDSLLDI SR DI AL KDK+Y  I+L   +IH+AL LG +   S  + 
Sbjct  110  AEVSSIPIVDNNDSLLDINSRRDIIALVKDKVYARISLSGFSIHQALLLGRDARFSCRLH  169

Query  447  GNERCHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRV  331
               RCHMCLRSD LHK  ++L+ PGVR+LV++EAGS+RV
Sbjct  170  NGPRCHMCLRSDSLHK--ERLANPGVRQLVVIEAGSRRV  206



>ref|XP_003058117.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
 gb|EEH58068.1| carbohydrate-binding module family 48 protein [Micromonas pusilla 
CCMP1545]
Length=508

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 19/169 (11%)
 Frame = -2

Query  786  FRHSPASLPILQLPINAIPLGTWVPKIGE--------PNRRPLAMLRPTASLSAALNLLI  631
            FR  P++LP+   PI A+P+GTW   +          P   P+  + P++++  A  ++ 
Sbjct  344  FRGVPSALPLFSQPIGALPIGTWTAALDASASQSTPIPGLLPVKAILPSSTVEDAFKMM-  402

Query  630  QAQVGAIPIVDENDSLLDIYSRSDITALAKDKIYTHINLDEMTIHKALQLGEEPYASPYM  451
                GA+P+VDE   L+D+Y+R+D+  LA +  Y  ++L E T+ +ALQ      A P  
Sbjct  403  -PGCGALPVVDEAGRLVDVYARADVILLAAENTYRRVSLSEFTVAQALQ-----RALP--  454

Query  450  VGNERCHMCLRSDPLHKVMDKLSKPGVRRLVIVEAGSKRVEGIISLSDV  304
                R H C R D L  V++ LS PGVRRLV+V+A S  VEG++SLSDV
Sbjct  455  --TPRAHTCTRGDTLRAVVEALSLPGVRRLVVVDANSHAVEGVVSLSDV  501



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752198629708