BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10348

Length=980
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    509   3e-176   Nicotiana tomentosiformis
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    508   1e-175   Nicotiana sylvestris
ref|XP_011655611.1|  PREDICTED: glutamate--glyoxylate aminotransf...    507   3e-175   Cucumis sativus [cucumbers]
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           505   2e-174   Morus notabilis
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    504   3e-174   Solanum lycopersicum
emb|CBI23368.3|  unnamed protein product                                504   3e-174   Vitis vinifera
ref|XP_012085470.1|  PREDICTED: glutamate--glyoxylate aminotransf...    504   5e-174   Jatropha curcas
ref|NP_001268094.1|  uncharacterized protein LOC100261274               504   7e-174   Vitis vinifera
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    503   8e-174   Solanum tuberosum [potatoes]
emb|CDP13207.1|  unnamed protein product                                503   9e-174   Coffea canephora [robusta coffee]
emb|CAN62302.1|  hypothetical protein VITISV_023686                     501   5e-173   Vitis vinifera
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                499   4e-172   Erythranthe guttata [common monkey flower]
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    499   6e-172   Malus domestica [apple tree]
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             499   6e-172   Citrus clementina [clementine]
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    497   2e-171   
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    497   3e-171   Pyrus x bretschneideri [bai li]
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   495   6e-171   Citrus sinensis [apfelsine]
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    495   1e-170   Prunus mume [ume]
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    494   2e-170   
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             494   5e-170   Prunus persica
gb|AAZ43368.1|  AlaT1                                                   492   2e-169   Vitis labrusca [Concord grape]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    492   2e-169   Populus trichocarpa [western balsam poplar]
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    492   3e-169   Eucalyptus grandis [rose gum]
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    491   5e-169   Nelumbo nucifera [Indian lotus]
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    489   2e-168   Gossypium arboreum [tree cotton]
ref|XP_003613139.1|  Alanine aminotransferase                           489   3e-168   Medicago truncatula
gb|KJB31170.1|  hypothetical protein B456_005G179600                    489   4e-168   Gossypium raimondii
gb|KJB31175.1|  hypothetical protein B456_005G179600                    489   7e-168   Gossypium raimondii
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    487   2e-167   Fragaria vesca subsp. vesca
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    487   2e-167   Glycine max [soybeans]
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             486   4e-167   Phaseolus vulgaris [French bean]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    486   6e-167   Tarenaya hassleriana [spider flower]
ref|NP_001237567.1|  alanine aminotransferase 2                         486   7e-167   
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    485   9e-167   
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    485   1e-166   Cicer arietinum [garbanzo]
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    484   2e-166   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    484   3e-166   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                484   4e-166   Glycine soja [wild soybean]
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    483   8e-166   Elaeis guineensis
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             482   2e-165   Populus trichocarpa [western balsam poplar]
ref|NP_001237581.1|  alanine aminotransferase 3                         482   2e-165   Glycine max [soybeans]
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    482   3e-165   
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    482   3e-165   
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    482   3e-165   Populus euphratica
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    481   5e-165   Brassica rapa
emb|CDY61225.1|  BnaC06g43710D                                          481   5e-165   Brassica napus [oilseed rape]
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    482   6e-165   Brassica rapa
gb|AET06145.1|  PLP-dependent aminotransferase                          479   2e-164   Papaver somniferum
ref|XP_011655610.1|  PREDICTED: glutamate--glyoxylate aminotransf...    479   2e-164   Cucumis sativus [cucumbers]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    479   2e-164   Elaeis guineensis
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    479   3e-164   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             479   5e-164   
dbj|BAJ90574.1|  predicted protein                                      471   9e-164   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY25780.1|  BnaA07g10020D                                          474   1e-163   Brassica napus [oilseed rape]
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    477   2e-163   Brassica rapa
emb|CDX91708.1|  BnaC08g06270D                                          474   3e-163   
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              476   3e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    476   3e-163   Nicotiana sylvestris
gb|AAM61453.1|  putative alanine aminotransferase                       476   4e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             475   8e-163   
dbj|BAH20108.1|  AT1G70580                                              475   1e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             475   1e-162   Capsella rubella
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    474   1e-162   Nicotiana tomentosiformis
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    474   2e-162   Camelina sativa [gold-of-pleasure]
emb|CDY41452.1|  BnaA08g20540D                                          474   2e-162   Brassica napus [oilseed rape]
emb|CDY66294.1|  BnaAnng22050D                                          474   3e-162   Brassica napus [oilseed rape]
gb|EMS58349.1|  Alanine aminotransferase 2                              474   4e-162   Triticum urartu
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    474   4e-162   Camelina sativa [gold-of-pleasure]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    474   4e-162   Camelina sativa [gold-of-pleasure]
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    473   5e-162   Solanum lycopersicum
gb|AAK68842.1|  alanine aminotransferase-like protein                   469   5e-162   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     470   5e-162   
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    473   6e-162   Setaria italica
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             473   6e-162   
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    473   9e-162   Brassica rapa
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    473   1e-161   Camelina sativa [gold-of-pleasure]
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          471   3e-161   
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    471   4e-161   Camelina sativa [gold-of-pleasure]
ref|NP_001058716.1|  Os07g0108300                                       471   4e-161   
gb|AAO84040.1|  alanine aminotransferase                                471   4e-161   Oryza sativa Indica Group [Indian rice]
ref|NP_001151209.1|  alanine aminotransferase 2                         471   6e-161   
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    471   6e-161   Brassica rapa
gb|AAL24255.1|  At1g23310/F26F24_4                                      471   7e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    470   7e-161   Brachypodium distachyon [annual false brome]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 471   7e-161   Arabidopsis thaliana [mouse-ear cress]
gb|EPS68501.1|  hypothetical protein M569_06265                         470   1e-160   Genlisea aurea
emb|CDY12474.1|  BnaC07g13140D                                          471   3e-160   Brassica napus [oilseed rape]
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    469   4e-160   Camelina sativa [gold-of-pleasure]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    468   9e-160   Cucumis melo [Oriental melon]
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          467   2e-159   Arabidopsis lyrata subsp. lyrata
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             466   5e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    466   5e-159   Cucumis sativus [cucumbers]
ref|XP_006840828.1|  PREDICTED: glutamate--glyoxylate aminotransf...    466   5e-159   Amborella trichopoda
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    465   2e-158   
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    464   3e-158   
ref|NP_001183048.1|  uncharacterized protein LOC100501386               463   4e-158   Zea mays [maize]
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    462   9e-158   
ref|XP_010248614.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    453   4e-156   
gb|ABK25444.1|  unknown                                                 450   1e-152   Picea sitchensis
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              450   1e-152   
gb|AFK42206.1|  unknown                                                 442   3e-152   Lotus japonicus
ref|XP_011034252.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    445   3e-152   Populus euphratica
ref|XP_008467047.1|  PREDICTED: glutamate--glyoxylate aminotransf...    416   3e-143   Cucumis melo [Oriental melon]
ref|XP_003613140.1|  Alanine aminotransferase                           411   1e-137   
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    402   5e-134   
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              400   6e-134   Arabidopsis thaliana [mouse-ear cress]
gb|EMT29455.1|  Alanine aminotransferase 2                              402   3e-133   
ref|XP_001763950.1|  predicted protein                                  400   4e-133   
ref|XP_001782822.1|  predicted protein                                  398   1e-132   
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    392   3e-132   
ref|XP_001777071.1|  predicted protein                                  395   4e-131   
ref|XP_002527918.1|  alanine aminotransferase, putative                 392   9e-131   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             379   8e-125   Selaginella moellendorffii
ref|XP_002947519.1|  alanine aminotransferase                           349   7e-113   Volvox carteri f. nagariensis
ref|XP_005651940.1|  alanine aminotransferase                           345   4e-111   Coccomyxa subellipsoidea C-169
ref|XP_001698518.1|  alanine aminotransferase                           340   3e-109   Chlamydomonas reinhardtii
gb|AAB01685.1|  alanine aminotransferase                                335   2e-107   Chlamydomonas reinhardtii
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               321   4e-101   Nannochloropsis gaditana
gb|KJB31174.1|  hypothetical protein B456_005G179600                    311   1e-99    Gossypium raimondii
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    311   4e-98    
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              305   9e-96    Chlorella variabilis
ref|XP_003291733.1|  alanine transaminase                               303   6e-95    Dictyostelium purpureum
ref|XP_009151206.1|  PREDICTED: glutamate--glyoxylate aminotransf...    286   3e-93    
gb|ETP41623.1|  hypothetical protein F442_11247                         294   7e-92    Phytophthora parasitica P10297
gb|ETP13560.1|  hypothetical protein F441_11279                         294   7e-92    Phytophthora parasitica CJ01A1
gb|KIZ07569.1|  alanine transaminase                                    297   1e-91    Monoraphidium neglectum
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    293   2e-91    Auxenochlorella protothecoides
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  292   6e-91    
tpg|DAA63613.1|  TPA: hypothetical protein ZEAMMB73_743428              286   8e-91    
gb|EXX69945.1|  alanine transaminase ALT1                               292   9e-91    Rhizophagus irregularis DAOM 197198w
ref|NP_001060284.1|  Os07g0617800                                       286   1e-90    
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    291   1e-90    Phytophthora parasitica INRA-310
gb|EFA80185.1|  alanine transaminase                                    293   4e-90    Heterostelium album PN500
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               290   1e-89    Acytostelium subglobosum LB1
ref|XP_002906656.1|  alanine aminotransferase 2                         288   2e-89    Phytophthora infestans T30-4
ref|XP_006657961.1|  PREDICTED: alanine aminotransferase 2-like i...    286   2e-89    Oryza brachyantha
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    287   4e-89    Oryza brachyantha
gb|AAV64199.1|  putative alanine aminotransferase                       288   5e-89    Zea mays [maize]
tpg|DAA41461.1|  TPA: hypothetical protein ZEAMMB73_764403              281   5e-89    
dbj|BAC79866.1|  putative alanine aminotransferase                      286   5e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             286   8e-89    Guillardia theta CCMP2712
gb|AAV64237.1|  putative alanine aminotransferase                       287   9e-89    Zea mays [maize]
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              287   1e-88    Zea mays [maize]
gb|KDE04574.1|  hypothetical protein MVLG_05042                         288   2e-88    Microbotryum lychnidis-dioicae p1A1 Lamole
emb|CCI42079.1|  unnamed protein product                                285   3e-88    Albugo candida
gb|EEE67593.1|  hypothetical protein OsJ_25140                          286   3e-88    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          286   3e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         284   3e-88    Oryza brachyantha
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         286   4e-88    Phoenix dactylifera
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      285   4e-88    Ectocarpus siliculosus
ref|NP_001064504.1|  Os10g0390500                                       284   4e-88    
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            284   4e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004992298.1|  alanine aminotransferase                           284   6e-88    Salpingoeca rosetta
ref|XP_008620886.1|  alanine transaminase                               283   2e-87    Saprolegnia diclina VS20
ref|XP_010939850.1|  PREDICTED: alanine aminotransferase 2 isofor...    277   2e-87    
gb|ETI43749.1|  hypothetical protein F443_11362                         283   3e-87    Phytophthora parasitica P1569
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          284   3e-87    Sorghum bicolor [broomcorn]
ref|XP_004345426.2|  alanine aminotransferase                           282   4e-87    Capsaspora owczarzaki ATCC 30864
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              283   5e-87    Phoenix dactylifera
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         281   6e-87    
gb|EIE85592.1|  hypothetical protein RO3G_10302                         281   8e-87    Rhizopus delemar RA 99-880
gb|KFH70378.1|  alanine transaminase                                    281   8e-87    Mortierella verticillata NRRL 6337
gb|KJE95383.1|  alanine aminotransferase                                282   1e-86    Capsaspora owczarzaki ATCC 30864
ref|XP_637993.1|  alanine transaminase                                  281   1e-86    Dictyostelium discoideum AX4
gb|EPB88721.1|  alanine transaminase                                    281   2e-86    Mucor circinelloides f. circinelloides 1006PhL
emb|CEP13768.1|  hypothetical protein                                   280   3e-86    Parasitella parasitica
gb|EEE58449.1|  hypothetical protein OsJ_09677                          271   3e-86    Oryza sativa Japonica Group [Japonica rice]
gb|ETI43741.1|  hypothetical protein F443_11357                         279   4e-86    Phytophthora parasitica P1569
emb|CEG73189.1|  Putative Alanine transaminase                          279   5e-86    Rhizopus microsporus
gb|KDD76740.1|  aminotransferase                                        279   6e-86    Helicosporidium sp. ATCC 50920
emb|CEI91975.1|  Putative Alanine transaminase                          279   7e-86    Rhizopus microsporus
emb|CCA27196.1|  unnamed protein product                                279   8e-86    Albugo laibachii Nc14
gb|ETK88933.1|  hypothetical protein L915_06890                         271   1e-85    Phytophthora parasitica
gb|KDO24164.1|  hypothetical protein SPRG_10592                         278   1e-85    Saprolegnia parasitica CBS 223.65
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         279   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    277   1e-85    Elaeis guineensis
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         279   2e-85    
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              278   2e-85    
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              278   2e-85    
gb|ERM96039.1|  hypothetical protein AMTR_s00129p00080070               275   2e-85    Amborella trichopoda
ref|XP_002887430.1|  ALAAT2                                             278   2e-85    
ref|XP_008869166.1|  hypothetical protein H310_06043                    277   3e-85    Aphanomyces invadans
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              278   4e-85    Elaeis guineensis
dbj|GAN09782.1|  alanine transaminase                                   277   5e-85    Mucor ambiguus
gb|KJB68682.1|  hypothetical protein B456_011G0552001                   271   5e-85    Gossypium raimondii
gb|KJB68683.1|  hypothetical protein B456_011G0552001                   271   6e-85    Gossypium raimondii
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    277   6e-85    Elaeis guineensis
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    276   9e-85    Solanum tuberosum [potatoes]
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             276   1e-84    Phytophthora sojae
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    276   2e-84    Solanum tuberosum [potatoes]
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    275   2e-84    Solanum lycopersicum
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    275   2e-84    
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         275   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM22749.1|  alanine aminotransferase                                263   2e-84    Deschampsia antarctica
ref|XP_010230121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    264   2e-84    
emb|CEG76882.1|  Putative Alanine transaminase                          275   3e-84    Rhizopus microsporus
gb|EEC74641.1|  hypothetical protein OsI_10280                          275   3e-84    Oryza sativa Indica Group [Indian rice]
gb|ADE77246.1|  unknown                                                 269   4e-84    Picea sitchensis
ref|XP_010235387.1|  PREDICTED: alanine aminotransferase 2-like i...    274   5e-84    Brachypodium distachyon [annual false brome]
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    274   8e-84    Acanthamoeba castellanii str. Neff
gb|AET06148.1|  PLP-dependent aminotransferase                          273   9e-84    Papaver somniferum
gb|EPS60556.1|  hypothetical protein M569_14246                         273   1e-83    Genlisea aurea
gb|AAK59591.2|  putative alanine aminotransferase                       274   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011628485.1|  PREDICTED: alanine aminotransferase 2              274   1e-83    Amborella trichopoda
ref|NP_001185380.1|  alanine aminotransferase 2                         274   2e-83    Arabidopsis thaliana [mouse-ear cress]
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    272   2e-83    Hordeum vulgare [barley]
ref|XP_008903570.1|  hypothetical protein PPTG_10079                    272   2e-83    Phytophthora parasitica INRA-310
ref|NP_565040.2|  alanine aminotransferase 2                            274   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009515719.1|  hypothetical protein PHYSODRAFT_477603             272   2e-83    Phytophthora sojae
emb|CEG73119.1|  Putative Alanine transaminase                          273   3e-83    Rhizopus microsporus
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    273   3e-83    Prunus mume [ume]
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             273   3e-83    Prunus persica
emb|CDS14202.1|  hypothetical protein LRAMOSA06372                      273   3e-83    Lichtheimia ramosa
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              271   3e-83    Brachypodium distachyon [annual false brome]
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    272   3e-83    Hordeum vulgare [barley]
emb|CEG73120.1|  Putative Alanine transaminase                          272   3e-83    Rhizopus microsporus
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                271   4e-83    Erythranthe guttata [common monkey flower]
emb|CEI94294.1|  Putative Alanine transaminase                          272   4e-83    Rhizopus microsporus
gb|ETP13552.1|  hypothetical protein F441_11274                         271   4e-83    Phytophthora parasitica CJ01A1
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              273   4e-83    Fragaria vesca subsp. vesca
ref|XP_011651727.1|  PREDICTED: alanine aminotransferase 2-like i...    272   4e-83    Cucumis sativus [cucumbers]
ref|XP_010235383.1|  PREDICTED: alanine aminotransferase 2-like i...    274   4e-83    Brachypodium distachyon [annual false brome]
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    271   4e-83    Gossypium arboreum [tree cotton]
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    273   5e-83    Camelina sativa [gold-of-pleasure]
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    272   5e-83    Cucumis melo [Oriental melon]
ref|XP_002499950.1|  alanine aminotransferase                           270   6e-83    Micromonas commoda
ref|XP_004144444.2|  PREDICTED: alanine aminotransferase 2-like i...    272   6e-83    Cucumis sativus [cucumbers]
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         273   6e-83    
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    272   8e-83    Cucumis melo [Oriental melon]
ref|XP_009826737.1|  hypothetical protein H257_04062                    270   8e-83    Aphanomyces astaci
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...    272   9e-83    Camelina sativa [gold-of-pleasure]
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              272   1e-82    Sesamum indicum [beniseed]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    271   1e-82    Cicer arietinum [garbanzo]
ref|XP_005443445.1|  PREDICTED: alanine aminotransferase 2-like         268   2e-82    Falco cherrug
emb|CDH53092.1|  alanine transaminase                                   271   2e-82    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004356702.1|  alanine aminotransferase, mitochondrial, put...    269   2e-82    Acanthamoeba castellanii str. Neff
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...    271   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         271   2e-82    Sesamum indicum [beniseed]
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             271   2e-82    Citrus clementina [clementine]
gb|AIT69935.1|  alanine transaminase                                    270   3e-82    Dumontia simplex
emb|CEI89079.1|  Putative Alanine transaminase                          270   3e-82    Rhizopus microsporus
ref|XP_005230442.1|  PREDICTED: alanine aminotransferase 2-like         268   3e-82    
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             270   3e-82    
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 1, mitoc...    269   3e-82    Cucumis sativus [cucumbers]
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    270   3e-82    Citrus sinensis [apfelsine]
ref|XP_001769989.1|  predicted protein                                  269   3e-82    
emb|CEI89078.1|  Putative Alanine transaminase                          270   3e-82    Rhizopus microsporus
ref|XP_005514471.1|  PREDICTED: alanine aminotransferase 2-like         267   4e-82    
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    269   4e-82    Cucumis melo [Oriental melon]
ref|XP_002681562.1|  alanine aminotransferase                           269   4e-82    Naegleria gruberi strain NEG-M
ref|XP_007024768.1|  Alanine aminotransferase 2                         270   5e-82    
emb|CDJ93113.1|  Aminotransferase domain containing protein             269   6e-82    Haemonchus contortus [red stomach worm]
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   270   7e-82    Citrus sinensis [apfelsine]
gb|EMC77259.1|  Alanine aminotransferase 2                              267   9e-82    
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               269   9e-82    Glycine soja [wild soybean]
ref|XP_010096539.1|  Alanine aminotransferase 2                         269   1e-81    Morus notabilis
ref|NP_001086104.1|  alanine aminotransferase 2                         269   1e-81    Xenopus laevis [clawed frog]
ref|XP_002906651.1|  alanine aminotransferase 2                         268   1e-81    Phytophthora infestans T30-4
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2              268   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...    267   2e-81    
gb|AIT69936.1|  alanine transaminase                                    267   2e-81    Grateloupia livida
gb|AIT69941.1|  alanine transaminase                                    267   2e-81    Gloiopeltis furcata
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...    267   2e-81    
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              268   3e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2              268   3e-81    Nicotiana tomentosiformis
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...    267   3e-81    
ref|XP_001372290.1|  PREDICTED: alanine aminotransferase 1 isofor...    266   5e-81    
gb|KIR88856.1|  alanine transaminase                                    266   6e-81    Cryptococcus gattii VGIV IND107
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...    266   6e-81    Monodelphis domestica
ref|XP_003627448.1|  Alanine aminotransferase                           267   6e-81    Medicago truncatula
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...    267   7e-81    Elaeis guineensis
ref|XP_571848.1|  transaminase                                          266   7e-81    Cryptococcus neoformans var. neoformans JEC21
gb|KIR49354.1|  alanine transaminase                                    266   8e-81    Cryptococcus gattii CA1280
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like         267   8e-81    Nicotiana sylvestris
gb|KIR54768.1|  alanine transaminase                                    266   9e-81    Cryptococcus gattii Ru294
ref|XP_001745052.1|  hypothetical protein                               265   1e-80    Monosiga brevicollis MX1
ref|XP_012051258.1|  alanine transaminase, variant                      265   1e-80    Cryptococcus neoformans var. grubii H99
gb|AIT69940.1|  alanine transaminase                                    265   1e-80    Grateloupia catenata
gb|KIR99100.1|  alanine transaminase                                    266   1e-80    Cryptococcus gattii VGII 2001/935-1
gb|KGB76334.1|  transaminase                                            266   1e-80    
ref|XP_005775483.1|  alanine aminotransferase                           266   1e-80    
ref|XP_012051257.1|  alanine transaminase                               265   2e-80    
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             266   2e-80    
gb|ACJ85860.1|  unknown                                                 265   2e-80    
ref|XP_003195327.1|  glutamate-pyruvate transaminase/Glutamate-al...    265   2e-80    
emb|CDS05712.1|  hypothetical protein LRAMOSA08240                      265   3e-80    
gb|EIE90509.1|  hypothetical protein RO3G_15220                         263   3e-80    
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    264   3e-80    
gb|AAR05449.1|  alanine aminotransferase                                263   4e-80    
emb|CDJ93112.1|  Aminotransferase domain containing protein             261   4e-80    
gb|EMT05433.1|  Alanine aminotransferase 2                              264   4e-80    
gb|ADB91976.1|  alanine aminotransferase                                264   4e-80    
ref|XP_009557985.1|  PREDICTED: alanine aminotransferase 2-like         261   4e-80    
gb|AIT69942.1|  alanine transaminase                                    263   4e-80    
ref|XP_005852218.1|  hypothetical protein CHLNCDRAFT_29318              264   5e-80    
gb|KFO75258.1|  Alanine aminotransferase 2                              261   7e-80    
ref|XP_004362319.1|  alanine transaminase                               264   7e-80    
emb|CDO97792.1|  unnamed protein product                                263   8e-80    
ref|XP_002430266.1|  Alanine aminotransferase, putative                 263   8e-80    
ref|XP_004227217.1|  PREDICTED: alanine aminotransferase 2              263   9e-80    
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             264   1e-79    
ref|NP_001237553.1|  alanine aminotransferase 1                         262   2e-79    
ref|XP_009899311.1|  PREDICTED: alanine aminotransferase 1              260   2e-79    
gb|AIT69932.1|  alanine transaminase                                    261   2e-79    
gb|EIE79350.1|  hypothetical protein RO3G_04055                         261   2e-79    
emb|CEF68484.1|  Alanine aminotransferase 1                             262   2e-79    
gb|AFK39904.1|  unknown                                                 263   2e-79    
gb|EWM26977.1|  alanine aminotransferase                                264   3e-79    
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like         262   3e-79    
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              261   3e-79    
ref|XP_006438273.1|  hypothetical protein CICLE_v10031381mg             258   3e-79    
ref|XP_005838227.1|  hypothetical protein GUITHDRAFT_103164             261   3e-79    
gb|KFV67752.1|  Alanine aminotransferase 2                              260   3e-79    
gb|ETN63742.1|  alanine aminotransferase                                261   3e-79    
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg             263   4e-79    
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         261   5e-79    
dbj|GAN07970.1|  alanine transaminase                                   261   5e-79    
gb|AIT69922.1|  alanine transaminase                                    261   5e-79    
gb|KGB32667.1|  Alanine aminotransferase 2                              261   6e-79    
gb|AIT69937.1|  alanine transaminase                                    261   6e-79    
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...    262   8e-79    
gb|EPB83565.1|  alanine transaminase                                    260   8e-79    
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         261   9e-79    
ref|XP_010776891.1|  PREDICTED: alanine aminotransferase 2-like         257   1e-78    
ref|XP_011048627.1|  PREDICTED: alanine aminotransferase 2, mitoc...    259   2e-78    
dbj|BAK07780.1|  predicted protein                                      261   2e-78    
gb|EMT23015.1|  Alanine aminotransferase 2                              260   2e-78    
gb|EMS19811.1|  1-aminocyclopropane-1-carboxylate synthase              260   2e-78    
gb|ENN78579.1|  hypothetical protein YQE_04947                          260   2e-78    
gb|EMS46317.1|  Alanine aminotransferase 2                              260   2e-78    
gb|KFK41654.1|  hypothetical protein AALP_AA2G155600                    260   2e-78    
ref|XP_003760591.1|  PREDICTED: alanine aminotransferase 1              259   3e-78    
ref|XP_008150574.1|  PREDICTED: alanine aminotransferase 2 isofor...    258   3e-78    
ref|NP_001016805.1|  alanine aminotransferase 2                         259   3e-78    
ref|XP_007516096.1|  PREDICTED: alanine aminotransferase 1              258   4e-78    
emb|CDX81815.1|  BnaC08g37860D                                          260   5e-78    
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...    258   5e-78    
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         258   5e-78    
gb|KDN46269.1|  putative alt1-alanine aminotransferase                  259   6e-78    
gb|KFH67262.1|  alanine transaminase                                    259   7e-78    
gb|AIT69938.1|  alanine transaminase                                    259   7e-78    
gb|AIT69934.1|  alanine transaminase                                    259   7e-78    
gb|AIT69930.1|  alanine transaminase                                    258   8e-78    
dbj|BAN21041.1|  alanine aminotransferase                               258   8e-78    
ref|XP_009175684.1|  hypothetical protein T265_10908                    258   8e-78    
dbj|GAA29952.1|  alanine transaminase                                   258   8e-78    
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                     258   9e-78    
emb|CCD81366.1|  putative alanine aminotransferase                      257   9e-78    
ref|XP_002166762.2|  PREDICTED: alanine aminotransferase 2-like         256   9e-78    
ref|XP_002946490.1|  hypothetical protein VOLCADRAFT_120326             265   9e-78    
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              258   9e-78    
gb|EPB77692.1|  aminotransferase, class I/II                            258   1e-77    
ref|XP_006746371.1|  PREDICTED: alanine aminotransferase 1              251   1e-77    
ref|XP_009783410.1|  PREDICTED: alanine aminotransferase 2, mitoc...    258   1e-77    
emb|CDY26256.1|  BnaA06g11610D                                          258   1e-77    
ref|XP_005709075.1|  alanine transaminase                               258   1e-77    
ref|XP_004580835.1|  PREDICTED: alanine aminotransferase 1              257   1e-77    
ref|XP_008150573.1|  PREDICTED: alanine aminotransferase 2 isofor...    258   2e-77    
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    258   2e-77    
ref|XP_006357426.1|  PREDICTED: alanine aminotransferase 2, mitoc...    258   2e-77    
ref|XP_004400797.1|  PREDICTED: alanine aminotransferase 1              257   2e-77    
ref|XP_003055208.1|  predicted protein                                  256   2e-77    
gb|EHJ76295.1|  putative alanine aminotransferase                       256   3e-77    
gb|AAF79891.1|AC026479_3  Strong similarity to alanine aminotrans...    256   3e-77    
ref|XP_006390672.1|  hypothetical protein EUTSA_v10019459mg             258   3e-77    
emb|CDY21752.1|  BnaA09g45030D                                          258   3e-77    
gb|KHJ47772.1|  aminotransferase, class I/II                            257   3e-77    
gb|KDR12685.1|  Alanine aminotransferase 2                              258   3e-77    
ref|XP_011556474.1|  PREDICTED: alanine aminotransferase 1              257   3e-77    
ref|XP_009117710.1|  PREDICTED: alanine aminotransferase 1, mitoc...    258   3e-77    
ref|XP_011499275.1|  PREDICTED: alanine aminotransferase 2              257   3e-77    
gb|KFB49063.1|  AGAP000901-PA-like protein                              258   3e-77    
emb|CBK19835.2|  Alanine aminotransferase 2                             256   3e-77    
emb|CAD58795.1|  glutamic-pyruvate transaminase                         250   4e-77    
emb|CDX83914.1|  BnaC08g17310D                                          257   4e-77    
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...    258   4e-77    
gb|KJB57089.1|  hypothetical protein B456_009G147700                    256   5e-77    
ref|XP_002304255.2|  hypothetical protein POPTR_0003s07020g             255   5e-77    
ref|XP_001660470.1|  AAEL009872-PA                                      257   5e-77    
gb|EFN75006.1|  Alanine aminotransferase 2                              257   5e-77    
ref|XP_010628764.1|  PREDICTED: alanine aminotransferase 1              256   6e-77    
ref|XP_005608301.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   6e-77    
ref|XP_009265680.1|  hypothetical protein J056_000007                   255   6e-77    
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1              257   6e-77    
gb|KJB57091.1|  hypothetical protein B456_009G147700                    256   6e-77    
ref|XP_009110415.1|  PREDICTED: alanine aminotransferase 1, mitoc...    257   7e-77    
ref|XP_004779455.1|  PREDICTED: alanine aminotransferase 1 isofor...    255   7e-77    
gb|AIT69931.1|  alanine transaminase                                    255   7e-77    
ref|NP_001077209.1|  alanine aminotransferase 1                         255   7e-77    
ref|XP_010261672.1|  PREDICTED: alanine aminotransferase 2-like         256   8e-77    
ref|XP_009149177.1|  PREDICTED: alanine aminotransferase 1, mitoc...    256   8e-77    
emb|CDY48485.1|  BnaC05g13450D                                          256   8e-77    
ref|XP_010842208.1|  PREDICTED: alanine aminotransferase 2              253   8e-77    
gb|EGU11111.1|  putative Alanine aminotransferase                       255   9e-77    
ref|XP_006416098.1|  hypothetical protein EUTSA_v10007514mg             251   9e-77    
ref|XP_010959534.1|  PREDICTED: alanine aminotransferase 1              254   9e-77    
ref|XP_010716082.1|  PREDICTED: alanine aminotransferase 2              252   9e-77    
ref|XP_010537653.1|  PREDICTED: alanine aminotransferase 2, mitoc...    256   1e-76    
ref|XP_005062449.1|  PREDICTED: alanine aminotransferase 2-like i...    254   1e-76    
ref|XP_008654837.1|  PREDICTED: uncharacterized protein LOC100193...    254   1e-76    
gb|EMS62762.1|  Alanine aminotransferase 2                              256   1e-76    
ref|XP_004779454.1|  PREDICTED: alanine aminotransferase 1 isofor...    256   1e-76    
ref|XP_008560719.1|  PREDICTED: alanine aminotransferase 1              257   1e-76    
ref|XP_008507870.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   1e-76    
gb|AIT69921.1|  alanine transaminase                                    255   1e-76    
ref|XP_006680648.1|  hypothetical protein BATDEDRAFT_20287              254   1e-76    
emb|CDX96776.1|  BnaA08g23190D                                          256   1e-76    
ref|XP_004826063.1|  PREDICTED: alanine aminotransferase 1 isofor...    255   1e-76    
ref|XP_008584771.1|  PREDICTED: alanine aminotransferase 2              254   1e-76    
ref|XP_008380735.1|  PREDICTED: alanine aminotransferase 2              256   2e-76    
gb|KHN72520.1|  Alanine aminotransferase 2                              253   2e-76    
ref|XP_006064662.1|  PREDICTED: alanine aminotransferase 1 isofor...    254   2e-76    
ref|XP_010812871.1|  PREDICTED: alanine aminotransferase 2 isofor...    252   2e-76    
sp|P34106.1|ALA2_PANMI  RecName: Full=Alanine aminotransferase 2;...    254   2e-76    
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like         255   2e-76    
gb|AAK64147.2|  putative alanine aminotransferase                       255   2e-76    
ref|XP_005062450.1|  PREDICTED: alanine aminotransferase 2-like i...    253   2e-76    
ref|XP_004944250.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   2e-76    
ref|XP_009627254.1|  PREDICTED: alanine aminotransferase 2-like         255   2e-76    
ref|NP_173173.3|  alanine aminotransferase                              255   2e-76    
ref|XP_004583880.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   2e-76    
ref|XP_004697404.1|  PREDICTED: alanine aminotransferase 1              254   2e-76    
ref|XP_005608300.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   2e-76    
gb|AIT69944.1|  alanine transaminase                                    254   2e-76    
gb|EMT08497.1|  Alanine aminotransferase 2                              252   2e-76    
ref|XP_009079156.1|  PREDICTED: alanine aminotransferase 2              249   2e-76    
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like         256   2e-76    
ref|XP_005401471.1|  PREDICTED: alanine aminotransferase 2-like i...    252   2e-76    
ref|XP_004265286.1|  PREDICTED: alanine aminotransferase 1              254   3e-76    
ref|XP_008246599.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    254   3e-76    
emb|CEG68597.1|  Putative Alanine transaminase                          253   3e-76    
ref|XP_004983099.1|  PREDICTED: alanine aminotransferase 2-like         253   3e-76    
ref|XP_010029516.1|  PREDICTED: alanine aminotransferase 2-like         255   3e-76    
ref|XP_009059448.1|  hypothetical protein LOTGIDRAFT_192553             253   3e-76    
ref|XP_001660471.1|  AAEL009875-PA                                      251   3e-76    
ref|XP_002890217.1|  alanine aminotransferase                           255   3e-76    
gb|AAF82782.1|AF275372_1  alanine aminotransferase                      255   3e-76    
gb|AIT69939.1|  alanine transaminase                                    254   3e-76    
gb|AIT69918.1|  alanine transaminase                                    254   3e-76    
ref|XP_010285870.1|  PREDICTED: alanine aminotransferase 2              251   3e-76    
ref|XP_008700888.1|  PREDICTED: alanine aminotransferase 2              253   3e-76    
ref|XP_010884988.1|  PREDICTED: alanine aminotransferase 2-like i...    253   3e-76    
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              254   3e-76    
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   3e-76    
ref|XP_004472119.1|  PREDICTED: alanine aminotransferase 1              253   3e-76    
ref|XP_005401470.1|  PREDICTED: alanine aminotransferase 2-like i...    252   4e-76    
gb|KFQ69505.1|  Alanine aminotransferase 2                              252   4e-76    
ref|XP_011235435.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    253   4e-76    
ref|XP_004324928.1|  PREDICTED: alanine aminotransferase 2              251   4e-76    
ref|XP_005401469.1|  PREDICTED: alanine aminotransferase 2-like i...    252   4e-76    
emb|CEG68596.1|  Putative Alanine transaminase                          254   4e-76    
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              255   5e-76    
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    254   5e-76    
ref|XP_006729760.1|  PREDICTED: alanine aminotransferase 2 isofor...    254   5e-76    
gb|KFD51767.1|  hypothetical protein M513_07294                         257   5e-76    
ref|XP_008053205.1|  PREDICTED: alanine aminotransferase 2              252   6e-76    
ref|XP_006034404.1|  PREDICTED: alanine aminotransferase 2              251   6e-76    
gb|KFV00293.1|  Alanine aminotransferase 2                              248   6e-76    
ref|XP_009700544.1|  PREDICTED: alanine aminotransferase 2              251   6e-76    
gb|AIT69919.1|  alanine transaminase                                    253   6e-76    
ref|XP_005692006.1|  PREDICTED: alanine aminotransferase 2              251   6e-76    
ref|XP_001660472.1|  AAEL009875-PB                                      252   6e-76    
ref|XP_010078751.1|  PREDICTED: alanine aminotransferase 2              248   7e-76    
ref|XP_006530622.1|  PREDICTED: alanine aminotransferase 2 isofor...    246   7e-76    
ref|XP_011226824.1|  PREDICTED: alanine aminotransferase 1 isofor...    255   7e-76    
ref|XP_009939421.1|  PREDICTED: alanine aminotransferase 2              251   7e-76    
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2              254   7e-76    
gb|KFR15864.1|  Alanine aminotransferase 2                              251   7e-76    
gb|AAC62456.1|  alanine aminotransferase                                252   7e-76    
ref|XP_010166043.1|  PREDICTED: alanine aminotransferase 2              251   8e-76    
ref|XP_001919896.1|  PREDICTED: alanine aminotransferase 1              253   8e-76    
ref|XP_010884980.1|  PREDICTED: alanine aminotransferase 2-like i...    254   8e-76    
gb|KFP59082.1|  Alanine aminotransferase 2                              251   8e-76    
ref|XP_006191406.1|  PREDICTED: alanine aminotransferase 2              252   8e-76    
ref|XP_010140032.1|  PREDICTED: alanine aminotransferase 2              250   9e-76    
ref|XP_005608298.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   9e-76    
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    252   9e-76    
ref|XP_005215289.1|  PREDICTED: alanine aminotransferase 1 isofor...    253   9e-76    
gb|KFZ58051.1|  Alanine aminotransferase 2                              251   9e-76    
ref|XP_006530621.1|  PREDICTED: alanine aminotransferase 2 isofor...    249   1e-75    
ref|XP_010394851.1|  PREDICTED: alanine aminotransferase 2              250   1e-75    
ref|XP_005426315.1|  PREDICTED: alanine aminotransferase 2              250   1e-75    
gb|AIT69916.1|  alanine transaminase                                    253   1e-75    
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1              252   1e-75    
ref|XP_004403733.1|  PREDICTED: alanine aminotransferase 2              253   1e-75    
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              252   1e-75    
ref|XP_010498073.1|  PREDICTED: alanine aminotransferase 1, mitoc...    254   1e-75    
gb|KFZ65228.1|  Alanine aminotransferase 2                              250   1e-75    
ref|XP_010151513.1|  PREDICTED: alanine aminotransferase 2              250   1e-75    
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    253   1e-75    
ref|XP_005490144.1|  PREDICTED: alanine aminotransferase 2              250   1e-75    
ref|XP_010113991.1|  PREDICTED: alanine aminotransferase 2              250   1e-75    
ref|XP_006887880.1|  PREDICTED: alanine aminotransferase 2              253   1e-75    
gb|KFO93213.1|  Alanine aminotransferase 2                              251   1e-75    
ref|XP_004618719.1|  PREDICTED: alanine aminotransferase 1              252   1e-75    
ref|XP_414111.3|  PREDICTED: alanine aminotransferase 2 isoform X2      253   1e-75    
ref|XP_003792568.1|  PREDICTED: alanine aminotransferase 2              253   1e-75    
ref|XP_003978704.1|  PREDICTED: alanine aminotransferase 2              254   1e-75    
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1              252   1e-75    
ref|XP_007439806.1|  PREDICTED: alanine aminotransferase 2              250   1e-75    



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   509 bits (1312),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 239/260 (92%), Positives = 254/260 (98%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS ANLK+I+QFC++E+LVLLGDEVYQQNIYQDERPF+S+RKVLLDMGPPISKEL
Sbjct  222  PTGQCLSVANLKQIIQFCHQESLVLLGDEVYQQNIYQDERPFISARKVLLDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVPGQIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  IEAAKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   508 bits (1309),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 238/260 (92%), Positives = 254/260 (98%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS ANLK+I+QFC++E+LVLLGDEVYQQNIYQDERPF+S+RKVLLDMGPPISKEL
Sbjct  222  PTGQCLSVANLKQIIQFCHQESLVLLGDEVYQQNIYQDERPFISARKVLLDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVPGQIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  IEAAKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>ref|XP_011655611.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
sativus]
 gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   507 bits (1306),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 234/260 (90%), Positives = 252/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FC++ENLVLLGDEVYQQN+YQDERPF+SSRKVLLDMGPPISKEL
Sbjct  222  PTGQCLSEANLREILNFCFQENLVLLGDEVYQQNVYQDERPFISSRKVLLDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SF
Sbjct  402  IDAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM++YEDHRGYSRM
Sbjct  462  KKFNDSFMEEYEDHRGYSRM  481



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   505 bits (1300),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 235/260 (90%), Positives = 253/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY+ENLVLLGDEVYQQNIYQDERPF+SSRKVLLDMGPPISKE+
Sbjct  222  PTGQCLSEANLREILKFCYQENLVLLGDEVYQQNIYQDERPFISSRKVLLDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP +V+EIYKV+SISLSPNVP QIFLGLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPETVDEIYKVSSISLSPNVPAQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGDISY+Q+VRESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PRPGDISYEQYVRESKGILESLRRRASIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESF
Sbjct  402  IEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGMFHLRTTILPAEEDMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   504 bits (1299),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 236/260 (91%), Positives = 254/260 (98%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS ANLK+I+QFC++ENLVLLGDEVYQQNIYQDERPF+S+RKVLLDMG P+SKE+
Sbjct  222  PTGQCLSVANLKQIIQFCHQENLVLLGDEVYQQNIYQDERPFISARKVLLDMGLPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASISLSPNVPGQIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IETA  LGKAPDV YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF
Sbjct  402  IETANKLGKAPDVLYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM++YEDH+GYSRM
Sbjct  462  KKFNDEFMEKYEDHKGYSRM  481



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   504 bits (1299),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 236/260 (91%), Positives = 252/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL FCY+ENLVLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKEL
Sbjct  222  PTGQCLSEANLKEILHFCYQENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P PGDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PTPGDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF
Sbjct  402  IEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>ref|XP_012085470.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Jatropha 
curcas]
 ref|XP_012085471.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Jatropha 
curcas]
 gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   504 bits (1298),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 234/260 (90%), Positives = 252/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY+ENL LLGDEVYQQNIYQDERPF+S+RKVLLDMGPPISKE+
Sbjct  222  PTGQCLSEANLREILRFCYQENLALLGDEVYQQNIYQDERPFISARKVLLDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRE KGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYDQFVREGKGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SF
Sbjct  402  IEAAKRLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDH GYSRM
Sbjct  462  KKFNDEFMEQYEDHTGYSRM  481



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   504 bits (1297),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 236/260 (91%), Positives = 252/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL FCY+ENLVLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKEL
Sbjct  222  PTGQCLSEANLKEILHFCYQENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P PGDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PTPGDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIMESF
Sbjct  402  IEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   503 bits (1296),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 235/260 (90%), Positives = 254/260 (98%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS ANLK+I+QFC++ENLVLLGDEVYQQNIYQDERPF+S+RKVLLDMG P+SKE+
Sbjct  222  PTGQCLSVANLKQIIQFCHQENLVLLGDEVYQQNIYQDERPFISARKVLLDMGLPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASISLSPNVPGQIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQ+VRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYDQYVRESKGILESLRRRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IETA  LGKA DV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF
Sbjct  402  IETANKLGKAADVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM++YEDH+GYSRM
Sbjct  462  KKFNDEFMEKYEDHKGYSRM  481



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   503 bits (1296),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 232/260 (89%), Positives = 253/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLK++++FCY+ENLVLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPI+KEL
Sbjct  222  PTGQCLSEANLKDVIKFCYQENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPINKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASI+LSPNVPGQIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASIALSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+++VRESK +LESLRKRA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYERYVRESKAVLESLRKRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  IEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDH+GYSRM
Sbjct  462  KKFNDEFMEQYEDHKGYSRM  481



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   501 bits (1291),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 235/260 (90%), Positives = 251/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL FCY+ENLVLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKEL
Sbjct  222  PTGQCLSEANLKEILHFCYQENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P PGDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PTPGDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE MPAIMESF
Sbjct  402  IEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEXMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   499 bits (1285),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 230/260 (88%), Positives = 252/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL+FCY+ N+VLLGDEVYQQNIYQDERPF+S+RKVL+DMG PI+KEL
Sbjct  221  PTGQCLSEANLKEILRFCYQNNVVLLGDEVYQQNIYQDERPFISARKVLMDMGAPINKEL  280

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASI+LSPNVP QIF+GLMVNP
Sbjct  281  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKAVEEIYKVASIALSPNVPAQIFMGLMVNP  340

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY++F+RESKGILESLR+RA++MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  341  PKPGDISYERFIRESKGILESLRRRAQLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  400

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SF
Sbjct  401  IEAAQKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSF  460

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDH+GYSRM
Sbjct  461  KKFNDEFMEQYEDHKGYSRM  480



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   499 bits (1284),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 233/260 (90%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY E+LVLLGDEVYQQNIYQDERPF+SSRKVL+ MG PISKE+
Sbjct  222  PTGQCLSEANLREILNFCYHESLVLLGDEVYQQNIYQDERPFISSRKVLMGMGLPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SF
Sbjct  402  IEAAQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFMDQYED RGYSRM
Sbjct  462  KKFNDEFMDQYEDQRGYSRM  481



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   499 bits (1284),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 231/260 (89%), Positives = 253/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY+ENLVLLGDEVYQQNIYQDERPF+SS+KVL+DMGPP SKE+
Sbjct  222  PTGQCLSEANLREILRFCYQENLVLLGDEVYQQNIYQDERPFVSSKKVLMDMGPPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  LKPGDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF
Sbjct  402  IEAAKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+RGYSRM
Sbjct  462  KKFNDEFMEQYEDYRGYSRM  481



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   497 bits (1280),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 231/260 (89%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCYRE+LVLLGDEVYQQNIYQDERPF+S+RKVL+ MG P+SKE+
Sbjct  222  PTGQCLSEANLREILNFCYRESLVLLGDEVYQQNIYQDERPFISARKVLMGMGLPVSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKV SI+LSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVVSIALSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+QF+RESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYEQFIRESKGILESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SF
Sbjct  402  IEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFMDQYED RGYSRM
Sbjct  462  KKFNDEFMDQYEDRRGYSRM  481



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   497 bits (1279),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 232/260 (89%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY E+LVLLGDEVYQQNIYQDERPF+SSRKVL+ MG PISKE+
Sbjct  222  PTGQCLSEANLREILNFCYHESLVLLGDEVYQQNIYQDERPFISSRKVLMGMGLPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SF
Sbjct  402  IEAAQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFN+EFMDQYED RGYSRM
Sbjct  462  KKFNNEFMDQYEDQRGYSRM  481



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   495 bits (1275),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 229/260 (88%), Positives = 252/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY+ENLVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  204  PTGQCLSEANLREILRFCYQENLVLLGDEVYQQNIYQDERPFVSSKKVLMDMGLPFSKEV  263

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP
Sbjct  264  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNP  323

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  324  LKPGDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  383

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESF
Sbjct  384  IEAAKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESF  443

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+RGYSRM
Sbjct  444  KKFNDEFMEQYEDYRGYSRM  463



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   495 bits (1275),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 232/260 (89%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FC+ E LVLLGDEVYQQNIYQDERPF+S+RKVL+ MG PISKE+
Sbjct  222  PTGQCLSEANLREILNFCFHEGLVLLGDEVYQQNIYQDERPFISARKVLMGMGLPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASIALSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+QFVRESKGILESLRKRARIMTDGFN+CRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYEQFVRESKGILESLRKRARIMTDGFNNCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SF
Sbjct  402  IEAAKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   494 bits (1273),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 230/260 (88%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+L+FCY+ NLVLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKE 
Sbjct  219  PTGQCLSEANLREVLKFCYQNNLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKEC  278

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASISLSPNVP QIF+GLMVNP
Sbjct  279  QLVSFHTVSKGYWGECGQRGGYFEMTNISPKTVEEIYKVASISLSPNVPAQIFMGLMVNP  338

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGDISY+++VRESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  339  LKPGDISYERYVRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  398

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  399  IEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASF  458

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  459  KKFNDEFMEQYEDHRGYSRM  478



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   494 bits (1271),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 230/260 (88%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FC+ E LVLLGDEVYQQNIYQDERPF+S+RKVL+ MG PISKE+
Sbjct  222  PTGQCLSEANLREILNFCFHEGLVLLGDEVYQQNIYQDERPFISARKVLMGMGLPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASIALSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+QFVRESKGILESLR+RARIMTDGFN+CRN+VCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYEQFVRESKGILESLRRRARIMTDGFNNCRNIVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SF
Sbjct  402  IEAAKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   492 bits (1267),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 231/256 (90%), Positives = 246/256 (96%), Gaps = 0/256 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL FC +ENLVLLGDEVYQQNIYQDERPF+S+RK L+DMGPPISKEL
Sbjct  222  PTGQCLSEANLKEILHFCNQENLVLLGDEVYQQNIYQDERPFISARKALMDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P PGDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PTPGDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF
Sbjct  402  IEAAKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  461

Query  260  KKFNDEFMDQYEDHRG  213
            KKFNDEFM+QYEDHRG
Sbjct  462  KKFNDEFMEQYEDHRG  477



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   492 bits (1267),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 250/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY+ENLVLLGDEVYQQNIYQDERPF+S+RKVL+ MGPP+SKE+
Sbjct  222  PTGQCLSEANLREILHFCYQENLVLLGDEVYQQNIYQDERPFISARKVLMGMGPPVSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPKAVDEIYKVASVSLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+QF+RESKGILESLR+RAR+MTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYEQFIRESKGILESLRRRARMMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SF
Sbjct  402  IDAAKMAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYE H GYSR+
Sbjct  462  KKFNDEFMEQYEGHGGYSRL  481



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   492 bits (1266),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 227/260 (87%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEI+ FCY+E LVLLGDEVYQQNIYQDERPF+S++KVLL+MGPPIS+EL
Sbjct  222  PTGQCLSEANLKEIIYFCYQEKLVLLGDEVYQQNIYQDERPFISAKKVLLNMGPPISREL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QI +G+MV+P
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQILMGMMVDP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYD +VRESKGI+ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYDLYVRESKGIIESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   491 bits (1264),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 227/260 (87%), Positives = 247/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL FC++ENLVLL DEVYQQNIYQDERPF+S++KVL+D+G P+S+E+
Sbjct  222  PTGQCLSEANLKEILHFCFQENLVLLADEVYQQNIYQDERPFISAKKVLMDLGAPLSREV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIFLGLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +FV ESK IL+SLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYLKFVTESKAILDSLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  IEAAKNAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYEDHRGYSRM
Sbjct  462  KKFNDEFMEQYEDHRGYSRM  481



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   489 bits (1260),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 228/260 (88%), Positives = 247/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY+ENLVLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISKE+
Sbjct  222  PTGQCLSEANLREILNFCYQENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGD+SYDQ+VRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI LPP+A
Sbjct  342  LKPGDVSYDQYVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIHLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SF
Sbjct  402  IEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QYED+  +SRM
Sbjct  462  KKFNDEFMAQYEDNWNHSRM  481



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   489 bits (1260),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 252/260 (97%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE NL+E+LQFCY ENLVLLGDEVYQ NIYQDERPF+S++KVL+D+GPP+SKE+
Sbjct  222  PTGQCLSEENLREVLQFCYEENLVLLGDEVYQTNIYQDERPFISAKKVLMDIGPPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLM+NP
Sbjct  282  QLVSFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMINP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +ETA+  GKA DVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SF
Sbjct  402  LETAKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND+FM+QY+DHRGYSR+
Sbjct  462  KKFNDDFMEQYDDHRGYSRL  481



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   489 bits (1259),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 228/260 (88%), Positives = 247/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY+ENLVLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISK++
Sbjct  222  PTGQCLSEANLREILNFCYQENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKDV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+A
Sbjct  342  LKPGDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SF
Sbjct  402  IEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QYED+   SRM
Sbjct  462  KKFNDEFMAQYEDNWNRSRM  481



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   489 bits (1258),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 228/260 (88%), Positives = 247/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY+ENLVLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISK++
Sbjct  236  PTGQCLSEANLREILNFCYQENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKDV  295

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP
Sbjct  296  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNP  355

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+A
Sbjct  356  LKPGDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKA  415

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SF
Sbjct  416  IEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSF  475

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QYED+   SRM
Sbjct  476  KKFNDEFMAQYEDNWNRSRM  495



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   487 bits (1254),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 248/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EI+ FC +ENLVLLGDEVYQQN+YQDERPF+S+RKVL+ MGP ISKEL
Sbjct  222  PTGQCLSEANLREIINFCIQENLVLLGDEVYQQNVYQDERPFISARKVLMGMGPFISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFH+VSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS++LSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHSVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKVASVALSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYDQFARESKEILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQK+GVFHLRTTILPAEEDMPAIM+SF
Sbjct  402  IQAAKSAGKVPDVFYCLKLLEATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFN+EFM+QYED RGYSRM
Sbjct  462  KKFNNEFMEQYEDDRGYSRM  481



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   487 bits (1254),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+LQFCY+ENL LLGDEVYQ NIYQDERPF+SSRKVL+++GPPISKE+
Sbjct  222  PTGQCLSEANLREVLQFCYQENLALLGDEVYQTNIYQDERPFISSRKVLMELGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M+NP
Sbjct  282  QLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGDISYD+FVRES GILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PQPGDISYDKFVRESTGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SF
Sbjct  402  LEAAKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED RGYSR+
Sbjct  462  KKFNDEFMEQYEDDRGYSRL  481



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   486 bits (1252),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EILQFCY+ENL LLGDEVYQQNIYQDERPF+SS+KVL+D+GPPISKE+
Sbjct  222  PTGQCLSEANLREILQFCYQENLALLGDEVYQQNIYQDERPFISSKKVLMDLGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M+NP
Sbjct  282  QLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMINP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGDISYDQFVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  LKPGDISYDQFVRESNGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SF
Sbjct  402  IEAAKQAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            K FNDEFM+QYED+RGYSR+
Sbjct  462  KNFNDEFMEQYEDNRGYSRL  481



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   486 bits (1251),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 248/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVL+GDEVYQQNIYQDERPF+SS+KVL+DMGPP+S+E+
Sbjct  222  PTGQCLSEANLREILKFCYEEKLVLMGDEVYQQNIYQDERPFISSKKVLMDMGPPVSREV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNVP QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVPAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P PGDISY+QF+RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP RA
Sbjct  342  PNPGDISYEQFIRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPARA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IEAARQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QYED+ GYSRM
Sbjct  462  KKFNDEFMSQYEDNFGYSRM  481



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   486 bits (1250),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+LQFCY+ENL LLGDEVYQ NIYQDERPF+SSRKVL+D+GPPISKE+
Sbjct  222  PTGQCLSEANLREVLQFCYQENLALLGDEVYQTNIYQDERPFISSRKVLMDLGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++P
Sbjct  282  QLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SF
Sbjct  402  LEAAKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED RGYSR+
Sbjct  462  KKFNDEFMEQYEDDRGYSRL  481



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   485 bits (1249),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 227/260 (87%), Positives = 247/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKE+L+FCY  NLVLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKE+
Sbjct  222  PTGQCLSEANLKEVLKFCYENNLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNI P++VEEIYKVASISLSPNVPGQIF+GLMV+P
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNISPQTVEEIYKVASISLSPNVPGQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+++VRESKGILESLR+RARIMTDGFN CRNVVCNFTEGAMYSFPQIRLP + 
Sbjct  342  PKPGDISYERYVRESKGILESLRRRARIMTDGFNCCRNVVCNFTEGAMYSFPQIRLPLKV  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  MEAAKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+ GYSRM
Sbjct  462  KKFNDEFMEQYEDNGGYSRM  481



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   485 bits (1249),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 250/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+LQFCY ENLVLLGDEVYQ NIYQDERPF+SS+KVL+D+GPP+SKE+
Sbjct  222  PTGQCLSEANLREVLQFCYEENLVLLGDEVYQTNIYQDERPFISSKKVLMDIGPPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFH+VSKGY+GECGQRGGYFEM NI P +V+EIYKVASISLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHSVSKGYYGECGQRGGYFEMVNISPETVDEIYKVASISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A
Sbjct  342  PKPGDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +ETA+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SF
Sbjct  402  LETAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND+FM+QYEDHRGYSR+
Sbjct  462  KKFNDDFMEQYEDHRGYSRL  481



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   484 bits (1247),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 223/260 (86%), Positives = 248/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+L+FC+REN+VLL DEVYQQNIYQDERPF+S+RK+LLDMGPPIS E+
Sbjct  222  PTGQCLSEANLRELLKFCFRENIVLLADEVYQQNIYQDERPFISARKILLDMGPPISTEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+P ++V+EIYKVAS+SLSPNVPGQIFLGLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPAKTVDEIYKVASVSLSPNVPGQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYLRFAAESNAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKAPDV+YCLKL+EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SF
Sbjct  402  IEAAKRAGKAPDVFYCLKLVEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+RGYSRM
Sbjct  462  KKFNDEFMEQYEDYRGYSRM  481



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   484 bits (1246),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 246/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL  +L+FC++ENLVLL DEVYQQNIYQDERPF+S+RK+LLDMGPP+SKE+
Sbjct  222  PTGQCLSEANLNGLLKFCFQENLVLLADEVYQQNIYQDERPFISARKILLDMGPPMSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIP ++V+EIYKVAS+SLSPNVPGQIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPAKTVDEIYKVASVSLSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGDISY +FV ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  LKPGDISYLRFVAESTAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  IEAAKSAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+RGYSRM
Sbjct  462  KKFNDEFMEQYEDYRGYSRM  481



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   484 bits (1245),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 250/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+LQFCY+ENL LLGDEVYQ NIYQDERPF+SSRKVL+D+GPPISKE+
Sbjct  222  PTGQCLSEANLREVLQFCYQENLALLGDEVYQTNIYQDERPFISSRKVLMDLGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++P
Sbjct  282  QLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GK PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SF
Sbjct  402  LEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+RGYSR+
Sbjct  462  KKFNDEFMEQYEDNRGYSRL  481



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   483 bits (1243),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E+L+FC++ENLVLL DEVYQQNIYQDERPF+S+RK+L DMGPPISKE+
Sbjct  222  PTGQCLSEANIRELLKFCFQENLVLLADEVYQQNIYQDERPFISARKILFDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVAS+SLSPNVPGQIFLGLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPQTVDEIYKVASVSLSPNVPGQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDIS+ +FV ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A
Sbjct  342  PKPGDISHLKFVVESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SF
Sbjct  402  IEAAKKVGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED RGYSRM
Sbjct  462  KKFNDEFMEQYEDCRGYSRM  481



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   482 bits (1241),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 248/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY+ENL LLGDEVYQQNIYQDERPF+SSRKVL+ MGPPISKE+
Sbjct  222  PTGQCLSEANLREILRFCYQENLALLGDEVYQQNIYQDERPFISSRKVLMGMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPG+ISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+A
Sbjct  342  LKPGNISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SF
Sbjct  402  IEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFN+EFM+QY+D  GYSR+
Sbjct  462  KKFNNEFMEQYDDRSGYSRL  481



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   482 bits (1240),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+LQFCY+ENL LLGDEVYQ NIYQDERPF+SSRKVL+D+GPPISKE+
Sbjct  221  PTGQCLSEANLREVLQFCYQENLALLGDEVYQTNIYQDERPFISSRKVLMDLGPPISKEV  280

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++P
Sbjct  281  QLISFHSVSKGYYGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHP  340

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  341  PQPGDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  400

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+   K PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SF
Sbjct  401  LEAAKQAAKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSF  460

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+RGYSR+
Sbjct  461  KKFNDEFMEQYEDNRGYSRL  480



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   482 bits (1240),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 223/260 (86%), Positives = 247/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY+ENLVLLGDEVYQQNIYQDE PF+S+RKVL+DMGPPISKE+
Sbjct  222  PTGQCLSEANLREILNFCYQENLVLLGDEVYQQNIYQDEHPFISARKVLMDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK++SISLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKISSISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGDISY+Q+VRESKGIL+SLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  LKPGDISYEQYVRESKGILDSLRRRAWIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SF
Sbjct  402  VEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYED+  +SRM
Sbjct  462  KKFNDEFMEQYEDNWSHSRM  481



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   482 bits (1240),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 223/260 (86%), Positives = 249/260 (96%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E+L+FC++ENLVLL DEVYQQNIYQDERPF+S+RK+L DMGPP+SKE+
Sbjct  222  PTGQCLSEANIRELLEFCFQENLVLLADEVYQQNIYQDERPFVSARKILFDMGPPMSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+P ++V+EIYKVASISLSPNVPGQIFLGLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPSQTVDEIYKVASISLSPNVPGQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +FV+ESK +LESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISYLKFVQESKAVLESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  IEAARKAGKAPDVFYCLGLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            +KFNDEFM+QYE+ RGYSRM
Sbjct  462  RKFNDEFMEQYENCRGYSRM  481



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   482 bits (1240),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 248/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY+ENL LLGDEVYQQNIYQDERPF+S+RKVL+ MGPP+SKE+
Sbjct  222  PTGQCLSEANLREILRFCYQENLALLGDEVYQQNIYQDERPFISARKVLMGMGPPMSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGDISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+A
Sbjct  342  LKPGDISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SF
Sbjct  402  IEAAKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFN+EFM+QY+D  GYSR+
Sbjct  462  KKFNNEFMEQYDDRSGYSRL  481



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 246/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+
Sbjct  222  PTGQCLSEANLREILKFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D+ GYSRM
Sbjct  462  KKFNDEFMSQYGDNFGYSRM  481



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   481 bits (1238),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 246/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+
Sbjct  222  PTGQCLSEANLREILKFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D+ GYSRM
Sbjct  462  KKFNDEFMSQYGDNFGYSRM  481



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   482 bits (1240),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 246/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+
Sbjct  250  PTGQCLSEANLREILKFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEV  309

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  310  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  369

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  370  PKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  429

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESF
Sbjct  430  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESF  489

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D+ GYSRM
Sbjct  490  KKFNDEFMSQYGDNFGYSRM  509



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/260 (87%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS  +L+E+L+FC RE LVLL DEVYQQN+YQDERPF+SSRKVL+DMG PISK++
Sbjct  221  PTGQCLSIEDLQELLRFCSREKLVLLADEVYQQNVYQDERPFISSRKVLMDMGTPISKDV  280

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIP  SV+EIYKVASISLSPNVPGQIFLGLMVNP
Sbjct  281  QLVSFHTVSKGYWGECGQRGGYFEMTNIPAESVDEIYKVASISLSPNVPGQIFLGLMVNP  340

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +FV+ESK ILESLRKRA IMT+GFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  341  PKPGDISYQKFVQESKTILESLRKRAHIMTNGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  400

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SF
Sbjct  401  IEVAKMAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSF  460

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM+QYED RGYSRM
Sbjct  461  KKFNDAFMEQYEDQRGYSRM  480



>ref|XP_011655610.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   479 bits (1233),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 223/251 (89%), Positives = 240/251 (96%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FC++ENLVLLGDEVYQQN+YQDERPF+SSRKVLLDMGPPIS EL
Sbjct  222  PTGQCLSEANLREILNFCFQENLVLLGDEVYQQNVYQDERPFISSRKVLLDMGPPISNEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRA
Sbjct  342  PKPGDISYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SF
Sbjct  402  IEAAKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSF  461

Query  260  KKFNDEFMDQY  228
            KKFND FM++Y
Sbjct  462  KKFNDAFMEEY  472



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 247/260 (95%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E+L+FC++ENLVLL DEVYQQNIYQDERPF+S+RK+L DMGPPISKE+
Sbjct  222  PTGQCLSEANIRELLKFCFQENLVLLADEVYQQNIYQDERPFVSARKILFDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+P ++V+EIYKVAS+SLSPNVPGQIFLGLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPSQTVDEIYKVASVSLSPNVPGQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GDISY + V+ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP +A
Sbjct  342  PKAGDISYLKLVQESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPLKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKAPDV+YCLKLLEATGI+TVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  IEAARKAGKAPDVFYCLKLLEATGIATVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            +KFNDEFM+QYED+RGYSRM
Sbjct  462  RKFNDEFMEQYEDYRGYSRM  481



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   479 bits (1233),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/260 (87%), Positives = 245/260 (94%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEI+ FC +E LVLL DEVYQQNIYQDERPF+S+RKVL++MG P+SKEL
Sbjct  222  PTGQCLSEANLKEIVNFCIQEKLVLLADEVYQQNIYQDERPFISARKVLMNMGLPMSKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIP  SV+EIYK+ASI+LSPNVPGQIFLGLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPQESVDEIYKIASIALSPNVPGQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY ++ +ESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A
Sbjct  342  PKPGDISYLRYEQESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFH+RTTILPAEEDMPAIM+SF
Sbjct  402  IEDAKKAGKHPDVFYCLKLLEATGISTVPGSGFGQKEGVFHMRTTILPAEEDMPAIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM+QYEDHRGYSRM
Sbjct  462  KKFNDAFMEQYEDHRGYSRM  481



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   479 bits (1232),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 245/260 (94%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANLREILRFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D  GYSRM
Sbjct  462  KKFNDEFMSQYGDSFGYSRM  481



>dbj|BAJ90574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   471 bits (1211),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E+L FCY+E LVLL DEVYQQN+YQDERPF+S+RKV+ DMGPP+S+E+
Sbjct  39   PTGQCLSEANIRELLNFCYQEKLVLLADEVYQQNVYQDERPFISARKVMFDMGPPVSREV  98

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNP
Sbjct  99   QLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNP  158

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA
Sbjct  159  PKPGDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRA  218

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  219  MDVAKSAGKEPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSF  278

Query  260  KKFNDEFMDQYEDH  219
            KKFND FMDQY+DH
Sbjct  279  KKFNDSFMDQYQDH  292



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   474 bits (1221),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 241/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  144  PTGQCLSEANLREILRFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEV  203

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMVNP
Sbjct  204  QLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVNP  263

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A
Sbjct  264  PKPGDISYDQFTRESKGILESLRRRANIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGA  323

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLE TGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  324  LQAAKQAGKVPDVFYCLKLLETTGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  383

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYSRM
Sbjct  384  KKFNDEFMTQYDNNFGYSRM  403



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   477 bits (1228),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +
Sbjct  219  PTGQCLSEANLKEILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGV  278

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  279  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  338

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A
Sbjct  339  PKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGA  398

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  399  LQAAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  458

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QYE+  GYSRM
Sbjct  459  KKFNDEFMAQYENGFGYSRM  478



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   474 bits (1219),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 223/260 (86%), Positives = 241/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +
Sbjct  144  PTGQCLSEANLKEILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGV  203

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  204  QLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  263

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A
Sbjct  264  PKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGA  323

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  324  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  383

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QYE+  GYSRM
Sbjct  384  KKFNDEFMAQYENGFGYSRM  403



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 245/260 (94%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANIREILRFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D+ GYSRM
Sbjct  462  KKFNDEFMSQYADNFGYSRM  481



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   476 bits (1225),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 225/252 (89%), Positives = 240/252 (95%), Gaps = 0/252 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN+K+ILQFCY+ENLVLLGDEVYQQNIYQDE PF+S+RKVL+DM PPISKEL
Sbjct  222  PTGQCLSEANVKQILQFCYQENLVLLGDEVYQQNIYQDEHPFISARKVLMDMDPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGLM NP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLMANP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RA IMT GFNSCRNV+CNFTEGAMYSFPQI+LP  A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRAHIMTGGFNSCRNVLCNFTEGAMYSFPQIQLPRGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ LGKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SF
Sbjct  402  IDAAKKLGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASF  461

Query  260  KKFNDEFMDQYE  225
            KKFND+FM QYE
Sbjct  462  KKFNDDFMKQYE  473



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   476 bits (1225),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 245/260 (94%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANIREILRFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D+ GYSRM
Sbjct  462  KKFNDEFMSQYADNFGYSRM  481



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   475 bits (1223),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 245/260 (94%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+S++KVL+DMG P+SKE+
Sbjct  219  PTGQCLSEANLREILRFCYNEKLVLLGDEVYQQNIYQDERPFISAKKVLMDMGLPLSKEV  278

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  279  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  338

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A
Sbjct  339  PKPGDISYDQFSRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGA  398

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  399  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  458

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYSRM
Sbjct  459  KKFNDEFMTQYDNNFGYSRM  478



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 245/260 (94%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANIREILRFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEI+KVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIHKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D+ GYSRM
Sbjct  462  KKFNDEFMSQYADNFGYSRM  481



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +
Sbjct  222  PTGQCLSEANLREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYSRM
Sbjct  462  KKFNDEFMTQYDNNVGYSRM  481



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 241/252 (96%), Gaps = 0/252 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL+EAN+K+ILQFC++ENLVLLGDEVYQQNIYQDE PF+S+RKVL+DMGPPI+KEL
Sbjct  222  PTGQCLTEANVKQILQFCHQENLVLLGDEVYQQNIYQDEHPFISARKVLMDMGPPITKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGLM NP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLMANP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQI+LP   
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRAHLMTDGFNSCRNVVCNFTEGAMYSFPQIQLPRGV  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ LGK PDV+YC+KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SF
Sbjct  402  IDAAKKLGKTPDVFYCIKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASF  461

Query  260  KKFNDEFMDQYE  225
            KKFND+FM+QYE
Sbjct  462  KKFNDDFMEQYE  473



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 242/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  222  PTGQCLSEANLREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A
Sbjct  342  PKPGDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY++  GYSRM
Sbjct  462  KKFNDEFMTQYDNTVGYSRM  481



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   474 bits (1220),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/260 (86%), Positives = 242/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +
Sbjct  219  PTGQCLSEANLKEILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGV  278

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  279  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  338

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A
Sbjct  339  PKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGA  398

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  399  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  458

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY++  GYSRM
Sbjct  459  KKFNDEFMAQYDNGFGYSRM  478



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   474 bits (1220),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 244/260 (94%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+
Sbjct  222  PTGQCLSEANLREILKFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GDISYDQFVRES+GILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKSGDISYDQFVRESEGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFN EFM QY D+ GYSRM
Sbjct  462  KKFNHEFMSQYGDNFGYSRM  481



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E+L FCY+ENLVLL DEVYQQN+YQDERPF+S+RKV+ DMGPP+S+E+
Sbjct  222  PTGQCLSEANIRELLNFCYQENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPVSREV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA
Sbjct  342  PKPGDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  402  MDVAKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSF  461

Query  260  KKFNDEFMDQYEDH  219
            KKFND FM+QY+DH
Sbjct  462  KKFNDSFMEQYQDH  475



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 242/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  222  PTGQCLSEANLREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NV CNFTEGAMYSFPQIRLP  A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVACNFTEGAMYSFPQIRLPAGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYSRM
Sbjct  462  KKFNDEFMTQYDNNVGYSRM  481



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  222  PTGQCLSEANLREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND+FM QY+++ GYSRM
Sbjct  462  KKFNDDFMTQYDNNFGYSRM  481



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   473 bits (1217),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 221/252 (88%), Positives = 239/252 (95%), Gaps = 0/252 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE NL++I+QFCY ENLVLLGDEVYQQNIYQDE PF+S+RKVL DMGPP+SKEL
Sbjct  222  PTGQCLSEQNLRQIIQFCYEENLVLLGDEVYQQNIYQDEHPFISARKVLFDMGPPVSKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGL+ NP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLLANP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRA
Sbjct  342  PKPGDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP+IM SF
Sbjct  402  IDAAKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPSIMASF  461

Query  260  KKFNDEFMDQYE  225
            KKFNDEFM +YE
Sbjct  462  KKFNDEFMARYE  473



>gb|AAK68842.1| alanine aminotransferase-like protein [Arabidopsis thaliana]
Length=379

 Score =   469 bits (1208),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 218/260 (84%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+
Sbjct  120  PTGQCLSEANIREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEV  179

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNP
Sbjct  180  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNP  239

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A
Sbjct  240  PKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGA  299

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SF
Sbjct  300  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSF  359

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYS+M
Sbjct  360  KKFNDEFMTQYDNNFGYSKM  379



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   470 bits (1210),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 241/260 (93%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN+KE+LQFCY ENLVLL DEVYQQNIYQDERPF+S+RKV+ DMGPPIS EL
Sbjct  143  PTGQCLSEANIKELLQFCYHENLVLLADEVYQQNIYQDERPFISARKVMFDMGPPISSEL  202

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            Q+VSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNP
Sbjct  203  QVVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGVMVNP  262

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  263  PKPGDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  322

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SF
Sbjct  323  IEAARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSF  382

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM+QYE   GYSR+
Sbjct  383  KKFNDSFMEQYE---GYSRL  399



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 242/260 (93%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN+KE+LQFCY ENLVLL DEVYQQN+YQDERPF+S++KVL DMGPP+S+E+
Sbjct  222  PTGQCLSEANIKEVLQFCYHENLVLLADEVYQQNVYQDERPFISAKKVLFDMGPPLSREV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPQTVDEIYKVASIALSPNVPGQIFMGVMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK IL+SLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYLKFAAESKSILDSLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SF
Sbjct  402  IEAAKRAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            K FND FM QYE   GYSRM
Sbjct  462  KNFNDSFMAQYE---GYSRM  478



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   473 bits (1218),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E+LVLLGDEVYQQNIYQDE PF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANLREILRFCCDESLVLLGDEVYQQNIYQDEHPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+ EEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTAEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP +A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMGSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY D+ GYSRM
Sbjct  462  KKFNDEFMSQYGDNFGYSRM  481



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   473 bits (1216),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 242/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC+ E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  219  PTGQCLSEANLREILRFCHSEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEV  278

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  279  QLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSP  338

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP A
Sbjct  339  PKPGDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPGA  398

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  399  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  458

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QYE+  GYSRM
Sbjct  459  KKFNDEFMTQYENSFGYSRM  478



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 223/260 (86%), Positives = 244/260 (94%), Gaps = 2/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANLREILRFCCNERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY    GYSRM
Sbjct  462  KKFNDEFMSQY--GVGYSRM  479



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   471 bits (1213),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 242/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL++MG P SK +
Sbjct  222  PTGQCLSEANIREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKGV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QI +GLMV+P
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQILMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYSRM
Sbjct  462  KKFNDEFMTQYDNNVGYSRM  481



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   471 bits (1212),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 222/260 (85%), Positives = 244/260 (94%), Gaps = 2/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANLREILRFCCNERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY    GYSRM
Sbjct  462  KKFNDEFMSQY--GVGYSRM  479



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   471 bits (1213),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 243/260 (93%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+KE+L+FC+ ENLVLL DEVYQQNIYQDERPF+S+RKVL DMGPP+S+E+
Sbjct  229  PTGQCLSEGNIKELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREV  288

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNP
Sbjct  289  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNP  348

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  349  PKPGDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  408

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  409  IDAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSF  468

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FMDQY+   GYSRM
Sbjct  469  KKFNDTFMDQYD---GYSRM  485



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   471 bits (1213),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 243/260 (93%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+KE+L+FC+ ENLVLL DEVYQQNIYQDERPF+S+RKVL DMGPP+S+E+
Sbjct  228  PTGQCLSEGNIKELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREV  287

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNP
Sbjct  288  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNP  347

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  348  PKPGDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  407

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  408  IDAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSF  467

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FMDQY+   GYSRM
Sbjct  468  KKFNDTFMDQYD---GYSRM  484



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   471 bits (1211),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 241/260 (93%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN+KE+LQFCY ENLVLL DEVYQQNIYQDERPF+S+RKV+ DMGPPIS EL
Sbjct  222  PTGQCLSEANIKELLQFCYHENLVLLADEVYQQNIYQDERPFISARKVMFDMGPPISSEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            Q+VSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNP
Sbjct  282  QVVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGVMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA
Sbjct  342  PKPGDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SF
Sbjct  402  IEAARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM+QYE   GYSR+
Sbjct  462  KKFNDSFMEQYE---GYSRL  478



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   471 bits (1211),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 240/260 (92%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  219  PTGQCLSEANLREILRFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEV  278

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMVNP
Sbjct  279  QLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVNP  338

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI LPP A
Sbjct  339  PKPGDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQILLPPGA  398

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEA GISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  399  LQAAKQAGKVPDVFYCLKLLEAAGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  458

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM QY+++ GYSRM
Sbjct  459  KKFNDAFMTQYDNNFGYSRM  478



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   471 bits (1211),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 218/260 (84%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+
Sbjct  222  PTGQCLSEANIREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SF
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYS+M
Sbjct  462  KKFNDEFMTQYDNNFGYSKM  481



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   470 bits (1210),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 218/260 (84%), Positives = 244/260 (94%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E+L FCY+ENLVLL DEVYQQNIYQDERPF+S+RKVL DMGPPIS+E+
Sbjct  223  PTGQCLSEANIRELLNFCYQENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPISREV  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLM+NP
Sbjct  283  QLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMMNP  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP RA
Sbjct  343  PKPGDISYLKFATESKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAMYSFPQIRLPKRA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+TA+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  403  IDTAKSAGKEPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSF  462

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM+QY+D   YSR+
Sbjct  463  KKFNDSFMEQYQD---YSRL  479



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   471 bits (1211),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 218/260 (84%), Positives = 243/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+
Sbjct  222  PTGQCLSEANIREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SF
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYS+M
Sbjct  462  KKFNDEFMTQYDNNFGYSKM  481



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   470 bits (1209),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 218/262 (83%), Positives = 241/262 (92%), Gaps = 2/262 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+++L FCY  NLVLL DEVYQQNIYQDERPF+S+RKVL+ +GPP+S EL
Sbjct  220  PTGQCLSEANLRQVLSFCYENNLVLLADEVYQQNIYQDERPFISARKVLMGIGPPMSNEL  279

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNI P +V+EIYKV+SI+LSPNVP QIF+GLMVNP
Sbjct  280  QLVSFHTVSKGYWGECGQRGGYFEMTNISPETVDEIYKVSSIALSPNVPAQIFMGLMVNP  339

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYD+F+ ESKGILESLR+RARIMTDGFNSCRN+VCNFTEGAMYSFPQI+LP RA
Sbjct  340  PKPGDISYDKFITESKGILESLRRRARIMTDGFNSCRNIVCNFTEGAMYSFPQIQLPARA  399

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A   GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SF
Sbjct  400  IEAANRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASF  459

Query  260  KKFNDEFMDQYED--HRGYSRM  201
            KKFND+FMDQYE+  H+ YSRM
Sbjct  460  KKFNDDFMDQYEEDHHKAYSRM  481



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   471 bits (1212),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 219/260 (84%), Positives = 241/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+
Sbjct  278  PTGQCLSEANLREILRFCYSEKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEV  337

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+ 
Sbjct  338  QLVSFHTVSKGYWGECGQRGGYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSS  397

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RA+IMTDGFNSC+N VCNFTEGAMYSFPQI+LPP A
Sbjct  398  PKPGDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNAVCNFTEGAMYSFPQIQLPPGA  457

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  458  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  517

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYSRM
Sbjct  518  KKFNDEFMTQYDNNFGYSRM  537



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   469 bits (1206),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 221/260 (85%), Positives = 243/260 (93%), Gaps = 2/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANLREILRFCCNERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY QFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYAQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND+FM QY    GYSRM
Sbjct  462  KKFNDDFMSQY--GVGYSRM  479



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   468 bits (1203),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 240/251 (96%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FC++ENL LLGDEVYQQNIYQDERPF+SS+KVL+DMGPPISKEL
Sbjct  222  PTGQCLSEANLREILNFCFQENLALLGDEVYQQNIYQDERPFISSKKVLMDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP Q+F+GLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD+SY+Q+ RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDVSYEQYHRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IETA+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP IM SF
Sbjct  402  IETAKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPGIMASF  461

Query  260  KKFNDEFMDQY  228
            +KFNDEFM+QY
Sbjct  462  RKFNDEFMEQY  472



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   467 bits (1202),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 222/261 (85%), Positives = 243/261 (93%), Gaps = 1/261 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL+FC  E LVLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+
Sbjct  222  PTGQCLSEANLKEILRFCCDERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+P
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDIS+DQFV ESK ILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +A
Sbjct  342  PKPGDISHDQFVCESKRILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SF
Sbjct  402  IEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHR-GYSRM  201
            KKFNDEFM QY D+  GYSRM
Sbjct  462  KKFNDEFMSQYGDNNFGYSRM  482



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   466 bits (1199),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 217/260 (83%), Positives = 242/260 (93%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+
Sbjct  222  PTGQCLSEANIREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVV NFTEGAMYSFPQIRLP  A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVRNFTEGAMYSFPQIRLPTGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SF
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM QY+++ GYS+M
Sbjct  462  KKFNDEFMTQYDNNFGYSKM  481



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 240/251 (96%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FC++ENL LLGDEVYQQNIYQDERPF+SS+KVL+DMGPPISKEL
Sbjct  222  PTGQCLSEANLREILNFCFQENLALLGDEVYQQNIYQDERPFISSKKVLMDMGPPISKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP Q+F+GLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
             KPGD+SY+Q+ RESKGIL+SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  LKPGDVSYEQYHRESKGILDSLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IETA+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MPAIM SF
Sbjct  402  IETAKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPAIMASF  461

Query  260  KKFNDEFMDQY  228
            KKFNDEFM+QY
Sbjct  462  KKFNDEFMEQY  472



>ref|XP_006840828.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Amborella 
trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 214/260 (82%), Positives = 240/260 (92%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS AN++EIL+FCY ENL LL DEVYQQNIYQDERPF+S++K+L++MG PIS E+
Sbjct  222  PTGQCLSAANIREILEFCYVENLALLADEVYQQNIYQDERPFVSAKKILMEMGLPISMEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVS+HTVSKGYWGECGQRGGYFEMTN+ P +V+E+YK++SISLSPNVP QIF+GLMVNP
Sbjct  282  QLVSYHTVSKGYWGECGQRGGYFEMTNLSPETVDEMYKISSISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDIS+ +F  ESK ILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+A
Sbjct  342  PKPGDISFMRFAAESKEILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE+DMP IM SF
Sbjct  402  IEAAKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEQDMPEIMASF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QYE HRGYSRM
Sbjct  462  KKFNDEFMEQYEHHRGYSRM  481



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   465 bits (1196),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 218/263 (83%), Positives = 242/263 (92%), Gaps = 3/263 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE ++KE+L FC++ENLVLL DEVYQQNIYQDERPF+S+RKVL DMGPP+S+E+
Sbjct  232  PTGQCLSEGSIKELLSFCFQENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREV  291

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNP
Sbjct  292  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNP  351

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA
Sbjct  352  PKPGDISYLKFAAESKAILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRA  411

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A   GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF
Sbjct  412  IDAANRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSF  471

Query  260  KKFNDEFMDQYEDHRG---YSRM  201
            KKFND FMD+Y+ + G   YSRM
Sbjct  472  KKFNDSFMDEYDGYGGGSSYSRM  494



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   464 bits (1193),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 215/260 (83%), Positives = 240/260 (92%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E++++CY ENLVLL DEVYQQN+YQDERPF+S+RKV+ DMGPPIS+E+
Sbjct  223  PTGQCLSEANIRELVRYCYHENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPISREV  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNP
Sbjct  283  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNP  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RA
Sbjct  343  PKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SF
Sbjct  403  IEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSF  462

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM+QYE   GYSRM
Sbjct  463  KKFNDSFMEQYE---GYSRM  479



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   463 bits (1192),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 215/260 (83%), Positives = 240/260 (92%), Gaps = 3/260 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E++++CY ENLVLL DEVYQQN+YQDERPF+S+RKV+ DMGPPIS+E+
Sbjct  223  PTGQCLSEANIRELVRYCYHENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPISREV  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNP
Sbjct  283  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNP  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RA
Sbjct  343  PKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SF
Sbjct  403  IEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSF  462

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFND FM+QYE   GYSRM
Sbjct  463  KKFNDSFMEQYE---GYSRM  479



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   462 bits (1190),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 220/255 (86%), Positives = 235/255 (92%), Gaps = 3/255 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSS---RKVLLDMGPPIS  810
            PTGQCLSE NL++I+QFCY ENLVLLGDEVYQQNIYQDE PF+S    R VL DMGPPIS
Sbjct  222  PTGQCLSEQNLRQIIQFCYEENLVLLGDEVYQQNIYQDEHPFISKGVYRSVLFDMGPPIS  281

Query  809  KELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLM  630
            KELQLVSFHTVSKGYWGECGQRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGL+
Sbjct  282  KELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLL  341

Query  629  VNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLP  450
             NPPKPGDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LP
Sbjct  342  ANPPKPGDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLP  401

Query  449  PRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM  270
            P AI+ A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP+IM
Sbjct  402  PGAIDAAKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPVEEEMPSIM  461

Query  269  ESFKKFNDEFMDQYE  225
             SFKKFNDEFM QYE
Sbjct  462  ASFKKFNDEFMAQYE  476



>ref|XP_010248614.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Nelumbo nucifera]
Length=338

 Score =   453 bits (1165),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 215/260 (83%), Positives = 233/260 (90%), Gaps = 6/260 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANLKEIL FC + NLVLL DEVYQQNIYQDERPF+S +KVL+D+GPPISKE+
Sbjct  85   PTGQCLSEANLKEILHFCLQXNLVLLADEVYQQNIYQDERPFISVKKVLMDLGPPISKEV  144

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQ GGYFEMTNIPP++V+EIYKVASISLSPNVP QIFL LMVNP
Sbjct  145  QLVSFHTVSKGYWGECGQXGGYFEMTNIPPKTVDEIYKVASISLSPNVPIQIFLSLMVNP  204

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F      I ESL++RA IMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+A
Sbjct  205  PKPGDISYLKF------ITESLKRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQMRLPPKA  258

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IETA+  GK PDV+YCLKLLEATGIS VPGSGFGQKE  FHL TTILPAEEDMPAIM SF
Sbjct  259  IETAKRAGKVPDVFYCLKLLEATGISMVPGSGFGQKEEAFHLMTTILPAEEDMPAIMASF  318

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            KKFNDEFM+QY DHRGYS M
Sbjct  319  KKFNDEFMEQYGDHRGYSWM  338



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   450 bits (1157),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 209/260 (80%), Positives = 237/260 (91%), Gaps = 1/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS  N+KE+L+FCY ENLVLL DEVYQQNIYQDERPF+S++KVL+DMG P SKEL
Sbjct  222  PTGQCLSRDNIKELLEFCYAENLVLLADEVYQQNIYQDERPFVSAKKVLMDMGLPFSKEL  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVS+HTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLGLMVNP
Sbjct  282  QLVSYHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASISLSPNVPGQIFLGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKP DISY +FV ESK ILESLR+RA +MTDGFN+CRNV+CNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPADISYQRFVAESKAILESLRRRAHLMTDGFNNCRNVICNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  A+  GKAPDV+YCLKLLEATG+STVPGSGFGQKEGVFHLRTTILP EE+MP IM  F
Sbjct  402  IAAAKEAGKAPDVFYCLKLLEATGMSTVPGSGFGQKEGVFHLRTTILPPEEEMPEIMNVF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            K FND+FM +YE++  +SR+
Sbjct  462  KIFNDDFMAKYENY-SWSRL  480



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   450 bits (1157),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 206/247 (83%), Positives = 230/247 (93%), Gaps = 0/247 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E++++CY ENLVLL DEVYQQN+YQDERPF+S+RKV+ DMGPPIS+E+
Sbjct  223  PTGQCLSEANIRELVRYCYHENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPISREV  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNP
Sbjct  283  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNP  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RA
Sbjct  343  PKPGDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SF
Sbjct  403  IEAAKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSF  462

Query  260  KKFNDEF  240
            KKFND F
Sbjct  463  KKFNDSF  469



>gb|AFK42206.1| unknown [Lotus japonicus]
Length=305

 Score =   442 bits (1137),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS+ NL+E+LQFCY ENLVLLGDEVYQ NIYQDERPF+SS+KVL+DMGPPISKE 
Sbjct  66   PTGQCLSQENLREVLQFCYEENLVLLGDEVYQTNIYQDERPFISSKKVLMDMGPPISKEQ  125

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLV FH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLMVNP
Sbjct  126  QLVCFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMVNP  185

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQFVRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPPRA
Sbjct  186  PKPGDISYDQFVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPRA  245

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+   KAPDVYYCLKLLEATGISTVPGSGFGQK+G FHLRTTILP EE+MPAIM  F
Sbjct  246  IEAAKQARKAPDVYYCLKLLEATGISTVPGSGFGQKDGYFHLRTTILPLEEEMPAIMGEF  305



>ref|XP_011034252.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Populus euphratica]
Length=382

 Score =   445 bits (1144),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 208/262 (79%), Positives = 235/262 (90%), Gaps = 3/262 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS ANL+E L FCY+ENLVLLGDEVYQQN YQDERPF+S+RKVL+ MGPP+SKE+
Sbjct  122  PTGQCLSAANLRETLHFCYQENLVLLGDEVYQQNTYQDERPFISARKVLMGMGPPVSKEV  181

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP +V EIYKVAS+S+SPNVP QIF+GLMVNP
Sbjct  182  QLISFHTVSKGYWGECGQRGGYFEMTNIPPETVVEIYKVASLSISPNVPAQIFMGLMVNP  241

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD+SY+QF+RESKGILESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQI  PP+A
Sbjct  242  PKPGDVSYEQFIRESKGILESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIX-PPKA  300

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG--VFHLRTTILPAEEDMPAIME  267
            I+ A+  GK PDV+YCLKLLEATGISTVP  G        VFHLRTTILPAEEDMP IM+
Sbjct  301  IDAAKRAGKVPDVFYCLKLLEATGISTVPQIGLIVIRSCRVFHLRTTILPAEEDMPEIMD  360

Query  266  SFKKFNDEFMDQYEDHRGYSRM  201
            SFKKFNDEFM++YE H GYSR+
Sbjct  361  SFKKFNDEFMERYEGHGGYSRL  382



>ref|XP_008467047.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Cucumis melo]
Length=238

 Score =   416 bits (1070),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = -1

Query  842  KVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSP  663
            +VLLDMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSP
Sbjct  25   QVLLDMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSP  84

Query  662  NVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEG  483
            NVP QIF+GLMVNPPKPGDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEG
Sbjct  85   NVPAQIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEG  144

Query  482  AMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  303
            AMYSFPQIRLPP+AIE A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTI
Sbjct  145  AMYSFPQIRLPPKAIEAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  204

Query  302  LPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  201
            LPAEEDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  205  LPAEEDMPEIMASFKKFNDSFMEEYEDHRGYSRM  238



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/221 (86%), Positives = 211/221 (95%), Gaps = 0/221 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE NL+E+LQFCY ENLVLLGDEVYQ NIYQDERPF+S++KVL+D+GPP+SKE+
Sbjct  222  PTGQCLSEENLREVLQFCYEENLVLLGDEVYQTNIYQDERPFISAKKVLMDIGPPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFH+VSKGY+GECGQRGGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLM+NP
Sbjct  282  QLVSFHSVSKGYFGECGQRGGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMINP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A
Sbjct  342  PKPGDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  318
            +ETA+  GKA DVYYCLKLLEATGISTVPGSGFGQKEG  H
Sbjct  402  LETAKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGYVH  442



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   402 bits (1034),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+E+LQFCY ENLVLLGDEVYQ NIYQDERPF+SS+KVL+D+GPP+SKE+
Sbjct  222  PTGQCLSEANLREVLQFCYEENLVLLGDEVYQTNIYQDERPFISSKKVLMDIGPPLSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFH+VSKGY+GECGQRGGYFEM NI P +V+EIYKVASISLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHSVSKGYYGECGQRGGYFEMVNISPETVDEIYKVASISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A
Sbjct  342  PKPGDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  327
            +ETA+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  402  LETAKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   400 bits (1028),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 186/218 (85%), Positives = 204/218 (94%), Gaps = 0/218 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++EIL+FCY E LVLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+
Sbjct  222  PTGQCLSEANIREILKFCYNEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A
Sbjct  342  PKPGDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  327
            ++ A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  402  LQAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN++E+L FCY+ENLVLL DEVYQQN+YQDERPF+S+RKV+ DMGPP+S+E+
Sbjct  222  PTGQCLSEANIRELLNFCYQENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPVSREV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QL+SFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNP
Sbjct  282  QLISFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA
Sbjct  342  PKPGDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  327
            ++ A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEG
Sbjct  402  MDVAKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   400 bits (1027),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE NL+ +++FC RE +VL+ DEVYQQN+YQDERPF+S+RKVL+ MGP  S  L
Sbjct  223  PTGQCLSEKNLRGLIEFCIRERVVLMADEVYQQNVYQDERPFISARKVLMGMGPRYSSAL  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFHTVSKG+ GECGQRGGYFEMTN  P++VEE+YKVASI+LSPNV GQI +GLMV P
Sbjct  283  ELVSFHTVSKGFLGECGQRGGYFEMTNFHPKTVEELYKVASIALSPNVTGQIMMGLMVKP  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD+S+  +  ES  I++SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  A
Sbjct  343  PRPGDVSFPLYAAESAAIMQSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPKAA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMPAIMESF
Sbjct  403  IAAARQAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPAIMESF  462

Query  260  KKFNDEFMDQYEDHR  216
            K FN +FM QY D +
Sbjct  463  KMFNADFMAQYSDSK  477



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL+E NL E+++FC +E +VL+ DEVYQQN+YQDERPF+S+RKVL+ MGPP S+ L
Sbjct  223  PTGQCLTEKNLGELIEFCIQERIVLMADEVYQQNVYQDERPFISARKVLMGMGPPASEAL  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFHTVSKG+ GECGQRGGYFEMTN  P++V+E+YKV+SI+LSPNV GQI +GLMVNP
Sbjct  283  ELVSFHTVSKGFLGECGQRGGYFEMTNFHPKTVDELYKVSSIALSPNVSGQIMMGLMVNP  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY Q+  ESK I  SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  A
Sbjct  343  PKPGDISYPQYEAESKAISLSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPQAA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMP IMESF
Sbjct  403  VAAAKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPGIMESF  462

Query  260  KKFNDEFMDQYEDHR  216
            KKFN +FM QY D +
Sbjct  463  KKFNQDFMAQYADAK  477



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  842  KVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSP  663
            KVLLDMGPPIS ELQL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSP
Sbjct  128  KVLLDMGPPISNELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSP  187

Query  662  NVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEG  483
            NVP QIF+GLMVNPPKPGD SYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEG
Sbjct  188  NVPAQIFMGLMVNPPKPGDFSYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEG  247

Query  482  AMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  303
            AMYSFPQIRLPPRAIE+A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTI
Sbjct  248  AMYSFPQIRLPPRAIESAKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  307

Query  302  LPAEEDMPAIMESFKKFNDEFMDQY  228
            LPAEEDMP IM SFKKFND FM++Y
Sbjct  308  LPAEEDMPEIMASFKKFNDAFMEEY  332



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 223/255 (87%), Gaps = 0/255 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL+E NL+E+++FC +E +VL+ DEVYQQN+YQDERPF+S+RKVL+ MGPP+S+ L
Sbjct  223  PTGQCLTEKNLRELIEFCIKEKIVLMADEVYQQNVYQDERPFISARKVLMGMGPPVSEAL  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFHTVSKG+ GECGQRGGYFEMTNI P++V+E+YKV+SI+LSPNV GQI +GLMV+P
Sbjct  283  ELVSFHTVSKGFLGECGQRGGYFEMTNIHPKTVDELYKVSSIALSPNVTGQIMMGLMVSP  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGDISY  +  ES+ I  SLRKRA IMTDGFN+C N+VCNFTEGAMYSFPQ++LP  A
Sbjct  343  PKPGDISYPLYKAESEAISLSLRKRAHIMTDGFNACENIVCNFTEGAMYSFPQVKLPQAA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E DMP IMESF
Sbjct  403  IAAAKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSERDMPGIMESF  462

Query  260  KKFNDEFMDQYEDHR  216
            KKFN +FM Q+ D +
Sbjct  463  KKFNADFMAQHSDTK  477



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   392 bits (1008),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 195/265 (74%), Positives = 212/265 (80%), Gaps = 39/265 (15%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE NL+EIL+FCY E+LVLLGDEVYQQNIYQDERPF+SSRKVLLDMGPPISKE+
Sbjct  222  PTGQCLSEDNLREILRFCYHEDLVLLGDEVYQQNIYQDERPFISSRKVLLDMGPPISKEV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIP ++V+EIYKVAS+SLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPAKTVDEIYKVASVSLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFP-----QIR  456
             KPGDISY+Q+VRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSF      +I 
Sbjct  342  LKPGDISYEQYVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFLXXSWFRIW  401

Query  455  LPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPA  276
               RA+                                     VFHLRTTILPAEEDMPA
Sbjct  402  TERRALPCR----------------------------------VFHLRTTILPAEEDMPA  427

Query  275  IMESFKKFNDEFMDQYEDHRGYSRM  201
            IM SFKKFNDEFM++YEDHRGYSRM
Sbjct  428  IMASFKKFNDEFMEEYEDHRGYSRM  452



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   379 bits (972),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 218/260 (84%), Gaps = 0/260 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS  NL+++++FCY+E L+L+ DEVYQ N+YQDERPF+S++KVL+DMG P S  +
Sbjct  222  PTGQCLSVTNLQDLIKFCYKERLLLMADEVYQVNVYQDERPFVSAKKVLMDMGAPYSNTV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFH+VSKG+ GECGQRGGYFEMTNI P++VEE+YKVASISLSPNV GQI +GLMV P
Sbjct  282  ELVSFHSVSKGFLGECGQRGGYFEMTNIHPQTVEELYKVASISLSPNVVGQIMMGLMVTP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+P DISY Q+  ESK I+ES+R+RA IMTDGFN C +VVCNFTEGAMYSFP+I+L   A
Sbjct  342  PRPFDISYPQYQAESKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMYSFPRIKLSKAA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A   GKA DV+YCLKLLEATGISTVPGSGFGQKEG  HLRTTILP E+DMP IM  F
Sbjct  402  MDAAAQAGKAADVFYCLKLLEATGISTVPGSGFGQKEGTLHLRTTILPLEQDMPGIMAKF  461

Query  260  KKFNDEFMDQYEDHRGYSRM  201
            +KF+ +FM QY D+   SR+
Sbjct  462  QKFHADFMAQYSDYSVSSRL  481



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 203/251 (81%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS+ NLKE++QF Y E +VL+ DEVYQ+N+YQDERPF+S++KV+ +MG P    +
Sbjct  271  PTGQCLSQENLKELIQFAYEERIVLMADEVYQENVYQDERPFVSAKKVMYEMGEPYRSHV  330

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  GQI L  +VNP
Sbjct  331  ELLSFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSCLVNP  390

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SY+ + +E    L SLR+RA ++TDGFNS   V CNFTEGAMYSFPQI+LPP+A
Sbjct  391  PKPGDSSYEMYTKEKAAELASLRRRAHMVTDGFNSLDGVTCNFTEGAMYSFPQIKLPPKA  450

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GKA DV+YCLKLLE+TGISTVPGSGFGQ++G FHLRTTILP EE M + +E F
Sbjct  451  LEAAKAAGKAGDVFYCLKLLESTGISTVPGSGFGQEDGTFHLRTTILPREEVMSSFVEKF  510

Query  260  KKFNDEFMDQY  228
            +KF+ +FM QY
Sbjct  511  EKFHKDFMKQY  521



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 203/251 (81%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS  NL++I++F + EN+VL+ DEVYQ NI+QDERPF+S +KV++DMG P S E 
Sbjct  273  PTGQCLSYQNLEDIIKFAHEENIVLMADEVYQTNIFQDERPFVSCKKVMMDMGAPYS-EQ  331

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFHT+SKG  GECG RGG  E TNI P +++++YK+ASI+LSPN  GQ  L LMVNP
Sbjct  332  ELVSFHTISKGALGECGMRGGMLEATNIHPDTIDQLYKIASINLSPNTFGQAGLALMVNP  391

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++Q   E+ GI+ S+R+RAR+MTDGFN+C  + CN+TEGAMYSFP++ LPP+A
Sbjct  392  PKEGDPSHEQHEAEAAGIIASMRRRARMMTDGFNACEGITCNYTEGAMYSFPRLNLPPKA  451

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  GKAPD +YCLKLL+ATG+ TVPGSGFGQ+EG FHLRTTILP E+ +  ++ SF
Sbjct  452  LQAAKKAGKAPDTWYCLKLLDATGVLTVPGSGFGQEEGTFHLRTTILPQEDKIKDVIASF  511

Query  260  KKFNDEFMDQY  228
            +KF+  FMD+Y
Sbjct  512  QKFHASFMDEY  522



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 203/251 (81%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS+ NL+E+++F Y+E +VL+ DEVYQ+N+YQDERPF+S++KV+ +MG P    +
Sbjct  270  PTGQCLSKENLQELIKFAYQEKIVLMADEVYQENVYQDERPFVSAKKVMWEMGEPYRSHV  329

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  GQI L ++VNP
Sbjct  330  ELLSFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSVLVNP  389

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYDQ+ +E    L SLR+RA ++TDGFN+   V CNFTEGAMYSFPQI+LP +A
Sbjct  390  PKPGDPSYDQYTKEKASELVSLRRRAHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKA  449

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F
Sbjct  450  LEAAKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTHFVEKF  509

Query  260  KKFNDEFMDQY  228
             KF+ +FM QY
Sbjct  510  DKFHKDFMKQY  520



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 201/251 (80%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS+ NL+E+++  Y+E +VL+ DEVYQ+N+YQDERPF+S++KV+ +MG P    +
Sbjct  270  PTGQCLSKENLQELIKLAYQEKIVLMADEVYQENVYQDERPFVSAKKVMWEMGEPYRSHV  329

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFHTVSKG  GECG RGGY EMTNI P ++EE+YK ASI+LSPN  GQI L ++VNP
Sbjct  330  ELLSFHTVSKGTAGECGLRGGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSVLVNP  389

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYDQ+ +E    L SLR+R  ++TDGFN+   V CNFTEGAMYSFPQI+LP +A
Sbjct  390  PKPGDPSYDQYTKEKASELVSLRRRRHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKA  449

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F
Sbjct  450  LEAAKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTTFVEKF  509

Query  260  KKFNDEFMDQY  228
             KF+ +FM QY
Sbjct  510  DKFHKDFMKQY  520



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   321 bits (823),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/282 (55%), Positives = 199/282 (71%), Gaps = 7/282 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS  +L+ +++F Y+  LVL+ DEVYQ NIYQ  RPF+S+R V L MG P ++ L
Sbjct  268  PTGQCLSRQDLEGLVKFAYKHKLVLMADEVYQDNIYQTVRPFVSARHVALSMGSPYAQGL  327

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L +FHT SKG +GECG RGG  E+ N   R  +E+YK+ASI+LSPNVPGQ+ LGLMVN 
Sbjct  328  ELATFHTASKGVYGECGFRGGVMELLNFDERVADELYKLASINLSPNVPGQVILGLMVNG  387

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY Q+ RE + +L+SLR+RAR +TD FNSC  +VC  TEGAMYSFP+I LPP A
Sbjct  388  PRPGDESYAQYAREKQDLLDSLRRRARAITDAFNSCEGIVCQETEGAMYSFPKITLPPAA  447

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A+  GK+PDV+YCLKLLE TGISTVPGSGF Q++G FH RTTILP E     I++ F
Sbjct  448  MAAAKAAGKSPDVFYCLKLLETTGISTVPGSGFKQRDGTFHFRTTILPPESKFQDIIQRF  507

Query  260  KKFNDEFMDQYE-------DHRGYSRM*QIADNMKQLLKSHK  156
              F+  FM +Y+       D R   R  Q    +  ++ +H+
Sbjct  508  LAFHSAFMAEYKGSTGRGTDSRDVKRAEQQESEVNWMIPAHR  549



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEANL+EIL FCY+ENLVLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISK++
Sbjct  222  PTGQCLSEANLREILNFCYQENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKDV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVV  501
             KPGD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVV
Sbjct  342  LKPGDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVV  381



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSEAN+KE+LQFCY ENLVLL DEVYQQN+YQDERPF+S++KVL DMGPP+S+E+
Sbjct  222  PTGQCLSEANIKEVLQFCYHENLVLLADEVYQQNVYQDERPFISAKKVLFDMGPPLSREV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFHTVSKGYWGECGQRGGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNP
Sbjct  282  QLVSFHTVSKGYWGECGQRGGYFEMTNLPPQTVDEIYKVASIALSPNVPGQIFMGVMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEG  483
            PKPGDISY +F  ESK IL+SLR+RAR+MTDGFNSCRNVVCNFTEG
Sbjct  342  PKPGDISYLKFAAESKSILDSLRRRARMMTDGFNSCRNVVCNFTEG  387



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   305 bits (782),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 189/251 (75%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL+E NL+++++F  +E +VL+ DEVYQ NIYQDE+PF+S++KVL D+G PIS  +
Sbjct  278  PTGQCLTEDNLRDLVRFAAKEKVVLMADEVYQPNIYQDEKPFVSAKKVLGDLGKPISDSV  337

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFHTVSKG  GECG RGGY E+TN  P +V+E+YK  SI+LSPN  GQ+ + LMVNP
Sbjct  338  ELASFHTVSKGVLGECGLRGGYVELTNFHPGTVDELYKAVSINLSPNTTGQVAMSLMVNP  397

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SY Q+  E    L SLR+RA  MTDGFN+   V C FTEGAMYSFP++ LPP+A
Sbjct  398  PKPGDESYAQWKAEHDEGLASLRRRAHAMTDGFNALDGVTCTFTEGAMYSFPRLHLPPKA  457

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  A   GK  D +YCL+LLEATGI TVPGSGFGQ+EG FHLRTTILP E  +   ++ F
Sbjct  458  IAAAAAAGKPADTFYCLQLLEATGIVTVPGSGFGQEEGTFHLRTTILPPEAKIGEFVKLF  517

Query  260  KKFNDEFMDQY  228
            + F+  FM +Y
Sbjct  518  QDFHKAFMAKY  528



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   303 bits (777),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 190/253 (75%), Gaps = 2/253 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIY-QDERPFLSSRKVLLDMGPPISKE  804
            PTGQCL +AN++E+++FC  + LVLL DEVYQ+N+Y ++++PF+S +KV+ DMG   + +
Sbjct  279  PTGQCLDKANMEEVVKFCLNKGLVLLADEVYQENVYVKEDKPFISFKKVVKDMGGEYA-D  337

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
            L++VSFH+VSKG+ GECG+RGGY E+  I      EIYK+ASI L PNV GQ+ + LMV 
Sbjct  338  LEMVSFHSVSKGFVGECGKRGGYMELNGITSDVKAEIYKLASIGLCPNVIGQLVVDLMVR  397

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP PGD SY+ +++E  GI +SL+KRA ++    NS   V CN +EGAMY+FPQIRLP +
Sbjct  398  PPTPGDSSYELYIKERDGIYDSLKKRANLLNKALNSLEGVTCNPSEGAMYAFPQIRLPKK  457

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            A+E AQ +GKAPD YYC++LLE TGI  VPGSGFGQK+G +H RTT LP+EE +  + E 
Sbjct  458  AVEYAQSIGKAPDAYYCIQLLEHTGICVVPGSGFGQKDGTYHFRTTFLPSEEAIEGVCER  517

Query  263  FKKFNDEFMDQYE  225
               F+ +FM++Y+
Sbjct  518  IADFHKQFMNKYK  530



>ref|XP_009151206.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Brassica 
rapa]
Length=155

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -1

Query  710  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  531
            ++VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRESKGILESLR+RARIMT
Sbjct  2    QTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMT  61

Query  530  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  351
            DGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPG
Sbjct  62   DGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPG  121

Query  350  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  249
            SGFGQKEGVFHLRTTILPAEE+MP IMESFKKFN
Sbjct  122  SGFGQKEGVFHLRTTILPAEEEMPLIMESFKKFN  155



>gb|ETP41623.1| hypothetical protein F442_11247 [Phytophthora parasitica P10297]
Length=499

 Score =   294 bits (753),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 183/251 (73%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+KEI++FC +EN+++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  249  PTGQCLSEKNIKEIIKFCKKENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  307

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  308  ELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNP  367

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A
Sbjct  368  PQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKA  427

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E  
Sbjct  428  VEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKT  487

Query  260  KKFNDEFMDQY  228
             KF+  FMD+Y
Sbjct  488  SKFHARFMDKY  498



>gb|ETP13560.1| hypothetical protein F441_11279 [Phytophthora parasitica CJ01A1]
Length=499

 Score =   294 bits (753),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 183/251 (73%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+KEI++FC +EN+++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  249  PTGQCLSEKNIKEIIKFCKKENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  307

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  308  ELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNP  367

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A
Sbjct  368  PQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKA  427

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E  
Sbjct  428  VEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKT  487

Query  260  KKFNDEFMDQY  228
             KF+  FMD+Y
Sbjct  488  SKFHARFMDKY  498



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 193/280 (69%), Gaps = 29/280 (10%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRK-------------  840
            PTGQ L  ANL+++++F + E L+L+ DEVYQ+ +Y++E+PF+S+RK             
Sbjct  341  PTGQVLPLANLRDLVRFAFDEKLLLMADEVYQELVYEEEKPFVSARKDARPACALLGLHM  400

Query  839  ----------------VLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPR  708
                             L DMG P +  ++L+S+HTVSKG  GECG RGGY+EM NI P 
Sbjct  401  TASGLLDGQPPATMAAALKDMGEPYASGVELISYHTVSKGTSGECGLRGGYYEMVNIHPA  460

Query  707  SVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTD  528
            +V++ YK++SI+LSPN  GQI L  MVNPP  GD S++ +++E +G L SL +RA+++ D
Sbjct  461  TVDQFYKISSINLSPNSIGQIALSCMVNPPAAGDPSHELWIQEQQGELASLNRRAKMVVD  520

Query  527  GFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGS  348
            GFNS + V CN TEGAMY+FP++ LPPRA+E A+  G+APD +YCL+LLEATGI  VPGS
Sbjct  521  GFNSLQGVSCNATEGAMYAFPRLSLPPRALEAARKAGRAPDAFYCLRLLEATGIVAVPGS  580

Query  347  GFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  228
            GFGQ EG FHLRTTILP EE M   ++ F+ F+  FM ++
Sbjct  581  GFGQAEGSFHLRTTILPREERMAEFVQKFRTFHQSFMAEF  620



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 176/253 (70%), Gaps = 0/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+   L+E++ F + E LVLL DEVYQ NIYQDE+PF+S+++VL +MG P +  +
Sbjct  235  PTGQVLTRETLRELIAFAHDEGLVLLADEVYQPNIYQDEKPFVSAKRVLREMGEPWASSV  294

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFHTVSKG  GECG RGGY E  NI P +  E+YKVAS++L PN  GQ  + LMV P
Sbjct  295  ELASFHTVSKGMLGECGLRGGYVEWVNIHPGAQAELYKVASVNLCPNTVGQATVSLMVAP  354

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P     +  Q+ ++ +  L SLR+RA +MTD FN      CNFTEGAMYSFP++ LP +A
Sbjct  355  PTGDSEAARQYAKQYEDSLASLRRRAHVMTDAFNGLEGASCNFTEGAMYSFPRLHLPAKA  414

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GK PD +YCL LL  TGI TVPGSGFGQ EG FHLRTTILP E+ M   ++  
Sbjct  415  IQAAKEAGKDPDTFYCLALLADTGIVTVPGSGFGQVEGTFHLRTTILPQEDVMHEFVDKL  474

Query  260  KKFNDEFMDQYED  222
            + F+  FM +Y+D
Sbjct  475  RTFHKSFMAKYKD  487



>gb|ESA18192.1| hypothetical protein GLOINDRAFT_334935 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 182/254 (72%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMGPPISKE  804
            PTGQCL+E N++EI+ FC+ E++VLL DEVYQ NIYQ DERPF S +KV+  MG    + 
Sbjct  244  PTGQCLTEHNMREIVDFCHNEHIVLLADEVYQTNIYQPDERPFHSFKKVIRSMGKKYER-  302

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH+VSKG  GECG+RGGY+E TNI  R +EE+YK+AS+SL PNV GQI + LMV 
Sbjct  303  FELFSFHSVSKGMIGECGRRGGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLMVQ  362

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PPK GD SY  + +E   I ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP +
Sbjct  363  PPKRGDKSYTSYQKELNEIYESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLPQK  422

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A   GK PD +YCL +L+ATG+  VPGSGFGQK G +H R+T LP EE +      
Sbjct  423  AIEAAHQAGKKPDEFYCLAMLDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFCIK  482

Query  263  FKKFNDEFMDQYED  222
             +KF++EF+++Y D
Sbjct  483  LQKFHNEFLEKYCD  496



>tpg|DAA63613.1| TPA: hypothetical protein ZEAMMB73_743428 [Zea mays]
Length=329

 Score =   286 bits (732),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L E N K+I++FC  E LVLL DEVYQ+NIY +++PF S +K+   +G     +L
Sbjct  78   PTGQVLVEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDL  136

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NP
Sbjct  137  PLVSFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNP  196

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  197  PKAGDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKA  256

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  257  IGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  316

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  317  KEFHEKFMDEFRD  329



>gb|EXX69945.1| alanine transaminase ALT1 [Rhizophagus irregularis DAOM 197198w]
Length=528

 Score =   292 bits (748),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 182/254 (72%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMGPPISKE  804
            PTGQCL+E N++EI+ FC+ E++VLL DEVYQ NIYQ DERPF S +KV+  MG    + 
Sbjct  276  PTGQCLTEHNMREIVDFCHNEHIVLLADEVYQTNIYQPDERPFHSFKKVIRSMGKKYER-  334

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH+VSKG  GECG+RGGY+E TNI  R +EE+YK+AS+SL PNV GQI + LMV 
Sbjct  335  FELFSFHSVSKGMIGECGRRGGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLMVQ  394

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PPK GD SY  + +E   I ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP +
Sbjct  395  PPKRGDKSYTSYQKELNEIYESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLPQK  454

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A   GK PD +YCL +L+ATG+  VPGSGFGQK G +H R+T LP EE +      
Sbjct  455  AIEAAHQAGKKPDEFYCLAMLDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFCIK  514

Query  263  FKKFNDEFMDQYED  222
             +KF++EF+++Y D
Sbjct  515  LQKFHNEFLEKYCD  528



>ref|NP_001060284.1| Os07g0617800 [Oryza sativa Japonica Group]
 dbj|BAF22198.1| Os07g0617800 [Oryza sativa Japonica Group]
Length=329

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 178/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  78   PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDL  136

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NP
Sbjct  137  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNP  196

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +A
Sbjct  197  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKA  256

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  257  IGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKF  316

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  317  KEFHEKFMDEFRD  329



>ref|XP_008907369.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETN06993.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETO72425.1| hypothetical protein F444_11432 [Phytophthora parasitica P1976]
Length=499

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 183/251 (73%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N++EI++FC +E++++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  249  PTGQCLSEKNIEEIIKFCKKEDILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  307

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  308  ELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNP  367

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A
Sbjct  368  PQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKA  427

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E  
Sbjct  428  VEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKT  487

Query  260  KKFNDEFMDQY  228
             KF+  FMD+Y
Sbjct  488  SKFHARFMDKY  498



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 181/253 (72%), Gaps = 2/253 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDE-RPFLSSRKVLLDMGPPISKE  804
            PTGQ L  AN++EI+ FC+R+ +VLL DEVYQ+N+Y  E +PF+S +KV++DMG  + + 
Sbjct  348  PTGQTLDAANMREIVAFCHRKRIVLLADEVYQENVYVKETKPFVSFKKVVMDMGKEV-EG  406

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
            L+LVSFH+VSKG+ GECG+RGGY E+  I      EIYK+ASI L PNV GQI + LMV 
Sbjct  407  LELVSFHSVSKGFVGECGKRGGYMELHGITNEVKAEIYKLASIGLCPNVTGQIVVDLMVR  466

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  G+ SYD +V+E   I +SL++RA ++    N    V CN  EGAMY+FPQIRLP R
Sbjct  467  PPVAGEQSYDTYVKERDTIFDSLKRRANLLAAALNGLEGVTCNQPEGAMYAFPQIRLPAR  526

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A+  GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+E+ +  +   
Sbjct  527  AIEEAKANGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTYHFRTTFLPSEQAIQGVCTR  586

Query  263  FKKFNDEFMDQYE  225
               F+  FM +Y+
Sbjct  587  IADFHKNFMAKYK  599



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/252 (52%), Positives = 183/252 (73%), Gaps = 1/252 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L  AN+ +I+QFC+++ LVLL DEVYQ+N+Y + +PF+S +KV+ D+G  + + L
Sbjct  281  PTGQTLDAANMSDIVQFCHQKRLVLLADEVYQENVYSENKPFVSFKKVVKDLGTKV-EGL  339

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            ++VSFH+VSKG+ GECG+RGGY E+  I P    EIYK++SI L PNV GQ+ + LMVNP
Sbjct  340  EMVSFHSVSKGFVGECGKRGGYMELFGISPEVKSEIYKLSSIGLCPNVIGQLVVDLMVNP  399

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+ G+ S+ Q++ E   I  SL++RA ++    NS   V CN  EGAMY+FPQIRLPP+A
Sbjct  400  PQEGEASHKQYIEERDAIYNSLKRRANLLATALNSLEGVTCNAPEGAMYAFPQIRLPPKA  459

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GK PD +YC++LLEATGI  VPGSGFGQ++G +H RTT LP+E+ +  + +  
Sbjct  460  VEEAKQNGKQPDAHYCIQLLEATGICVVPGSGFGQRDGTYHFRTTFLPSEQAIEGVCKKV  519

Query  260  KKFNDEFMDQYE  225
              F+  FM +Y+
Sbjct  520  ADFHKAFMAKYK  531



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 182/251 (73%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N++EI++FC +E++++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  249  PTGQCLSEKNIEEIIKFCKKEDILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  307

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  308  ELISFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLVVGMMTNP  367

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A
Sbjct  368  PQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKA  427

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC ++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E  
Sbjct  428  VEAAKEAGMAPDAFYCTQMLDDTGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEMT  487

Query  260  KKFNDEFMDQY  228
             KF+ +FMD Y
Sbjct  488  SKFHAKFMDTY  498



>ref|XP_006657961.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryza 
brachyantha]
Length=453

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  202  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKQFHSFKKIARSMGYT-DDDL  260

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NP
Sbjct  261  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNP  320

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +A
Sbjct  321  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKA  380

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  381  IGAAQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKF  440

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD+Y D
Sbjct  441  KEFHEKFMDEYRD  453



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  240  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKQFHSFKKIARSMGY-TDDDL  298

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NP
Sbjct  299  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNP  358

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +A
Sbjct  359  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKA  418

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  419  IGAAQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKF  478

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD+Y D
Sbjct  479  KEFHEKFMDEYRD  491



>gb|AAV64199.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   288 bits (736),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L E N K+I++FC  E LVLL DEVYQ+NIY +++PF S +K+   +G     +L
Sbjct  265  PTGQVLVEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDL  323

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NP
Sbjct  324  PLVSFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNP  383

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  384  PKAGDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKA  443

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  444  IGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  503

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  504  KEFHEKFMDEFRD  516



>tpg|DAA41461.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
 tpg|DAA41462.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
Length=330

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   +G     +L
Sbjct  78   PTGQVLTEENQKKIVEFCKNERLVLLADEVYQENIYVEDKQFHSFKKIARSLGY-TDDDL  136

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF ++SKGY+GECG+RGGY E+T   P+  ++IYK+ASI+L  N+ GQI   L++NP
Sbjct  137  PLVSFQSISKGYYGECGKRGGYMEITGFSPQVRDQIYKMASINLCSNITGQILASLVMNP  196

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ F  E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  197  PKAGDESFESFRLERDGILSSLGRRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPRKA  256

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H+R+TILP E+ +P I+  F
Sbjct  257  IGAAQAAGTAPDAYYAKRLLEATGIVFVPGSGFGQVPGTWHIRSTILPQEDKIPGIVSRF  316

Query  260  KKFNDEFMDQYEDH  219
            K+F+D+FMD++ D+
Sbjct  317  KEFHDKFMDEFRDY  330



>dbj|BAC79866.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC79995.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=486

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 178/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  235  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDL  293

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NP
Sbjct  294  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNP  353

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +A
Sbjct  354  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKA  413

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  414  IGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKF  473

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  474  KEFHEKFMDEFRD  486



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 178/251 (71%), Gaps = 5/251 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL+EAN++++++FC R NLV+L DEVYQ N+Y D  PF S RKV+  M       +
Sbjct  227  PTGQCLTEANIRQVVEFCERNNLVILADEVYQANVYGDV-PFTSFRKVVTHM----KSNV  281

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+S+H+VSKG  GECG+RGGY E+ NI P  VE+IYK+ SISL  N+ GQI + LMVNP
Sbjct  282  ELISYHSVSKGMIGECGRRGGYMELINIDPVVVEQIYKLFSISLCSNIAGQIIVDLMVNP  341

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P  GD S+DQ+ RE K + ESL++R++ +    NS +N+ C    GAMY+FP I LPP A
Sbjct  342  PAKGDPSHDQYEREMKDLFESLKRRSQKLHAALNSMKNITCTEIGGAMYAFPSIHLPPSA  401

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+  G  PD +Y ++LL+ATGI  VPGSGF QK+G FH RTT LP+E  M  +++  
Sbjct  402  VQAAKEAGMTPDTFYAVELLDATGICVVPGSGFRQKQGSFHFRTTFLPSESKMDDVIDKL  461

Query  260  KKFNDEFMDQY  228
            +KFN  FMD+Y
Sbjct  462  RKFNQSFMDKY  472



>gb|AAV64237.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   287 bits (734),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L E N K+I++FC  E LVLL DEVYQ+NIY +++PF S +K+   +G     +L
Sbjct  265  PTGQVLVEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDL  323

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NP
Sbjct  324  PLVSFQSVSKGYYGECGKRGGYMEITGFSPDVREQIYKVASVNLCSNVSGQILASLVMNP  383

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  384  PKAGDESFESFMSERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKA  443

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  444  IGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  503

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  504  KEFHEKFMDEFRD  516



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L E N K+I++FC  E LVLL DEVYQ+NIY +++PF S +K+   +G     +L
Sbjct  290  PTGQVLVEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDL  348

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NP
Sbjct  349  PLVSFQSVSKGYYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNP  408

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  409  PKAGDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKA  468

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  469  IGAAQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  528

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  529  KEFHEKFMDEFRD  541



>gb|KDE04574.1| hypothetical protein MVLG_05042 [Microbotryum violaceum p1A1 
Lamole]
Length=582

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 178/253 (70%), Gaps = 2/253 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG CLS  N+ +IL+ CY E LVL+ DEVYQ NIY  +RPF+S +K L D+G P S  +
Sbjct  332  PTGNCLSRENMNDILKVCYEEKLVLMADEVYQDNIYHKDRPFVSFKKALKDLGAPYSNNV  391

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFH++SKG  GECG+RGGYFE+ N  P + EEIYK+ASI L P++ GQI + ++V P
Sbjct  392  ELVSFHSISKGQTGECGRRGGYFELCNFAPEAEEEIYKLASIQLCPSLGGQIGVDVLVCP  451

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK G+ SY Q++ E +GI ++L++R+ I+   FN    V CN  EGA+Y FP + LPP+A
Sbjct  452  PKEGEASYAQWIEEREGIAKTLKERSEILHKAFNELEGVECNEAEGALYLFPTVHLPPKA  511

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YCL+LL+ATGI  VPGSGFGQKEG FH RTT L    D  A  +  
Sbjct  512  IEAAKKANLAPDAFYCLELLQATGICVVPGSGFGQKEGTFHFRTTFLAPGTDKFA--KRL  569

Query  260  KKFNDEFMDQYED  222
            ++F++ FM QY D
Sbjct  570  QQFHEGFMKQYRD  582



>emb|CCI42079.1| unnamed protein product [Albugo candida]
Length=479

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 180/251 (72%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS+ N++E++QFC + NL++L DEVYQ+N+Y  ++ FLS +KVL D+G   +  +
Sbjct  229  PTGQCLSKKNIEEVIQFCQKHNLLILADEVYQENVYAADKKFLSFKKVLRDLGAAYNN-V  287

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + E++YK+ SI+L  N+ GQ+ +GLMVNP
Sbjct  288  ELISFHSTSKGFTGECGRRGGYMELVNISECAREQLYKLMSINLCSNIEGQLMVGLMVNP  347

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY ++  +   IL SL++RA  +   FN    V CN TEGA+Y+FP+IRL  +A
Sbjct  348  PKKGDASYQRYCHQRDSILASLKRRALKLVAAFNKLEGVTCNATEGALYTFPRIRLSEKA  407

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A G   APD YYC+++LE TGI  VPGSGFGQK+G FH R+TILP E+++  ++   
Sbjct  408  VQAASGCNMAPDTYYCIQMLEKTGIVVVPGSGFGQKDGTFHFRSTILPPEDEVNEVITKM  467

Query  260  KKFNDEFMDQY  228
              F+  FM+ +
Sbjct  468  SDFHLNFMNAH  478



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 178/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  295  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDL  353

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NP
Sbjct  354  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNP  413

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +A
Sbjct  414  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKA  473

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  474  IGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKF  533

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  534  KEFHEKFMDEFRD  546



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 178/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  295  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDL  353

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  NV GQI   L++NP
Sbjct  354  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNP  413

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +A
Sbjct  414  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKA  473

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  474  IGAAQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKF  533

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  534  KEFHEKFMDEFRD  546



>ref|XP_006661735.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=483

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC  E LVLL DEVYQ+NIY D + F S +K+   MG     +L
Sbjct  232  PTGQVLAEENQRDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYN-EDDL  290

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  291  PLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNP  350

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY  +  E  GIL+SL +RA+ + D FN+   + CN TEGAMY FPQ+ LP +A
Sbjct  351  PKAGDASYASYKAEKDGILQSLARRAKALEDAFNNLEGITCNKTEGAMYLFPQLLLPRKA  410

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H+R TILP EE +PAI+  F
Sbjct  411  IEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRF  470

Query  260  KKFNDEFMDQYED  222
            K F++ FM  Y D
Sbjct  471  KTFHESFMAAYRD  483



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   286 bits (731),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 178/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE N KEI++FC  E LVLL DEVYQ+NIY D + F S +K+   MG     +L
Sbjct  279  PTGQVLSEENQKEIVEFCRNEGLVLLADEVYQENIYADNKKFNSFKKISRSMGYS-GDDL  337

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T + P   E+IYKVAS++L  N+ GQI   L++NP
Sbjct  338  SLVSFQSVSKGYYGECGKRGGYMEVTGLSPDVKEQIYKVASVNLCSNISGQILASLVMNP  397

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ ++ E   IL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +A
Sbjct  398  PKVGDESYESYIAERDEILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKA  457

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R+TILP E+ +PAI+   
Sbjct  458  IKAAEAVKTAPDAYYAHRLLDATGIVVVPGSGFGQVPGTWHIRSTILPQEDKIPAILSRL  517

Query  260  KKFNDEFMDQYED  222
            K F++ FMD++ D
Sbjct  518  KAFHEAFMDEFRD  530



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 185/251 (74%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG CL+  +L+++++F Y   LVL+ DEVYQ+NIYQ + PF S +KVL +MG P S  +
Sbjct  225  PTGNCLTVEDLRQLVRFAYDNRLVLMADEVYQENIYQSKTPFTSCKKVLAEMGYPYSSSV  284

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFHTVSKG +GECG RGGY E+TNI  R  +E+YK+ SI+LSPNV GQ+ +G+M NP
Sbjct  285  ELVSFHTVSKGVYGECGLRGGYMELTNIDQRVSDEMYKLCSINLSPNVTGQVAMGIMCNP  344

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPG  SY   +RE + +L+SL +RAR + D FN    V C  TEGA+Y+FP+I LP  A
Sbjct  345  PKPGSESYALHMREKEVLLQSLIRRARSIVDAFNGLDGVTCEETEGALYAFPKIDLPRAA  404

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+  GKAPDV+YCL+LL+ TG+S VPGSGFGQ EG +H RTTILPAE+   ++++ F
Sbjct  405  IDAAKAAGKAPDVFYCLELLKETGLSCVPGSGFGQAEGTYHFRTTILPAEDTFQSVVDGF  464

Query  260  KKFNDEFMDQY  228
              F+  FM +Y
Sbjct  465  TSFHRGFMAKY  475



>ref|NP_001064504.1| Os10g0390500 [Oryza sativa Japonica Group]
 dbj|BAA77260.1| alanine aminotransferase [Oryza sativa]
 dbj|BAA77261.1| alanine aminotransferase [Oryza sativa]
 gb|ABB47494.1| Alanine aminotransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26418.1| Os10g0390500 [Oryza sativa Japonica Group]
 gb|ACA50484.1| alanine aminotransferase [Oryza sativa Japonica Group]
 gb|EEC66876.1| hypothetical protein OsI_33417 [Oryza sativa Indica Group]
 gb|EEE50893.1| hypothetical protein OsJ_31385 [Oryza sativa Japonica Group]
Length=483

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC  E LVLL DEVYQ+NIY D + F S +K+   MG     +L
Sbjct  232  PTGQVLAEENQRDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYN-EDDL  290

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  291  PLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNP  350

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +A
Sbjct  351  PKAGDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKA  410

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  F
Sbjct  411  IDAAKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRF  470

Query  260  KKFNDEFMDQYED  222
            K F++ FM  Y D
Sbjct  471  KAFHEGFMAAYRD  483



>gb|AAK52114.1|AC079936_10 Putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=484

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC  E LVLL DEVYQ+NIY D + F S +K+   MG     +L
Sbjct  233  PTGQVLAEENQRDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYN-EDDL  291

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  292  PLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNP  351

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +A
Sbjct  352  PKAGDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKA  411

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  F
Sbjct  412  IDAAKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRF  471

Query  260  KKFNDEFMDQYED  222
            K F++ FM  Y D
Sbjct  472  KAFHEGFMAAYRD  484



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   284 bits (726),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 184/251 (73%), Gaps = 2/251 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LS  N++EI ++     +VLL DEVYQ N+Y   RPF+S +KV+ +MG    K +
Sbjct  227  PTGQVLSRENMEEIARWAAVNRVVLLADEVYQTNVY-GSRPFISFKKVVTEMGDE-GKNV  284

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFHTVSKG +GECG+RGGY E TNI P +++++YKV SI LS NV GQ+ +GLM NP
Sbjct  285  ELISFHTVSKGVFGECGRRGGYLEATNIHPGALDQLYKVFSIGLSSNVDGQLMMGLMCNP  344

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SY+Q+ +E   I +SL++RA ++++ FN+   V C   EGA+Y+FP++RLP  A
Sbjct  345  PKPGDASYEQYEQECDAIFQSLKRRAEMISNAFNALPGVSCQNVEGALYAFPRVRLPEAA  404

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A+     PD++YCL+LL ATGI  VPGSGFGQ+EG FH RTTILPAEE MP +++ F
Sbjct  405  VKEAEKKDMGPDLFYCLELLHATGICAVPGSGFGQEEGTFHFRTTILPAEEQMPRVIDLF  464

Query  260  KKFNDEFMDQY  228
              F+ +F+ ++
Sbjct  465  TSFHKDFLQRF  475



>ref|XP_008620886.1| alanine transaminase [Saprolegnia diclina VS20]
 gb|EQC25667.1| alanine transaminase [Saprolegnia diclina VS20]
Length=489

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 178/251 (71%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+++I+QFC  E LVL+ DEVYQ+N+Y +++ F+S +KVL DMGP     +
Sbjct  239  PTGQCLSENNMRDIVQFCKDEKLVLMADEVYQENVYAEDKHFVSFKKVLKDMGPDYDC-V  297

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH+ SKG+ GECG+RGGY E+ N    ++E++YK+ SI+L  N+ GQ+ + LM NP
Sbjct  298  ELASFHSTSKGFTGECGRRGGYMELVNFNADAMEQLYKLVSINLCSNIEGQLMVALMTNP  357

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P  GD SY+ ++ +  GIL SL++RA  +   FN    V CN  EGAMY+FP+I +P +A
Sbjct  358  PVEGDESYELYIAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKA  417

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A   G APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E  
Sbjct  418  VEEATKRGVAPDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKT  477

Query  260  KKFNDEFMDQY  228
             KF+ EFMD Y
Sbjct  478  AKFHAEFMDLY  488



>ref|XP_010939850.1| PREDICTED: alanine aminotransferase 2 isoform X3 [Elaeis guineensis]
Length=329

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N +EI+QFC +E LVLL DEVYQ+NIY + + F S +K+   MG    K+L
Sbjct  78   PTGQVLAEGNQREIVQFCKKEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDL  136

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++N 
Sbjct  137  SLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNT  196

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +A
Sbjct  197  PKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKA  256

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   
Sbjct  257  IEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARL  316

Query  260  KKFNDEFMDQYED  222
            K F++ F+ ++ D
Sbjct  317  KAFHESFLGEFRD  329



>gb|ETI43749.1| hypothetical protein F443_11362 [Phytophthora parasitica P1569]
Length=499

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 179/251 (71%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS   ++EI++FC  E++++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  249  PTGQCLSADAIEEIIKFCKEEDILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  307

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  308  ELISFHSTSKGFTGECGRRGGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNP  367

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A
Sbjct  368  PQPGDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKA  427

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E  
Sbjct  428  VEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKT  487

Query  260  KKFNDEFMDQY  228
             KF+  FMD+Y
Sbjct  488  SKFHARFMDKY  498



>ref|XP_002463187.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
 gb|EER99708.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
Length=541

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+N+Y +++ F S +K+   +G     +L
Sbjct  290  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENVYVEDKKFHSFKKIARSLGY-TDDDL  348

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKG++GECG+RGGY E+T   P   E+IYKVAS++L  NV GQI   L++NP
Sbjct  349  PLVSFQSVSKGFYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNP  408

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  409  PKAGDESFESFMLERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKA  468

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  469  IGAAQAAGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRF  528

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD++ D
Sbjct  529  KEFHEKFMDEFRD  541



>ref|XP_004345426.2| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=489

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 184/253 (73%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG  LS  +++ I++ C+RE+LVLL DEVYQ N+YQD+RPF+S RKVL  MGP  S  +
Sbjct  238  PTGGVLSMESMRGIVELCHREHLVLLADEVYQTNVYQDQRPFVSFRKVLKSMGPEFSN-V  296

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+VSKG+ GECG+RGGY EM  I     E+IYKVASISL PNV GQ+ + LMVNP
Sbjct  297  ELISFHSVSKGFIGECGKRGGYMEMIGIDAYVREQIYKVASISLCPNVQGQVIVDLMVNP  356

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK G+ SY+ + RE   IL SL+ R+  + D FN    V C   +GAMY+FPQIRLP +A
Sbjct  357  PKEGEPSYELYARERDQILGSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTFPQIRLPKKA  416

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GKAPD +YC+ LLEATG+S VPG+GF Q+EG +H R T LP ++  PA  ++ 
Sbjct  417  VEAAKAAGKAPDSFYCMALLEATGVSVVPGTGFKQREGTYHFRCTFLPPQDTFPAFTDAI  476

Query  260  KKFNDEFMDQYED  222
             +F++EFM +Y+D
Sbjct  477  VRFHNEFMAKYKD  489



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   283 bits (723),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N +EI++FC +E LVLL DEVYQ+NIY D + F S +K+   MG    K++
Sbjct  275  PTGQVLAEENQREIVEFCKKEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYG-EKDI  333

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  334  SLVSFQSVSKGYHGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNP  393

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +A
Sbjct  394  PKVGDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKA  453

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  454  IEAAKAVNVAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISHL  513

Query  260  KKFNDEFMDQYED  222
            K F++ FM+++ D
Sbjct  514  KAFHESFMEEFHD  526



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   281 bits (719),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L E    E+++FC  E LVLL DEVYQ+NIY   +   S +K+   MG    ++L
Sbjct  231  PTGQVLDEQQQYELVKFCKDEGLVLLADEVYQENIYVTNKKINSFKKIARSMGYN-EEDL  289

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVSFH+VSKGY+GECG+RGGY E+T       E++YK+AS++L  N+ GQI   L++NP
Sbjct  290  QLVSFHSVSKGYYGECGKRGGYMEVTGFSAPVREQLYKIASVNLCSNITGQILSSLIMNP  349

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SYD ++ E  GIL+SL +RA+ M   FNS   + CN TEGAMY FPQI LP +A
Sbjct  350  PKAGDGSYDLYMEEKDGILKSLARRAKAMESAFNSIDGITCNKTEGAMYLFPQIYLPHKA  409

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ + KAPD +Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F
Sbjct  410  IEAARAVNKAPDAFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMIARF  469

Query  260  KKFNDEFMDQYED  222
            ++F++EFM QY D
Sbjct  470  REFHEEFMAQYRD  482



>gb|EIE85592.1| hypothetical protein RO3G_10302 [Rhizopus delemar RA 99-880]
Length=475

 Score =   281 bits (718),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 176/254 (69%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDE-RPFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+++I+ FC+ E +VLL DEVYQ NIYQ E RPF S +KVL  MGP   +E
Sbjct  223  PTGQCLSEENMRDIIDFCHTERIVLLADEVYQTNIYQPEHRPFHSFKKVLKSMGPEY-QE  281

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH++SKG  GECG+RGGYFE  +I P  ++++YK++S+SL PN+ GQI + LM N
Sbjct  282  QELFSFHSISKGMIGECGRRGGYFECVHIDPEIMDQLYKISSVSLCPNIHGQIMVDLMTN  341

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GD SY Q+  E   I +SLR+RA  +   FN+   V CN  EGAMY FPQIRLP +
Sbjct  342  PPVEGDASYPQYKEEIDAIYQSLRRRAIKLATCFNNLEGVTCNSAEGAMYLFPQIRLPQK  401

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AI+ A+  G A D YY + +LEATG+  VPGSGFGQ++G +H R+T LP E        S
Sbjct  402  AIKEAEKAGMAADTYYSMAMLEATGVCVVPGSGFGQQQGTYHFRSTFLPEEHLFDTFCSS  461

Query  263  FKKFNDEFMDQYED  222
             + F+ EF+++Y D
Sbjct  462  LEAFHKEFLNKYRD  475



>gb|KFH70378.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=493

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 175/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL+E N++EI+ FC + N++LL DEVYQ NIYQ+ERPF S +KVL  MGP   +  
Sbjct  242  PTGQCLTEENMREIIVFCRKNNVILLADEVYQTNIYQNERPFHSFKKVLKSMGPKY-EGF  300

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +++S+H++SKG  GECG+RGGYFE   +    +E+IYK++SISL PNV GQI + LMVNP
Sbjct  301  EMISYHSISKGMIGECGRRGGYFECEGLDNSVLEQIYKISSISLCPNVQGQIMVDLMVNP  360

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK G+ SY+Q+  E  GI  SL KRA I+   FN+     CN  +GAMY FPQIRLP +A
Sbjct  361  PKQGEPSYEQYKAEFDGIYYSLIKRASILEKTFNALEGCTCNPADGAMYLFPQIRLPKKA  420

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ AQ  GK PD +YC+ +LEATG+  V GSGFGQ EG  H R+T LP  E         
Sbjct  421  IQAAQDAGKEPDQFYCMAMLEATGVCMVAGSGFGQVEGTAHFRSTFLPQPELFEGFCTGI  480

Query  260  KKFNDEFMDQYED  222
            + F+ +FM++Y D
Sbjct  481  RNFHADFMNKYRD  493



>gb|KJE95383.1| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=553

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 184/253 (73%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG  LS  +++ I++ C+RE+LVLL DEVYQ N+YQD+RPF+S RKVL  MGP  S  +
Sbjct  302  PTGGVLSMESMRGIVELCHREHLVLLADEVYQTNVYQDQRPFVSFRKVLKSMGPEFSN-V  360

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+VSKG+ GECG+RGGY EM  I     E+IYKVASISL PNV GQ+ + LMVNP
Sbjct  361  ELISFHSVSKGFIGECGKRGGYMEMIGIDAYVREQIYKVASISLCPNVQGQVIVDLMVNP  420

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK G+ SY+ + RE   IL SL+ R+  + D FN    V C   +GAMY+FPQIRLP +A
Sbjct  421  PKEGEPSYELYARERDQILGSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTFPQIRLPKKA  480

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GKAPD +YC+ LLEATG+S VPG+GF Q+EG +H R T LP ++  PA  ++ 
Sbjct  481  VEAAKAAGKAPDSFYCMALLEATGVSVVPGTGFKQREGTYHFRCTFLPPQDTFPAFTDAI  540

Query  260  KKFNDEFMDQYED  222
             +F++EFM +Y+D
Sbjct  541  VRFHNEFMAKYKD  553



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 188/253 (74%), Gaps = 2/253 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIY-QDERPFLSSRKVLLDMGPPISKE  804
            PTGQCL  AN++EI++FC  +N+VLL DEVYQ+N+Y ++ +PF+S +KV+ DMG   + +
Sbjct  283  PTGQCLDRANMEEIVKFCLEKNVVLLADEVYQENVYVKESKPFISFKKVVKDMGGDYA-D  341

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
            L++VSFH+VSKG+ GECG+RGGY E+  +      EIYK+ASI L PNV GQ+ + LMV 
Sbjct  342  LEMVSFHSVSKGFVGECGKRGGYMELNGVTQDVKAEIYKLASIGLCPNVIGQLVVDLMVR  401

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  G+ S+D +++E   I ESL+KRA ++T+  N+   V CN +EGAMY+FPQIRLP +
Sbjct  402  PPVAGEQSHDLYLKERDNIYESLKKRANLLTNALNNLEGVTCNPSEGAMYAFPQIRLPAK  461

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            A+E A  +GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+EE +  + + 
Sbjct  462  AVEYANSIGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKR  521

Query  263  FKKFNDEFMDQYE  225
               F+  FM++Y+
Sbjct  522  IADFHQSFMNKYK  534



>gb|EPB88721.1| alanine transaminase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=512

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 171/254 (67%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+KEI+QFC+ E +VLL DEVYQ NIYQ ER PF S +KVL  MGP   +E
Sbjct  260  PTGQCLSEDNIKEIIQFCHEERIVLLADEVYQTNIYQPERRPFHSFKKVLKSMGPEY-QE  318

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH+ SKG  GECG+RGGYFE  NI P  +E++YK++SISL PNV GQI + LM N
Sbjct  319  QELFSFHSTSKGMIGECGRRGGYFECVNIDPAIMEQLYKISSISLCPNVHGQIMVDLMTN  378

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GD SY Q+  E   I +SL +RA  +   FN    V CN  EGAMY FPQI LP +
Sbjct  379  PPVEGDESYPQYKAEVDAIFQSLGRRATKLAQCFNGLEGVTCNDAEGAMYLFPQISLPNK  438

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A+  G  PD +Y + +LEATG+  +PGSGFGQ+ G FH R+T LP E        S
Sbjct  439  AIEAAKKEGMTPDSFYAMGMLEATGVCVIPGSGFGQEPGTFHFRSTFLPEENLFDKFCGS  498

Query  263  FKKFNDEFMDQYED  222
             + F+  FMD+Y D
Sbjct  499  LEDFHKSFMDKYRD  512



>emb|CEP13768.1| hypothetical protein [Parasitella parasitica]
Length=510

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 170/254 (67%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+KEI++FC+ E +VLL DEVYQ NIYQ ER PF S +KVL  MGP   +E
Sbjct  258  PTGQCLSEDNIKEIIKFCHEERIVLLADEVYQTNIYQPERRPFHSFKKVLKSMGPEY-QE  316

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH+ SKG  GECG+RGGYFE  NI P  +E++YK++SISL PNV GQI + LM N
Sbjct  317  QELFSFHSTSKGMIGECGRRGGYFECVNIDPAIMEQLYKISSISLCPNVHGQIMVDLMTN  376

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GD+SY Q+  E   I +SL +RA  +   FN    V CN  EGAMY FPQI LP +
Sbjct  377  PPVEGDVSYPQYKAEIDAIFQSLGRRATKLAKCFNGLEGVTCNSAEGAMYLFPQITLPKK  436

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A+  G  PD +Y + +LEATG+  +PGSGFGQ  G FH R+T LP E        S
Sbjct  437  AIEAAEQKGMTPDSFYAMGMLEATGVCVIPGSGFGQAPGTFHFRSTFLPEENLFDKFCGS  496

Query  263  FKKFNDEFMDQYED  222
             + F+  FM+ Y D
Sbjct  497  LEDFHKSFMNNYRD  510



>gb|EEE58449.1| hypothetical protein OsJ_09677 [Oryza sativa Japonica Group]
Length=254

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 172/252 (68%), Gaps = 1/252 (0%)
 Frame = -1

Query  977  TGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQ  798
            T Q L E    E+++FC  E LVLL DEVYQ+NIY   +   S +K+   MG     +LQ
Sbjct  4    TNQILDEQQQYELVKFCKDEELVLLADEVYQENIYVTNKKINSFKKIARSMGYN-GDDLQ  62

Query  797  LVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPP  618
            LVS H+VSKGY+GECG+RGGY E+T       E++YK+AS++L  N+ GQI   L+++PP
Sbjct  63   LVSLHSVSKGYYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDPP  122

Query  617  KPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI  438
            K GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AI
Sbjct  123  KAGDASYDLYEEEKDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAI  182

Query  437  ETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFK  258
            E A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F+
Sbjct  183  EAARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFR  242

Query  257  KFNDEFMDQYED  222
            +F++EFM QY D
Sbjct  243  EFHEEFMSQYRD  254



>gb|ETI43741.1| hypothetical protein F443_11357 [Phytophthora parasitica P1569]
Length=491

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 185/254 (73%), Gaps = 1/254 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+KEI++FC +EN+++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  234  PTGQCLSEKNIKEIIKFCKKENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  292

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  293  ELISFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNP  352

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY +++ +  G L SL++RA  +   FN+   + CN TEGA+Y+FP I LP +A
Sbjct  353  PQPGDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGITCNETEGALYTFPSISLPAKA  412

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H R+TILP EE +  ++E  
Sbjct  413  VEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKT  472

Query  260  KKFNDEFMDQYEDH  219
             KF+ +FMD+Y ++
Sbjct  473  AKFHAKFMDKYREN  486



>emb|CEG73189.1| Putative Alanine transaminase [Rhizopus microsporus]
 emb|CEI95194.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=490

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 181/253 (72%), Gaps = 2/253 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMG-PPISK  807
            PTGQCL+  N++EI+ FCY++ +VLL DEVYQ NIYQ +ERPF+S +K L+D   P + +
Sbjct  237  PTGQCLTAKNMEEIVSFCYQQRIVLLADEVYQTNIYQPEERPFVSFKKALMDHPIPEVRE  296

Query  806  ELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMV  627
             L+LVSFH++SKG  GECG+RGGYFE  N+  + +E+IYK+AS+SL PNV GQI + LM 
Sbjct  297  SLELVSFHSISKGMIGECGRRGGYFECVNLDSQVLEQIYKMASVSLCPNVHGQILVDLMC  356

Query  626  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  447
            NPPKPGD SY+ + +E + I ESLR+R++ +   FN    V C   +G+MY FPQI LP 
Sbjct  357  NPPKPGDPSYESYKQEIESIYESLRRRSKKLEQVFNRMEGVTCQPAQGSMYLFPQITLPS  416

Query  446  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  267
            +A+E A+ L  A D YY L +LEATG+  +PGSGFGQKEG +H R+T LP E        
Sbjct  417  KAVEKAKELDMAADAYYSLAMLEATGVCVIPGSGFGQKEGTWHFRSTFLPEEHLFDEFCG  476

Query  266  SFKKFNDEFMDQY  228
            + +KF+ +F++++
Sbjct  477  ALEKFHKDFIEKH  489



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   279 bits (713),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 176/251 (70%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ   E NL+E+++  + E LVL+ DEVYQ NIY D RPF+S +KVL +MG P +  +
Sbjct  235  PTGQIAHEDNLRELIKLAHEEGLVLMADEVYQPNIYVD-RPFVSCKKVLREMGEPYAHGV  293

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFHTVSKG  GECG RGGY E  N  P ++ ++YK+ASI+L PN  GQ  +GL VNP
Sbjct  294  ELASFHTVSKGVTGECGLRGGYVEWVNFHPDTIAQLYKIASINLCPNTVGQACVGLAVNP  353

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P  G  +  +   E++ I ES+++RA  +T  FN+   V CN TEGAMY+FP++ LPP+A
Sbjct  354  PSQGTKAGKEHATETRAIHESMQRRAAKVTAAFNALPGVTCNPTEGAMYAFPRLHLPPKA  413

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  GKAPD +YCL LL+ TGI TVPG+GFGQ +G +H+RTTILP E+ +      F
Sbjct  414  VEAARAAGKAPDTFYCLALLDYTGIVTVPGTGFGQVDGTWHMRTTILPQEDVLDDFCNRF  473

Query  260  KKFNDEFMDQY  228
             +F+ +FMD+Y
Sbjct  474  AEFHQQFMDKY  484



>emb|CEI91975.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=490

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 181/253 (72%), Gaps = 2/253 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMG-PPISK  807
            PTGQCL+  N++EI+ FCY++ +VLL DEVYQ NIY+ +ERPF+S +K L+D   P + +
Sbjct  237  PTGQCLTAKNMEEIVSFCYQQRIVLLADEVYQTNIYEPEERPFVSFKKALMDHPIPEVRE  296

Query  806  ELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMV  627
             L+LVSFH++SKG  GECG+RGGYFE  N+  + +E+IYK+AS+SL PNV GQI + LM 
Sbjct  297  SLELVSFHSISKGMIGECGRRGGYFECVNLDSQVLEQIYKMASVSLCPNVHGQILVDLMC  356

Query  626  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  447
            NPPKPGD SY+ + +E + I ESLR+R++ +   FN    V C   +G+MY FPQI LP 
Sbjct  357  NPPKPGDPSYESYKQEIESIYESLRRRSKKLEQVFNRMEGVTCQPAQGSMYLFPQITLPS  416

Query  446  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  267
            +A+E A+ L  A D YY L +LEATG+  +PGSGFGQKEG +H R+T LP E        
Sbjct  417  KAVEKAKELDMAADAYYSLAMLEATGVCVIPGSGFGQKEGTWHFRSTFLPEEHLFDEFCS  476

Query  266  SFKKFNDEFMDQY  228
            + +KF+ +F++++
Sbjct  477  ALEKFHKDFIEKH  489



>emb|CCA27196.1| unnamed protein product [Albugo laibachii Nc14]
Length=504

 Score =   279 bits (713),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 179/251 (71%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+ +++QFC + ++++L DEVYQ+N+Y DE+ F+S +KVL D+G   +  +
Sbjct  254  PTGQCLSENNIVQVIQFCQKHDILILADEVYQENVYADEKRFVSFKKVLRDLGSAYNN-V  312

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + E++YK+ SI+L  N+ GQ+ +GLMVNP
Sbjct  313  ELISFHSTSKGFTGECGRRGGYMELVNISECAREQLYKLMSINLCSNIEGQLMVGLMVNP  372

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY ++  +   IL SL++RA  +   FN    V CN TEGA+Y+FP+IRL   A
Sbjct  373  PKTGDASYQKYCHQRDSILASLKRRALKLVAAFNKLEGVTCNATEGALYTFPRIRLSENA  432

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A     APD YYC+++L+ TGI  VPGSGFGQ++G FH R+TILP E+++  ++   
Sbjct  433  VQAAAKSSMAPDTYYCIQMLDKTGIVVVPGSGFGQRDGTFHFRSTILPPEDEVNEVIAKM  492

Query  260  KKFNDEFMDQY  228
              F+ EFM+ +
Sbjct  493  STFHLEFMNSH  503



>gb|ETK88933.1| hypothetical protein L915_06890 [Phytophthora parasitica]
Length=266

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS   +KEI++FC  EN+++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  9    PTGQCLSADAIKEIIKFCKEENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  67

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  68   ELISFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNP  127

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+ GD SY +++ +  G L SL++RA  +   FN+   V CN TEGA+Y+FP I LP +A
Sbjct  128  PQSGDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGVTCNETEGALYTFPSISLPAKA  187

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H R+TILP EE +  ++E  
Sbjct  188  VEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKT  247

Query  260  KKFNDEFMDQYEDH  219
             KF+ +FMD+Y ++
Sbjct  248  AKFHAKFMDKYREN  261



>gb|KDO24164.1| hypothetical protein SPRG_10592 [Saprolegnia parasitica CBS 223.65]
Length=489

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 175/251 (70%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+++I+QFC  E LVL+ DEVYQ+N+Y + + F+S +KVL DMG      +
Sbjct  239  PTGQCLSENNMRDIVQFCKDEKLVLMADEVYQENVYAENKHFVSFKKVLKDMGSDYDC-V  297

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH+ SKG+ GECG+RGGY E+ N    ++E++YK+ SI+L  N+ GQ+ + LM NP
Sbjct  298  ELASFHSTSKGFTGECGRRGGYMELVNFNADAMEQLYKLVSINLCSNIEGQLMVALMTNP  357

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P  GD SY+ +V +  GIL SL++RA  +   FN    V CN  EGAMY+FP+I +P +A
Sbjct  358  PVEGDESYELYVAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKA  417

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A   G APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E  
Sbjct  418  VAEATKRGVAPDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKT  477

Query  260  KKFNDEFMDQY  228
             KF+ EFMD Y
Sbjct  478  AKFHAEFMDLY  488



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N KEI++FC  E LVLL DEVYQ+NIY D++ F S +K+   MG    ++L
Sbjct  272  PTGQVLAEENQKEIVEFCKNERLVLLADEVYQENIYVDDKKFNSFKKIARSMGYG-DEDL  330

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  331  PLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMNP  390

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +A
Sbjct  391  PKVGDESYESFDAEKTGILSSLARRAKALEDAFNGLEEVTCNKAEGAMYLFPRLHLPKKA  450

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   
Sbjct  451  IEAAKAVKAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPHEDKIPAIISRL  510

Query  260  KKFNDEFMDQYED  222
            K F++ FM+++ D
Sbjct  511  KAFHEAFMEEFRD  523



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N +EI+QFC +E LVLL DEVYQ+NIY + + F S +K+   MG    K+L
Sbjct  224  PTGQVLAEGNQREIVQFCKKEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDL  282

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++N 
Sbjct  283  SLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNT  342

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +A
Sbjct  343  PKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKA  402

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   
Sbjct  403  IEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARL  462

Query  260  KKFNDEFMDQYED  222
            K F++ F+ ++ D
Sbjct  463  KAFHESFLGEFRD  475



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N +EI++FC +E LVLL DEVYQ+NIY + + F S +K+   MG    K+L
Sbjct  279  PTGQVLAEENQREIVEFCKKEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDL  337

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  338  SLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNP  397

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +A
Sbjct  398  PKVGDESYESFAAEKNGILSSLARRAKALEDAFNGLVGVTCNKAEGAMYLFPRLHLPQKA  457

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  458  IEAAKAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIARL  517

Query  260  KKFNDEFMDQYED  222
            K F++ FM ++ D
Sbjct  518  KAFHESFMGEFRD  530



>ref|XP_002969652.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
 gb|EFJ29740.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
Length=503

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE N K+I+QFC  E L+LL DEVYQ+NIY + + F S +KV   MG     +L
Sbjct  252  PTGQVLSEENQKKIIQFCKDERLLLLADEVYQENIYAEGKKFQSFKKVARSMGLG-ENDL  310

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             +VSFH+VSKGY+GECG+RGGY E+T +     E+IYK+AS++L  N+ GQI + L+ NP
Sbjct  311  SIVSFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVSNP  370

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA
Sbjct  371  PKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERA  430

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++   
Sbjct  431  LKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRL  490

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  491  TSFHQRFMDEFRD  503



>ref|XP_002970914.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
 gb|EFJ28240.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
Length=503

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE N K+I+QFC  E L+LL DEVYQ+NIY + + F S +KV   MG     +L
Sbjct  252  PTGQVLSEENQKKIIQFCKDERLLLLADEVYQENIYAEGKKFQSFKKVARSMGLG-ENDL  310

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             +VSFH+VSKGY+GECG+RGGY E+T +     E+IYK+AS++L  N+ GQI + L+ NP
Sbjct  311  SIVSFHSVSKGYYGECGRRGGYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVSNP  370

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA
Sbjct  371  PKAGDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERA  430

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            ++ A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++   
Sbjct  431  LKAAAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRL  490

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  491  TSFHQRFMDEFRD  503



>gb|ERM96039.1| hypothetical protein AMTR_s00129p00080070 [Amborella trichopoda]
Length=405

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+EAN +EI++FC++E LVLL DEVYQ+NIY D++ F S +K+   MG    +++
Sbjct  154  PTGQVLAEANQREIVEFCHKEGLVLLADEVYQENIYVDDKKFDSFKKISRSMGYG-EEDI  212

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++P
Sbjct  213  ALVSFQSVSKGYYGECGKRGGYMEVTGFSRDVKEQIYKVASVNLCSNISGQILASLVMSP  272

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD S++ F  E  GIL SL +RA+ +   FNS   V CN  EGAMY FP++ LP +A
Sbjct  273  PKPGDESFESFTAERDGILSSLARRAKALEKAFNSLEGVTCNRAEGAMYLFPRLHLPAKA  332

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ L  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ + A++  F
Sbjct  333  IKAAEALNVAPDAYYTHRLLDATGIVAVPGSGFGQVPGTWHVRYTILPQEDKIAAVVSKF  392

Query  260  KKFNDEFMDQYED  222
              F++  + ++ D
Sbjct  393  TAFHEALIAEFRD  405



>ref|XP_002887430.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63689.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 175/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC +E LVLL DEVYQ+N+Y  ++ F S +KV   +G    K++
Sbjct  284  PTGQVLAEDNQRDIVNFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDI  342

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++P
Sbjct  343  SLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSP  402

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD ++ E  GIL S+ KRA+ + DG NS   V CN  EGAMY FP+I LP +A
Sbjct  403  PKPGDDSYDSYMAERDGILSSMAKRAKTLEDGLNSLEGVTCNRAEGAMYLFPRINLPQKA  462

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  463  IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQAPGTWHFRCTILPQEDKIPAIVNRL  522

Query  260  KKFNDEFMDQYED  222
             +F+  FMD++ D
Sbjct  523  TEFHKSFMDEFRD  535



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 176/251 (70%), Gaps = 4/251 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE N+++I+ FC  E LVL+ DEVYQ+N+Y  ++ F+S +KVL DM    + ++
Sbjct  239  PTGQILSEDNMRDIITFCKEEKLVLMADEVYQENVYASDKHFVSFKKVLRDM----NSDV  294

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH+ SKG+ GECG+RGGY E+ N     +EE+YK+ SI+L  N+ GQ+ + LM NP
Sbjct  295  ELASFHSTSKGFTGECGRRGGYMELVNFDHDVMEELYKLVSINLCSNIEGQLMVALMTNP  354

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD +V +   I+ SL++RA  +   FN    V CN TEGAMY+FP+I +P +A
Sbjct  355  PKPGDASYDLYVSQRDEIVNSLKRRALKLVASFNELEGVTCNATEGAMYTFPRITVPAKA  414

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A+ +G+APD +Y   LL ATGI  VPGSGFGQ++G FH R+TILP EE +  ++   
Sbjct  415  VAEAKKVGQAPDAFYAFALLNATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIAKT  474

Query  260  KKFNDEFMDQY  228
             KF+ +FM++Y
Sbjct  475  AKFHADFMNKY  485



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N +EI++FC +E LVLL DEVYQ+NIY + + F S +K+   MG    +++
Sbjct  275  PTGQVLAEENQREIVEFCKKEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EQDI  333

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++N 
Sbjct  334  SLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNT  393

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +A
Sbjct  394  PKVGDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKA  453

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  454  IEAAKVVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRL  513

Query  260  KKFNDEFMDQYED  222
            K F++ FM+++ D
Sbjct  514  KAFHESFMEEFHD  526



>dbj|GAN09782.1| alanine transaminase [Mucor ambiguus]
Length=512

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 171/254 (67%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+KEI++FC+ E +VLL DEVYQ NIYQ ER PF S +KVL  MGP   +E
Sbjct  260  PTGQCLSEENIKEIIRFCHEERIVLLADEVYQTNIYQPERRPFHSFKKVLKSMGPEY-QE  318

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH+ SKG  GECG+RGGYFE  NI P  +E++YK++SISL PNV GQI + LM N
Sbjct  319  QELFSFHSTSKGMIGECGRRGGYFECVNIDPAIMEQLYKISSISLCPNVHGQIMVDLMTN  378

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GD SY Q+  E   I +SL +RA  +   FN    V CN  EGAMY FPQI LP +
Sbjct  379  PPVEGDESYPQYKAEVDAIFQSLGRRATKLAQCFNGLEGVTCNDAEGAMYLFPQITLPNK  438

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A+  G  PD +Y + +LEATG+  +PGSGFGQ+ G FH R+T LP E        S
Sbjct  439  AIEAAKKDGMTPDSFYAMGMLEATGVCVIPGSGFGQEPGTFHFRSTFLPEENLFDKFCGS  498

Query  263  FKKFNDEFMDQYED  222
             + F+  FM++Y D
Sbjct  499  LEDFHKSFMNKYRD  512



>gb|KJB68682.1| hypothetical protein B456_011G0552001 [Gossypium raimondii]
Length=329

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 171/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K I++FC  E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  78   PTGQVLAEENQKAIVEFCKEEGLVLLADEVYQENVYVPEKKFHSFKKVARSMGYG-EKDI  136

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+++P
Sbjct  137  HLVSFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSP  196

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +A
Sbjct  197  PKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKA  256

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+   
Sbjct  257  IKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRL  316

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  317  TDFHKRFMDEFRD  329



>gb|KJB68683.1| hypothetical protein B456_011G0552001, partial [Gossypium raimondii]
Length=331

 Score =   271 bits (693),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 171/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K I++FC  E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  80   PTGQVLAEENQKAIVEFCKEEGLVLLADEVYQENVYVPEKKFHSFKKVARSMGYG-EKDI  138

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+++P
Sbjct  139  HLVSFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSP  198

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +A
Sbjct  199  PKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKA  258

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+   
Sbjct  259  IKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRL  318

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  319  TDFHKRFMDEFRD  331



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N +EI+QFC +E LVLL DEVYQ+NIY + + F S +K+   MG    K+L
Sbjct  267  PTGQVLAEGNQREIVQFCKKEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDL  325

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L++N 
Sbjct  326  SLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNT  385

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +A
Sbjct  386  PKVGDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKA  445

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   
Sbjct  446  IEAANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARL  505

Query  260  KKFNDEFMDQYED  222
            K F++ F+ ++ D
Sbjct  506  KAFHESFLGEFRD  518



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score =   276 bits (705),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 176/251 (70%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG+ L+EAN +EI++FC++E LVLL DEVYQ+N+Y  ++ F S +K+   MG    K++
Sbjct  236  PTGRVLAEANQQEIVEFCWKEGLVLLADEVYQENVYAPDKQFHSFKKISRSMGFG-EKDI  294

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSFH+ SKGY+GECG+RGGY E T   P   E+IYKVAS++L  N+ GQI   L++ P
Sbjct  295  SLVSFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKVASVNLCSNISGQILASLIMIP  354

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E + IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +A
Sbjct  355  PKVGDESYESFSAEKEAILSSLARRAKILEDAFNSLEGVTCYNAEGALYSFPRINLPDKA  414

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F
Sbjct  415  IKAAEEAKTAPDAFYAWRLLNATGIVIVLGSGFGQRPGTWHFRCTILPQEEKIPAIVSRF  474

Query  260  KKFNDEFMDQY  228
             +F+ +FMD++
Sbjct  475  TQFHKQFMDEF  485



>ref|XP_009515714.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
 gb|EGZ28439.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
Length=492

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 184/253 (73%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS  N++ I++FC  EN+++L DEVYQ+N+Y + + F+S +KVL DMG     ++
Sbjct  235  PTGQCLSVENIEAIIKFCKDENILILADEVYQENVYAEGKKFVSFKKVLRDMGKAYD-DV  293

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  NV GQ+ +G+M NP
Sbjct  294  ELISFHSTSKGFTGECGRRGGYMELVNIDDGAKDQFYKLMSVNLCSNVEGQLMVGMMTNP  353

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY++++ +  G LE+L++RA  +   FN    V CN TEGAMY+FP+I +P +A
Sbjct  354  PQPGDASYERYIEQRDGTLEALKRRAVKLVKAFNELEGVTCNETEGAMYTFPKITIPAKA  413

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H R+TILP EE +  ++E  
Sbjct  414  VEAAKAAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRSTILPPEEAVDEVIEKT  473

Query  260  KKFNDEFMDQYED  222
             KF+  FMD+Y +
Sbjct  474  VKFHANFMDKYRE  486



>ref|XP_006342897.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=545

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 177/251 (71%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+EAN +EI++FC +E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  294  PTGQVLAEANQREIVEFCKKEGLVLLADEVYQENVYVPEKQFHSFKKVARSMGFG-EKDI  352

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKG++GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++P
Sbjct  353  SLVSFQSVSKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSP  412

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E +GIL SL +RA+ + D F++   V CN  EGAMY FP+I LP +A
Sbjct  413  PKVGDESYESFAAEKEGILSSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLPNKA  472

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +Y  +LL ATGI  VPGSGFGQ+ G +H R TILP EE +PAI+   
Sbjct  473  IKAAEEAKTAPDAFYARRLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSRL  532

Query  260  KKFNDEFMDQY  228
             +F+ +FMD++
Sbjct  533  TEFHKQFMDEF  543



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 175/251 (70%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG+ L+EAN +EI++FC +E LVLL DEVYQ+N+Y  ++ F S +K+   MG    K++
Sbjct  236  PTGRVLAEANQREIVEFCRKEGLVLLADEVYQENVYAPDKQFHSFKKISRSMGFG-EKDI  294

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSFH+ SKGY+GECG+RGGY E T   P   E+IYK+AS++L  N+ GQI   L+++P
Sbjct  295  SLVSFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLIMSP  354

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +A
Sbjct  355  PKVGDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKA  414

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F
Sbjct  415  IKAAEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRF  474

Query  260  KKFNDEFMDQY  228
             +F+ +FMD++
Sbjct  475  TQFHKQFMDEF  485



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 175/251 (70%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG+ L+EAN +EI++FC +E LVLL DEVYQ+N+Y  ++ F S +K+   MG    K++
Sbjct  233  PTGRVLAEANQREIVEFCRKEGLVLLADEVYQENVYAPDKQFHSFKKISRSMGFG-EKDI  291

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSFH+ SKGY+GECG+RGGY E T   P   E+IYK+AS++L  N+ GQI   L+++P
Sbjct  292  SLVSFHSASKGYYGECGKRGGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLIMSP  351

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +A
Sbjct  352  PKVGDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKA  411

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F
Sbjct  412  IKAAEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRF  471

Query  260  KKFNDEFMDQY  228
             +F+ +FMD++
Sbjct  472  TQFHKQFMDEF  482



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 173/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+N+Y D + F S +K+   MG    ++L
Sbjct  236  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENVYVDNKKFNSFKKIARSMGYG-EEDL  294

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF ++SKGY GECG+RGGY E+T       E+ YKVAS++L  N+ GQI   L++NP
Sbjct  295  YLVSFQSISKGYHGECGKRGGYMEVTGFSAEVREQFYKVASVNLCSNISGQIIASLVMNP  354

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY  F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +A
Sbjct  355  PKVGDESYKSFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKA  414

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  APD  Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   
Sbjct  415  IDAAKAVIAAPDTLYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPQEDKIPAIISRL  474

Query  260  KKFNDEFMDQYED  222
            K F++ FMD++ D
Sbjct  475  KAFHEAFMDEFRD  487



>gb|AAM22749.1| alanine aminotransferase [Deschampsia antarctica]
Length=147

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -1

Query  650  QIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  471
            QIF+GLMVNPPKPGDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  1    QIFMGLMVNPPKPGDISYLKYATESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  60

Query  470  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  291
            FPQIRLP RA++TA+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  61   FPQIRLPQRAMDTAKSAGKAPDVFYCLMLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  120

Query  290  EDMPAIMESFKKFNDEFMDQYEDH  219
            EDMPAIM SFKKFND FM+QY+D+
Sbjct  121  EDMPAIMSSFKKFNDSFMEQYQDY  144



>ref|XP_010230121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Brachypodium distachyon]
Length=164

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  710  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVRESKGILESLRKRARIMT  531
            ++V+EIYKVASI+LSPNVPGQIF+GLM+N PKPGDISY +F  ESK IL+SLR+RA+IMT
Sbjct  4    QTVDEIYKVASIALSPNVPGQIFMGLMMNHPKPGDISYLKFATESKSILDSLRRRAQIMT  63

Query  530  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  351
            DGFNSC+NVVCNFTEGAMYS+ QI LP RAI+TA+  GK PDV+YCLKLLEAT ISTVPG
Sbjct  64   DGFNSCQNVVCNFTEGAMYSYFQICLPKRAIDTAKSAGKEPDVFYCLKLLEATRISTVPG  123

Query  350  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  249
            SGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFN
Sbjct  124  SGFGQKEGVFHLRTTILPAEEDMPAIMLSFKKFN  157



>emb|CEG76882.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=512

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 173/254 (68%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+++I+ FC+ E +VLL DEVYQ NIYQ ER PF S +KVL  MGP   +E
Sbjct  260  PTGQCLSEENMRDIIDFCHTERIVLLADEVYQTNIYQPERRPFHSFKKVLKSMGPEY-QE  318

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH++SKG  GECG+RGGYFE  NI P  ++++YK++S+SL PN+ GQI + LM N
Sbjct  319  QELFSFHSISKGMIGECGRRGGYFECVNIDPDIMDQLYKISSVSLCPNIHGQIMVDLMTN  378

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GD+SY Q+  E   I ESLR+RA  +   FN    V CN  EGAMY FP+IRLP +
Sbjct  379  PPVEGDVSYPQYKAEVNAIYESLRRRAIKLASCFNKLEGVTCNNAEGAMYLFPRIRLPEK  438

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AI+ A+  G   D +Y L +L+ATG+  VPGSGFGQ+ G +H R+T LP E         
Sbjct  439  AIKEAEKAGMPADAFYSLAMLDATGVCVVPGSGFGQEPGTYHFRSTFLPEEHLFDQFCSK  498

Query  263  FKKFNDEFMDQYED  222
             + F+++FM +Y D
Sbjct  499  LETFHNDFMKKYRD  512



>gb|EEC74641.1| hypothetical protein OsI_10280 [Oryza sativa Indica Group]
Length=494

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L E    E+++FC  E LVLL DEVYQ+NIY   +   S +K+   MG     +L
Sbjct  243  PTGQILDEQQQYELVKFCKDEELVLLADEVYQENIYVTNKKINSFKKIARSMGYN-GDDL  301

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            QLVS H+VSKGY+GECG+RGGY E+T       E++YK+AS++L  N+ GQI   L+++P
Sbjct  302  QLVSLHSVSKGYYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDP  361

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +A
Sbjct  362  PKAGDASYDLYEEERDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKA  421

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F
Sbjct  422  IEAARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRF  481

Query  260  KKFNDEFMDQYED  222
            ++F++EFM QY D
Sbjct  482  REFHEEFMSQYRD  494



>gb|ADE77246.1| unknown [Picea sitchensis]
Length=329

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LS+ N +EI+QFC  E LVLL DEVYQ+N+Y D + F S +K+   MG    K++
Sbjct  78   PTGQVLSKENQEEIVQFCKNEGLVLLADEVYQENVYVDNKKFHSFKKIARSMGYG-EKDI  136

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       +++YKVAS++L  N+ GQI   L++NP
Sbjct  137  CLVSFQSVSKGYYGECGRRGGYMEVTGFDNNIKDQLYKVASVNLCSNISGQILASLVMNP  196

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ F  E  GIL SL +RA+ + D  N    V CN  EGAMY FP+I LP +A
Sbjct  197  PKSGDESFEMFFAERDGILSSLARRAKTLVDALNQLEGVTCNEAEGAMYVFPRIHLPQQA  256

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +   PD +Y  +LLEATGI TVPGSGFGQ  G +H R+TILP E+ +P I+   
Sbjct  257  IKAAEAVNMVPDAFYSQRLLEATGIVTVPGSGFGQVPGTWHFRSTILPPEDKIPTIVSRM  316

Query  260  KKFNDEFMDQYED  222
              F+ +FM+++ D
Sbjct  317  TTFHQKFMEEFHD  329



>ref|XP_010235387.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Brachypodium 
distachyon]
Length=514

 Score =   274 bits (701),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  202  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKQFHSFKKIARSMGY-TDDDL  260

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  261  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVMNP  320

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  321  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKA  380

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  381  IGAAQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRF  440

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD+Y +
Sbjct  441  KEFHEKFMDEYRE  453



>ref|XP_004342401.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR20285.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=514

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 176/253 (70%), Gaps = 6/253 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL+E+N++E++ FC R  +VLL DE    N Y   +P+LS +KVL DMGP   K++
Sbjct  268  PTGQCLAESNMQEVIDFCRRRGIVLLADET---NAYT--KPWLSFKKVLRDMGPKY-KDV  321

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+VSKG  GECG RGG+ E+  I     ++ YK+ASISL PN+PGQ+ + LMV P
Sbjct  322  ELISFHSVSKGVIGECGHRGGFMELVGIDEEVKQQFYKLASISLCPNLPGQVVVDLMVRP  381

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P  G+ SYD + +E+ GI ESL++RA  +T+ FN    V CN  EGAMY FP++RLP +A
Sbjct  382  PVAGEPSYDLYHQETTGIFESLKRRALRLTEAFNKLEGVTCNEAEGAMYLFPRVRLPAKA  441

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A    K PD +YCL LL+ TGI  VPGSGFGQK+G +H RTT LP E+ + A+ +S 
Sbjct  442  VHEAVKQKKTPDSFYCLALLDQTGICVVPGSGFGQKDGTYHFRTTFLPPEDKIDAVAKSI  501

Query  260  KKFNDEFMDQYED  222
             KF+ +FM +Y D
Sbjct  502  AKFHHDFMQKYRD  514



>gb|AET06148.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=484

 Score =   273 bits (698),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 173/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N + I++FC +ENLVLL DEVYQ+N+Y +++ F S +KV   MG    K++
Sbjct  233  PTGQVLAEENQRAIVEFCKKENLVLLADEVYQENVYVEDKSFHSFKKVARSMGYG-EKDI  291

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NP
Sbjct  292  SLVSFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMNP  351

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ +  E  GIL SL +RA+ + D FN+   V CN  EGAMY FP+I L  +A
Sbjct  352  PKVGDESFESYSAEKNGILSSLARRAKALEDAFNNLEGVTCNKAEGAMYLFPRIHLSQKA  411

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +Y  +LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+   
Sbjct  412  IKAAETAKTAPDAFYAKRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRL  471

Query  260  KKFNDEFMDQYED  222
              F+  FM ++ D
Sbjct  472  TDFHQAFMAEFRD  484



>gb|EPS60556.1| hypothetical protein M569_14246, partial [Genlisea aurea]
Length=491

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 169/251 (67%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE N KEI+ FC +ENLVLL DEVYQ+NIY  ++ F S +KV   +G     +L
Sbjct  241  PTGQVLSEGNQKEIVHFCKKENLVLLADEVYQENIYVSDKQFHSFKKVARSLGFG-ETDL  299

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   ++IYKVAS++L  N+ GQI   L+++P
Sbjct  300  SLVSFQSVSKGYYGECGKRGGYMEITGFSPEIRDQIYKVASVNLCSNISGQILASLVMSP  359

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +  E   IL SL +RA+ + D  N    V CN  EGAMY FP+I LP +A
Sbjct  360  PKVGDESYESYFAEKDAILSSLARRAKTLEDALNGLEGVTCNRAEGAMYLFPRIELPKKA  419

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +  APD +Y   LL ATGI  VPGSGFGQ  G +H R TILP EE +PAI+   
Sbjct  420  IEAAKAVDTAPDAFYARLLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVNRL  479

Query  260  KKFNDEFMDQY  228
             +F+  FMD+Y
Sbjct  480  TEFHQGFMDEY  490



>gb|AAK59591.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=532

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC +E LVLL DEVYQ+N+Y  ++ F S +KV   +G    K++
Sbjct  281  PTGQVLAEENQRDIVNFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDI  339

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++P
Sbjct  340  SLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSP  399

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  400  PKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKA  459

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  460  IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRL  519

Query  260  KKFNDEFMDQYED  222
             +F+  FMD++ +
Sbjct  520  TEFHKSFMDEFRN  532



>ref|XP_011628485.1| PREDICTED: alanine aminotransferase 2 [Amborella trichopoda]
Length=549

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+EAN +EI++FC++E LVLL DEVYQ+NIY D++ F S +K+   MG    +++
Sbjct  298  PTGQVLAEANQREIVEFCHKEGLVLLADEVYQENIYVDDKKFDSFKKISRSMGYG-EEDI  356

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++P
Sbjct  357  ALVSFQSVSKGYYGECGKRGGYMEVTGFSRDVKEQIYKVASVNLCSNISGQILASLVMSP  416

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD S++ F  E  GIL SL +RA+ +   FNS   V CN  EGAMY FP++ LP +A
Sbjct  417  PKPGDESFESFTAERDGILSSLARRAKALEKAFNSLEGVTCNRAEGAMYLFPRLHLPAKA  476

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ L  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ + A++  F
Sbjct  477  IKAAEALNVAPDAYYTHRLLDATGIVAVPGSGFGQVPGTWHVRYTILPQEDKIAAVVSKF  536

Query  260  KKFNDEFMDQYED  222
              F++  + ++ D
Sbjct  537  TAFHEALIAEFRD  549



>ref|NP_001185380.1| alanine aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35307.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=553

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC +E LVLL DEVYQ+N+Y  ++ F S +KV   +G    K++
Sbjct  302  PTGQVLAEENQRDIVNFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDI  360

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++P
Sbjct  361  SLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSP  420

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  421  PKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKA  480

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  481  IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRL  540

Query  260  KKFNDEFMDQYED  222
             +F+  FMD++ +
Sbjct  541  TEFHKSFMDEFRN  553



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N  +I++FC  E LVLL DEVYQ+NIY D + F S +K++  +G    ++L
Sbjct  231  PTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFHSFKKIVRSLGYG-EEDL  289

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVS+ +VSKGY+GECG+RGGYFE+T       E+IYK+AS++L  N+ GQI   L++NP
Sbjct  290  PLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNP  349

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK  D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +A
Sbjct  350  PKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKA  409

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F
Sbjct  410  IEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRF  469

Query  260  KKFNDEFMDQYED  222
              F++ FM +Y D
Sbjct  470  TVFHEAFMSEYRD  482



>ref|XP_008903570.1| hypothetical protein PPTG_10079 [Phytophthora parasitica INRA-310]
 gb|ETN11084.1| hypothetical protein PPTG_10079 [Phytophthora parasitica INRA-310]
Length=491

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 182/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLSE N+KEI++FC  EN+++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  234  PTGQCLSEKNIKEIIKFCKEENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  292

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  293  ELISFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNP  352

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY +++ +  G L SL++RA  +   FN+   + CN TEGA+Y+FP I LP +A
Sbjct  353  PQPGDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGITCNETEGALYTFPSISLPAKA  412

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G AP  +YC+++L+ TGI  VPGSGF QK G +H R+TILP EE +  ++E  
Sbjct  413  VEAAKEAGMAPGAFYCMQMLDETGIVVVPGSGFDQKAGTWHFRSTILPPEEAVDEVIEKT  472

Query  260  KKFNDEFMDQYEDH  219
             KF+ +FMD+Y ++
Sbjct  473  AKFHAKFMDKYREN  486



>ref|NP_565040.2| alanine aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9LDV4.1|ALAT2_ARATH RecName: Full=Alanine aminotransferase 2, mitochondrial; Short=AtAlaAT2; 
Short=AtAlaATm; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82781.1|AF275371_1 alanine aminotransferase [Arabidopsis thaliana]
 gb|AAG52580.1|AC016529_11 putative alanine aminotransferase; 79592-76658 [Arabidopsis thaliana]
 gb|AEE35305.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=540

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC +E LVLL DEVYQ+N+Y  ++ F S +KV   +G    K++
Sbjct  289  PTGQVLAEENQRDIVNFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDI  347

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++P
Sbjct  348  SLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSP  407

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  408  PKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKA  467

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  468  IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRL  527

Query  260  KKFNDEFMDQYED  222
             +F+  FMD++ +
Sbjct  528  TEFHKSFMDEFRN  540



>ref|XP_009515719.1| hypothetical protein PHYSODRAFT_477603 [Phytophthora sojae]
 gb|EGZ28444.1| hypothetical protein PHYSODRAFT_477603 [Phytophthora sojae]
Length=499

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 181/251 (72%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS  N++ I++FC  EN+++L DEVYQ+N+Y + + F+S +KVL DMG     ++
Sbjct  249  PTGQCLSVENIEAIIKFCKDENILILADEVYQENVYAEGKKFVSFKKVLRDMGKAYD-DV  307

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  NV GQ+ +GLM NP
Sbjct  308  ELISFHSTSKGFTGECGRRGGYMELVNIDDGAKDQFYKLMSVNLCSNVEGQLMVGLMTNP  367

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY +++ +  G LE+L++RA  +    N    V CN TEGAMY+FP+I +P +A
Sbjct  368  PQPGDASYKRYIEQRDGTLEALKRRAVKLVKACNELEGVTCNETEGAMYTFPKITIPAKA  427

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H R+TILP EE +  ++E  
Sbjct  428  VEAAKAAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRSTILPPEEAVDEVIEKT  487

Query  260  KKFNDEFMDQY  228
             KF+  FMD+Y
Sbjct  488  VKFHANFMDKY  498



>emb|CEG73119.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=512

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 172/254 (68%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+++I+ FC+ E +VLL DEVYQ NIYQ ER PF S +K+L  MG    +E
Sbjct  260  PTGQCLSEENMRDIIDFCHTERIVLLADEVYQTNIYQPERRPFHSFKKILRSMGAEY-QE  318

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH++SKG  GECG+RGGYFE  NI P  ++++YK++S+SL PN+ GQI + LM N
Sbjct  319  QELFSFHSISKGMIGECGRRGGYFECVNIDPDIMDQLYKISSVSLCPNIHGQIMVDLMTN  378

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GDISY Q+  E   I ESLR+RA  +   FN    V CN  EGAMY FP+IRLP +
Sbjct  379  PPVEGDISYPQYKAEVNAIYESLRRRAIKLASCFNKLEGVTCNDAEGAMYLFPRIRLPEK  438

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AI+ A+  G   D +Y L +L+ATG+  VPGSGFGQ+ G +H R+T LP E         
Sbjct  439  AIKEAEKAGMPADAFYSLAMLDATGVCVVPGSGFGQEPGTYHFRSTFLPEEHLFDQFCSK  498

Query  263  FKKFNDEFMDQYED  222
             + F+++FM +Y D
Sbjct  499  LEAFHNDFMKKYRD  512



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+N+Y  ++ F S +KV   MG    K++
Sbjct  293  PTGQVLAEDNQRQIVEFCKQEGLVLLADEVYQENVYVPDKEFHSFKKVSRSMGYG-EKDI  351

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T I P   E+IYKVAS++L  N+ GQI   L+++P
Sbjct  352  SLVSFQSVSKGYYGECGKRGGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLVMSP  411

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +A
Sbjct  412  PKVGDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKA  471

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  472  IKAAEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRL  531

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  532  TDFHKSFMDEFRD  544



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+N+Y  ++ F S +KV   MG    K++
Sbjct  293  PTGQVLAEDNQRQIVEFCKQEGLVLLADEVYQENVYVPDKEFHSFKKVSRSMGYG-EKDI  351

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T I P   E+IYKVAS++L  N+ GQI   L+++P
Sbjct  352  SLVSFQSVSKGYYGECGKRGGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLVMSP  411

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +A
Sbjct  412  PKVGDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKA  471

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  472  IKAAEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRL  531

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  532  TDFHKSFMDEFRD  544



>emb|CDS14202.1| hypothetical protein LRAMOSA06372 [Absidia idahoensis var. thermophila]
Length=513

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 179/254 (70%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMGPPISKE  804
            PTGQCL+E N++E++ FC++E LVLL DEVYQ NIYQ D+RPF S +KVL  MG    + 
Sbjct  261  PTGQCLTEENMREVIDFCHKERLVLLADEVYQTNIYQPDQRPFHSFKKVLRSMGDKY-QN  319

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
            ++L SFH+ SKG  GECG+RGGY E  NI  + +E++YKVASISL PNV GQ+ + LM N
Sbjct  320  VELFSFHSTSKGMIGECGRRGGYLECVNIDEKVLEQLYKVASISLCPNVHGQVMVDLMTN  379

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PPK GD SY+ + +E   I ESLR+RA  + + FN+  N+ CN  +GAMY FP++RLP +
Sbjct  380  PPKEGDASYESYQKEVGTIYESLRRRATKLANCFNTLENMTCNDAQGAMYLFPRVRLPKK  439

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A+    +PD +Y L++LEATG+  +PGSGFGQ++  +H R+T LP E        +
Sbjct  440  AIEAAKAANMSPDAFYSLQMLEATGVCVIPGSGFGQEKDTWHFRSTFLPEEHLFDQFCTN  499

Query  263  FKKFNDEFMDQYED  222
             +KF+  FMD+Y D
Sbjct  500  IEKFHQSFMDKYRD  513



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 174/253 (69%), Gaps = 2/253 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N  +I++FC  E LVLL DEVYQ+NIY D++ F S +K++  +G    ++L
Sbjct  231  PTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDDKKFHSFKKIVRSLG--YGEDL  288

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVS+ +VSKGY+GECG+RGGY E+T       E+IYK++S++L  N+ GQI   L++NP
Sbjct  289  PLVSYQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKISSVNLCSNITGQILASLVMNP  348

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY  +  E   IL SL +RA+ + D FN+   + CN  EGAMY FP+I LP +A
Sbjct  349  PKAGDESYASYQAEKDRILTSLARRAKALEDAFNNLEGITCNKAEGAMYLFPRINLPQKA  408

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A    KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F
Sbjct  409  IDAANAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRF  468

Query  260  KKFNDEFMDQYED  222
            K F++ FM ++ D
Sbjct  469  KVFHEAFMAEHRD  481



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N  +I++FC  E LVLL DEVYQ+NIY D + F S +K++  +G    ++L
Sbjct  249  PTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFHSFKKIVRSLGYG-EEDL  307

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVS+ +VSKGY+GECG+RGGYFE+T       E+IYK+AS++L  N+ GQI   L++NP
Sbjct  308  PLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNP  367

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK  D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +A
Sbjct  368  PKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKA  427

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F
Sbjct  428  IEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRF  487

Query  260  KKFNDEFMDQYED  222
              F++ FM +Y D
Sbjct  488  TVFHEAFMSEYRD  500



>emb|CEG73120.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=498

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 172/254 (68%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+++I+ FC+ E +VLL DEVYQ NIYQ ER PF S +K+L  MG    +E
Sbjct  246  PTGQCLSEENMRDIIDFCHTERIVLLADEVYQTNIYQPERRPFHSFKKILRSMGAEY-QE  304

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH++SKG  GECG+RGGYFE  NI P  ++++YK++S+SL PN+ GQI + LM N
Sbjct  305  QELFSFHSISKGMIGECGRRGGYFECVNIDPDIMDQLYKISSVSLCPNIHGQIMVDLMTN  364

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GDISY Q+  E   I ESLR+RA  +   FN    V CN  EGAMY FP+IRLP +
Sbjct  365  PPVEGDISYPQYKAEVNAIYESLRRRAIKLASCFNKLEGVTCNDAEGAMYLFPRIRLPEK  424

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AI+ A+  G   D +Y L +L+ATG+  VPGSGFGQ+ G +H R+T LP E         
Sbjct  425  AIKEAEKAGMPADAFYSLAMLDATGVCVVPGSGFGQEPGTYHFRSTFLPEEHLFDQFCSK  484

Query  263  FKKFNDEFMDQYED  222
             + F+++FM +Y D
Sbjct  485  LEAFHNDFMKKYRD  498



>gb|EYU45916.1| hypothetical protein MIMGU_mgv1a005454mg [Erythranthe guttata]
Length=483

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 172/251 (69%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N KEI+ FC RE LVLL DEVYQ+N+Y  ++ F S ++V   MG    K++
Sbjct  232  PTGQVLAEKNQKEIVDFCKREGLVLLADEVYQENVYVPDKQFHSFKEVARSMGYG-DKDI  290

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L++NP
Sbjct  291  ALVSFQSVSKGYYGECGKRGGYMEITGFSPEIREQIYKLASVNLCSNISGQILASLVMNP  350

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SYD +  E   IL SL +RA+ + D FN    V CN  EGAMY FP+I LP +A
Sbjct  351  PKVGDESYDSYFAEKNAILSSLARRAQKLEDAFNGLEGVSCNRAEGAMYLFPRIVLPNKA  410

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+    APD +Y  +LL ATGI  VPGSGFGQ +G +H+R TILP E+ + AI+   
Sbjct  411  LEAAKEAKTAPDAFYARRLLNATGIVVVPGSGFGQVDGTWHIRCTILPQEDRISAIITRL  470

Query  260  KKFNDEFMDQY  228
             KF+ EFMD++
Sbjct  471  TKFHTEFMDEF  481



>emb|CEI94294.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=511

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 172/254 (68%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+++I+ FC+ E +VLL DEVYQ NIYQ ER PF S +KVL  MG    +E
Sbjct  259  PTGQCLSEENMRDIIDFCHTERIVLLADEVYQTNIYQPERRPFHSFKKVLKSMGAEY-QE  317

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH++SKG  GECG+RGGYFE  NI P  ++++YK++S+SL PN+ GQI + LM N
Sbjct  318  QELFSFHSISKGMIGECGRRGGYFECVNIDPDIMDQLYKISSVSLCPNIHGQIMVDLMTN  377

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GD+SY Q+  E   I ESLR+RA  +   FN    V CN  EGAMY FP+IRLP +
Sbjct  378  PPVEGDVSYPQYKAEVDAIYESLRRRAIKLASCFNKLEGVTCNNAEGAMYLFPRIRLPEK  437

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AI+ A+  G   D +Y L +L+ATG+  VPGSGFGQ+ G +H R+T LP E         
Sbjct  438  AIKEAEKAGMPADAFYSLAMLDATGVCVVPGSGFGQEPGTYHFRSTFLPEEHLFDQFCSK  497

Query  263  FKKFNDEFMDQYED  222
             + F+++FM +Y D
Sbjct  498  LETFHNDFMKKYRD  511



>gb|ETP13552.1| hypothetical protein F441_11274 [Phytophthora parasitica CJ01A1]
Length=491

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCLS   +KEI++FC  EN+++L DEVYQ+N+Y + + F S +KVL DMG     ++
Sbjct  234  PTGQCLSADAIKEIIKFCKEENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DV  292

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L+SFH+ SKG+ GECG+RGGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NP
Sbjct  293  ELISFHSTSKGFTGECGRRGGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNP  352

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY +++ +  G L SL++RA  +   FN+   V CN TEGA+Y+FP   LP +A
Sbjct  353  PQPGDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGVTCNETEGALYTFPSTSLPAKA  412

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +E A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H R+TILP EE +  ++E  
Sbjct  413  VEAAKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKT  472

Query  260  KKFNDEFMDQYEDH  219
             KF+ +FMD+Y ++
Sbjct  473  AKFHAKFMDKYREN  486



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+N+Y  ++ F S +KV   MG     ++
Sbjct  290  PTGQVLAEDNQRQIVEFCKQEGLVLLADEVYQENVYVPDKEFHSFKKVTRSMGYG-ENDI  348

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L+++P
Sbjct  349  ALVSFQSVSKGYYGECGKRGGYMEVTGFSPEVREQIYKMASVNLCSNISGQILSSLVMSP  408

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ ++ E  GIL SL++RA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  409  PKVGDESYELYLSEKDGILSSLKRRAKTLEDALNSLEGVTCNRAEGAMYLFPRIELPQKA  468

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA+++  
Sbjct  469  IHAAEAAKTAPDAFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVDRL  528

Query  260  KKFNDEFMDQYED  222
             +F+ +FMD++ D
Sbjct  529  TEFHKKFMDEFRD  541



>ref|XP_011651727.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Cucumis 
sativus]
Length=518

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+NIY  ++ F S +K+   MG   ++++
Sbjct  267  PTGQVLAEDNQRQIVEFCKQEGLVLLADEVYQENIYAPDKKFHSFKKISRSMGYG-NEDI  325

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NP
Sbjct  326  ALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNP  385

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  386  PKVGDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKA  445

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  446  IKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  505

Query  260  KKFNDEFMDQYED  222
             +F+ +FM+++ D
Sbjct  506  TEFHKQFMEEFRD  518



>ref|XP_010235383.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Brachypodium 
distachyon]
Length=599

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I++FC  E LVLL DEVYQ+NIY +++ F S +K+   MG     +L
Sbjct  287  PTGQVLAEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKQFHSFKKIARSMGY-TDDDL  345

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  346  PLVSFQSVSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVMNP  405

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +A
Sbjct  406  PKAGDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKA  465

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  F
Sbjct  466  IGAAQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRF  525

Query  260  KKFNDEFMDQYED  222
            K+F+++FMD+Y +
Sbjct  526  KEFHEKFMDEYRE  538



>gb|KHG30536.1| Alanine aminotransferase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=482

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 171/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K I++FC  E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  231  PTGQVLAEENQKAIVEFCKEEGLVLLADEVYQENVYVPEKKFHSFKKVARSMGYG-EKDI  289

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E IYK+AS++L  N+ GQI   L+++P
Sbjct  290  HLVSFQSVSKGYYGECGKRGGYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSP  349

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +A
Sbjct  350  PKVGDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKA  409

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+   
Sbjct  410  IKAAEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRL  469

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  470  TDFHKRFMDEFRD  482



>ref|XP_010415979.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 174/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC +E LVLL DEVYQ+N+Y  ++ F S +K    +G    K++
Sbjct  297  PTGQVLAEENQRDIVNFCKQEGLVLLADEVYQENLYVPDKKFHSFKKFARSLGYG-EKDM  355

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L+++P
Sbjct  356  SLVSFQSVSKGYYGECGKRGGYMEVTGFTPDVREQIYKMASVNLCSNISGQILASLVMSP  415

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +A
Sbjct  416  PKPGDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRISLPQKA  475

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI++  
Sbjct  476  IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVDRL  535

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  536  TAFHKSFMDEFRD  548



>ref|XP_008460348.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=513

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+NIY  ++ F S +K+   MG   ++++
Sbjct  262  PTGQVLAEDNQRQIVEFCKQEGLVLLADEVYQENIYVPDKKFHSFKKISRSMGYG-NEDI  320

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NP
Sbjct  321  ALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNP  380

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  381  PKVGDESFESYSAEKDGILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKA  440

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  441  IKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  500

Query  260  KKFNDEFMDQYED  222
             +F+ +FM+++ D
Sbjct  501  TEFHKQFMEEFRD  513



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 173/252 (69%), Gaps = 5/252 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTG  L+  N KEI+QFC  E ++L+ DEVYQ+N+Y + R F S +KV+ DMG     ++
Sbjct  215  PTGNALNVDNQKEIVQFCKDEGVLLIADEVYQENVYAEGRSFTSFKKVVRDMG----LDI  270

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVS  + SKG++GECG+RGGY E+  + P    E+YK+AS+ L PN+ GQ+ +GL+++P
Sbjct  271  PLVSMQSTSKGFYGECGRRGGYMEVCGLDPDVKAELYKLASVGLCPNLSGQVLMGLVMSP  330

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SY+ +  E   IL SL++RA  +  G N+   V CN  +GAMY+FP++ LP + 
Sbjct  331  PKPGDPSYELYAAERDAILSSLKRRALKLVSGLNALEGVTCNEAQGAMYAFPKVSLPEKF  390

Query  440  IETAQGLGK-APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            +  A   GK APD  YC+KLLEATGI  VPGSGFGQ EG +H RTT LP+EED+  ++E 
Sbjct  391  VAEATASGKMAPDALYCMKLLEATGIVVVPGSGFGQVEGTWHFRTTFLPSEEDIGGVVEK  450

Query  263  FKKFNDEFMDQY  228
              KF+ EFMD Y
Sbjct  451  LAKFHAEFMDTY  462



>ref|XP_004144444.2| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
sativus]
 gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+NIY  ++ F S +K+   MG   ++++
Sbjct  284  PTGQVLAEDNQRQIVEFCKQEGLVLLADEVYQENIYAPDKKFHSFKKISRSMGYG-NEDI  342

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NP
Sbjct  343  ALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNP  402

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  403  PKVGDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKA  462

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  463  IKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  522

Query  260  KKFNDEFMDQYED  222
             +F+ +FM+++ D
Sbjct  523  TEFHKQFMEEFRD  535



>ref|XP_004235527.1| PREDICTED: alanine aminotransferase 2-like [Solanum lycopersicum]
 ref|XP_010318451.1| PREDICTED: alanine aminotransferase 2-like [Solanum lycopersicum]
Length=575

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 175/251 (70%), Gaps = 1/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+EAN +EI++FC +E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  324  PTGQVLAEANQREIVEFCKKEGLVLLADEVYQENVYVPEKQFHSFKKVARSMGFG-EKDI  382

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKG++GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++P
Sbjct  383  SLVSFQSVSKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSP  442

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F  E +GIL SL +RA+ + D F++   V CN  EGAMY FP+I LP +A
Sbjct  443  PKVGDESYESFAAEKEGILSSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLPDKA  502

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +Y   LL ATGI  VPGSGFGQ+ G +H R TILP EE +PAI+   
Sbjct  503  IKAAEEAKIAPDAFYARHLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSRL  562

Query  260  KKFNDEFMDQY  228
             +F+  FMD++
Sbjct  563  TEFHKLFMDEF  573



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+NIY  ++ F S +K+   MG   ++++
Sbjct  279  PTGQVLAEDNQRQIVEFCKQEGLVLLADEVYQENIYVPDKKFHSFKKISRSMGYG-NEDI  337

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NP
Sbjct  338  ALVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNP  397

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +A
Sbjct  398  PKVGDESFESYSAEKDGILSSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKA  457

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  458  IKAAEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRL  517

Query  260  KKFNDEFMDQYED  222
             +F+ +FM+++ D
Sbjct  518  TEFHKQFMEEFRD  530



>ref|XP_009826737.1| hypothetical protein H257_04062 [Aphanomyces astaci]
 gb|ETV83307.1| hypothetical protein H257_04062 [Aphanomyces astaci]
Length=486

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 172/251 (69%), Gaps = 4/251 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE N+++I+ FC  E LVL+ DEVYQ+N+Y  ++ F+S +KVL DM       +
Sbjct  239  PTGQILSEDNMRDIITFCKDEKLVLMADEVYQENVYVTDKTFVSFKKVLRDM----ESNV  294

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH+ SKG+ GECG+RGGY E+ N     +EE+YK+ SI+L  N+ GQ+ + LM NP
Sbjct  295  ELASFHSTSKGFTGECGRRGGYMELVNFDDDVMEELYKLVSINLCSNIEGQLMVALMTNP  354

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK G+ SYD +V +   I+ SL++RA  +   FN    V CN TEGAMY+FP+I +P +A
Sbjct  355  PKAGEPSYDLYVAQRDEIVSSLKRRAVKLVASFNELEGVTCNVTEGAMYTFPRITVPAKA  414

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A   G+APD +Y   LL ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E  
Sbjct  415  VAEANKAGQAPDAFYAFALLNATGIVVVPGSGFGQQDGTFHFRSTILPPEEAIDEVIEKT  474

Query  260  KKFNDEFMDQY  228
             KF+ +FM++Y
Sbjct  475  AKFHADFMNKY  485



>ref|XP_010428116.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Camelina 
sativa]
Length=549

 Score =   272 bits (696),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 173/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC  E LVLL DEVYQ+N+Y  ++ F S +KV   +G    +++
Sbjct  298  PTGQVLAEENQRDIVNFCKEEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EQDM  356

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++P
Sbjct  357  SLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSP  416

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +A
Sbjct  417  PKPGDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRINLPQKA  476

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+E  
Sbjct  477  IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVERL  536

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  537  TAFHKSFMDEFRD  549



>ref|XP_011072689.1| PREDICTED: alanine aminotransferase 2 [Sesamum indicum]
Length=547

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 173/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC +E LVLL DEVYQ+NIY  ++ F S +KV   MG    K++
Sbjct  296  PTGQVLAENNQQQIVDFCNKEGLVLLADEVYQENIYVPDKQFHSFKKVARSMGYG-EKDI  354

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L++NP
Sbjct  355  SLVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNP  414

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +  E   IL SL +RA+ + + FN    V CN  EGAMY FP+I+LP +A
Sbjct  415  PKVGDESYESYSAEKDAILSSLARRAKKLEEAFNGLEGVTCNRAEGAMYLFPRIQLPKKA  474

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +  APD +Y  +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  475  IEAAKAVNTAPDAFYARRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDRIPAIISRL  534

Query  260  KKFNDEFMDQYED  222
             +F+  FMD++ D
Sbjct  535  TEFHKGFMDEFRD  547



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 173/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I++FC +E LVLL DEVYQ+N+Y  E+ F S +KV   MG     ++
Sbjct  280  PTGQVLAEENQRDIVEFCKQEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-DDDI  338

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY GECG+RGGY E+T   P   E+IYKV+S++L  N+ GQI   L+++P
Sbjct  339  SLVSFQSVSKGYHGECGKRGGYMEVTGFSPDVREQIYKVSSVNLCSNITGQILASLVMSP  398

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ F+ E   IL SL  RA+ + +  N    V CN  EGAMY FPQIRLP +A
Sbjct  399  PKVGDESYESFMAEKGSILSSLATRAKSLEEALNKLEGVTCNKAEGAMYLFPQIRLPKKA  458

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  459  IEAAEAENTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRL  518

Query  260  KKFNDEFMDQYED  222
             +F+++FMD++ D
Sbjct  519  TEFHEKFMDEFRD  531



>ref|XP_005443445.1| PREDICTED: alanine aminotransferase 2-like [Falco cherrug]
Length=422

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 172/251 (69%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ  S   ++++++F + E L L+ DEVYQ NIY +   F S +KVL +MGPP S+ +
Sbjct  171  PTGQVQSRQCIEDVIKFAFEEKLFLMADEVYQDNIYAEGSAFHSFKKVLFEMGPPYSEVV  230

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH+VSKG+ GECG R GY E+ N+ P   +++ K+ S+ L P VPGQI L  +V+P
Sbjct  231  ELASFHSVSKGFMGECGFRSGYVEVVNMDPDVQQQLAKLVSVRLCPPVPGQILLDTVVDP  290

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA
Sbjct  291  PQPGDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRA  350

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E  
Sbjct  351  LAAAKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKL  410

Query  260  KKFNDEFMDQY  228
              F  +F+ +Y
Sbjct  411  SSFYTKFVKEY  421



>emb|CDH53092.1| alanine transaminase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=542

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 179/254 (70%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMGPPISKE  804
            PTGQCL+E N++E++ FC++E LVLL DEVYQ NIYQ D+RPF S +KVL  MG    + 
Sbjct  290  PTGQCLTEENMREVIDFCHKERLVLLADEVYQTNIYQPDQRPFHSFKKVLRSMGDKY-QN  348

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
            ++L SFH+ SKG  GECG+RGGY E  NI  + +E++YKVASISL PNV GQ+ + LM N
Sbjct  349  VELFSFHSTSKGMIGECGRRGGYLECVNIDEKVLEQLYKVASISLCPNVHGQVMVDLMTN  408

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PPK GD SY+ + +E   I ESLR+RA  + + FN+  N+ CN  +GAMY FP++RLP +
Sbjct  409  PPKEGDASYESYQKEVGTIYESLRRRATKLANCFNNLENMTCNDAQGAMYLFPRVRLPKK  468

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AIE A+    +PD +Y L++LEATG+  +PGSGFGQ++  +H R+T LP E        +
Sbjct  469  AIEAAKAANMSPDAFYALQMLEATGVCVIPGSGFGQEKDTWHFRSTFLPEEHLFDQFCSN  528

Query  263  FKKFNDEFMDQYED  222
             +KF+  FM++Y D
Sbjct  529  IEKFHKSFMNEYRD  542



>ref|XP_004356702.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR24802.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=454

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 172/253 (68%), Gaps = 11/253 (4%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQCL  AN++++++FC+R  ++L+ DEVYQ N Y   RPF S +KVL  MG   +   
Sbjct  213  PTGQCLDTANMQQVIEFCHRRRVLLMADEVYQANSYI--RPFTSFKKVLRSMGEAYAG-F  269

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +LVSFH+VSKG  GECG RGGY E+  +     ++IYK+ASISL PN+ GQ+ + LMV P
Sbjct  270  ELVSFHSVSKGVIGECGHRGGYMELVGLDIAVKQQIYKLASISLCPNIAGQVVVDLMVRP  329

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD S+DQF RE++   ESL+KRA ++    N    V CN  EGAMY FP+IRLP RA
Sbjct  330  PKPGDDSHDQFQRETQATFESLKKRAGLLATALNQLEGVTCNPAEGAMYLFPRIRLPQRA  389

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+ L +APDV+YC  LL+AT        GFGQ++G FH RTT LP EE + +++ + 
Sbjct  390  IDEAKRLCRAPDVFYCFALLDAT--------GFGQRDGTFHFRTTFLPQEEQIRSVVAAM  441

Query  260  KKFNDEFMDQYED  222
              F+  FMDQ+ +
Sbjct  442  AAFHARFMDQWRE  454



>ref|XP_010471259.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010471260.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 173/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N ++I+ FC +E LVLL DEVYQ+N+Y  ++ F S +KV   +G    K++
Sbjct  297  PTGQVLAEENQRDIVNFCKQEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDM  355

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYK+AS++L  N+ GQI   L+++P
Sbjct  356  SLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSP  415

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SYD ++ E  GIL S+ KRA+ + D  N+   V CN  EGAMY FP+I LP +A
Sbjct  416  PKPGDDSYDSYMVERDGILSSMAKRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPHKA  475

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ + AI++  
Sbjct  476  IEAAEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKILAIVDRL  535

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ D
Sbjct  536  TAFHKSFMDEFRD  548



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N K+I+ FC  E LVLL DEVYQ+NIY  ++ F S +KV   MG    K++
Sbjct  291  PTGQVLAENNQKQIVDFCKDEGLVLLADEVYQENIYVPDKQFHSFKKVARSMGYG-EKDI  349

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T   P   E+IYK+AS++L  N+ GQI   L++NP
Sbjct  350  SLVSFQSVSKGYYGECGKRGGYMEVTGFSPEIREQIYKLASVNLCSNISGQILASLVMNP  409

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ ++ E   IL SL +RA+ + D FNS + V CN  EGAMY FP I LP +A
Sbjct  410  PKVGDESYESYLAEKDAILSSLARRAKQLEDAFNSLKGVTCNRAEGAMYLFPCIDLPKKA  469

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            IE A+ +  APD +Y  +LL ATGI  VPGSGF Q  G +H R TILP E+ +PAI+   
Sbjct  470  IEAAKAVSTAPDAFYARRLLNATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVSRL  529

Query  260  KKFNDEFMDQYED  222
             KF+  FMD++ D
Sbjct  530  TKFHKGFMDEFCD  542



>ref|XP_006426798.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40038.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=533

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 171/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N + I+ FC +E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  282  PTGQVLAEENQRAIVDFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-EKDI  340

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++P
Sbjct  341  SLVSFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMSP  400

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +A
Sbjct  401  PKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKA  460

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  461  IKAAEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRL  520

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ +
Sbjct  521  TDFHKSFMDKFRN  533



>gb|AIT69935.1| alanine transaminase [Dumontia simplex]
Length=497

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 181/252 (72%), Gaps = 5/252 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE NLK+I+ FC RENLV++ DEVYQ+N+Y +E+PF+S +KV+ ++      ++
Sbjct  249  PTGQVLSEQNLKDIIHFCERENLVIMADEVYQKNVYTEEKPFVSFKKVVSEL----RSQV  304

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH+VSKG  GECG RGGY E+ N+     E IYK+ S+SL  N+ GQ+ + LM+ P
Sbjct  305  ELASFHSVSKGVMGECGLRGGYMEVLNMDQYVNELIYKLFSVSLCSNIVGQVAVDLMMTP  364

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+ GD SY+ +  E   I ESLR++A  M+DG N+   V CN +EGAMY FP+I +PP A
Sbjct  365  PEQGDPSYELYNSEVTNIYESLRRKAIAMSDGLNAFEGVRCNPSEGAMYLFPRITIPPAA  424

Query  440  IETAQGLGKA-PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            +  A+ LG A  DV YCL++LEATGI  VPGSGFGQ++G +H RTT LP+E+++P +++ 
Sbjct  425  VTEAKNLGLASADVMYCLEMLEATGICVVPGSGFGQRKGTYHFRTTFLPSEKEIPGVIDR  484

Query  263  FKKFNDEFMDQY  228
              +F+ +FM +Y
Sbjct  485  MHRFHQQFMLKY  496



>emb|CEI89079.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=498

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 171/254 (67%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDE-RPFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+++I+ FC+ E +VLL DEVYQ NIYQ E RPF S +K+L  MG    +E
Sbjct  246  PTGQCLSEENMRDIIDFCHTERIVLLADEVYQTNIYQPEHRPFHSFKKILRSMGAEY-QE  304

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH++SKG  GECG+RGGYFE  NI P  ++++YK++S+SL PN+ GQI + LM N
Sbjct  305  QELFSFHSISKGMIGECGRRGGYFECVNIDPDIMDQLYKISSVSLCPNIHGQIMVDLMTN  364

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GDISY Q+  E   I ESLR+RA  +   FN    V CN  EGAMY FP+IRLP +
Sbjct  365  PPVEGDISYPQYKAEVNAIYESLRRRAIKLASCFNKLEGVTCNDAEGAMYLFPRIRLPEK  424

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AI+ A+  G   D +Y L +L+ATG+  VPGSGFGQ+ G +H R+T LP E         
Sbjct  425  AIKEAEKAGMPADAFYSLAMLDATGVCVVPGSGFGQEAGTYHFRSTFLPEEHLFDQFCSK  484

Query  263  FKKFNDEFMDQYED  222
             +  +++FM +Y D
Sbjct  485  LEASHNDFMKKYRD  498



>ref|XP_005230442.1| PREDICTED: alanine aminotransferase 2-like [Falco peregrinus]
Length=436

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 172/251 (69%), Gaps = 0/251 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ  S   ++++++F + E L L+ DEVYQ NIY +   F S +KVL +MGPP S+ +
Sbjct  185  PTGQVQSRQCIEDVIKFAFEEKLFLMADEVYQDNIYAEGSAFHSFKKVLFEMGPPYSEVV  244

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH+VSKG+ GECG R GY E+ N+ P   +++ K+ S+ L P VPGQI L  +V+P
Sbjct  245  ELASFHSVSKGFMGECGFRSGYVEVVNMDPDVQQQLAKLVSVRLCPPVPGQILLDTVVDP  304

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PGD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA
Sbjct  305  PQPGDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRA  364

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            +  A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E  
Sbjct  365  LAAAKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKL  424

Query  260  KKFNDEFMDQY  228
              F  +F+ +Y
Sbjct  425  SSFYTKFIKEY  435



>ref|XP_006426797.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40037.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=529

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 171/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N + I+ FC +E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  278  PTGQVLAEENQRAIVDFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-EKDI  336

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY GECG+RGGY E+T   P   E+IYKVAS++L  N+ GQI   L+++P
Sbjct  337  SLVSFQSVSKGYHGECGKRGGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMSP  396

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +A
Sbjct  397  PKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKA  456

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  457  IKAAEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRL  516

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ +
Sbjct  517  TDFHKSFMDKFRN  529



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
sativus]
 ref|XP_011659600.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 171/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L++ N ++I+QFC +E LVLL DEVYQ+NIY  ++ F S +K+   MG    K++
Sbjct  237  PTGQVLTKENQEQIVQFCKQEGLVLLADEVYQENIYVPDKKFHSFKKIARTMGYG-EKDI  295

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  296  SLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNP  355

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +A
Sbjct  356  PKDGDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKA  415

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++   
Sbjct  416  IKAAEAANTVPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRL  475

Query  260  KKFNDEFMDQYED  222
              F+  FM++Y D
Sbjct  476  TDFHKAFMNEYRD  488



>ref|XP_006465804.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Citrus 
sinensis]
Length=533

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L+E N + I++FC +E LVLL DEVYQ+N+Y  E+ F S +KV   MG    K++
Sbjct  282  PTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-EKDI  340

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L+++P
Sbjct  341  SLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSP  400

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +A
Sbjct  401  PKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKA  460

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   
Sbjct  461  IKAAEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRL  520

Query  260  KKFNDEFMDQYED  222
              F+  FMD++ +
Sbjct  521  TDFHKNFMDKFRN  533



>ref|XP_001769989.1| predicted protein [Physcomitrella patens]
 gb|EDQ65165.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ LSE N ++I+ FC  E LVLL DEVYQ+NIY + + F S +KV   MG    K++
Sbjct  233  PTGQVLSEENQQDIVNFCKDEGLVLLADEVYQENIYAEGKTFNSFKKVARSMGLE-DKDI  291

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             +VSF +VSKGY+GECG+RGGY E+T +P    +++YK+AS++L  NV GQI + L++NP
Sbjct  292  VIVSFQSVSKGYYGECGRRGGYMEVTGLPKDVKDQLYKLASVNLCSNVSGQILVSLVMNP  351

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PKPGD SY+QF RE   IL SL +RA+++T+  N    V CN  EGAMY FP++ LP +A
Sbjct  352  PKPGDSSYEQFARERDSILSSLARRAKVLTEAMNKLEGVSCNAAEGAMYVFPRLYLPKKA  411

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
               A   G   DV+Y  +LL++TGI  VPGSGFGQ  G +H+R TILP+EE+  AI++  
Sbjct  412  QIAAGEAGMKADVFYTRRLLDSTGIVMVPGSGFGQVPGTWHVRCTILPSEENFGAIIDRL  471

Query  260  KKFNDEFMDQYED  222
              F+ +FMD++ D
Sbjct  472  TTFHKKFMDEFRD  484



>emb|CEI89078.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=512

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 171/254 (67%), Gaps = 2/254 (1%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDE-RPFLSSRKVLLDMGPPISKE  804
            PTGQCLSE N+++I+ FC+ E +VLL DEVYQ NIYQ E RPF S +K+L  MG    +E
Sbjct  260  PTGQCLSEENMRDIIDFCHTERIVLLADEVYQTNIYQPEHRPFHSFKKILRSMGAEY-QE  318

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVN  624
             +L SFH++SKG  GECG+RGGYFE  NI P  ++++YK++S+SL PN+ GQI + LM N
Sbjct  319  QELFSFHSISKGMIGECGRRGGYFECVNIDPDIMDQLYKISSVSLCPNIHGQIMVDLMTN  378

Query  623  PPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPR  444
            PP  GDISY Q+  E   I ESLR+RA  +   FN    V CN  EGAMY FP+IRLP +
Sbjct  379  PPVEGDISYPQYKAEVNAIYESLRRRAIKLASCFNKLEGVTCNDAEGAMYLFPRIRLPEK  438

Query  443  AIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMES  264
            AI+ A+  G   D +Y L +L+ATG+  VPGSGFGQ+ G +H R+T LP E         
Sbjct  439  AIKEAEKAGMPADAFYSLAMLDATGVCVVPGSGFGQEAGTYHFRSTFLPEEHLFDQFCSK  498

Query  263  FKKFNDEFMDQYED  222
             +  +++FM +Y D
Sbjct  499  LEASHNDFMKKYRD  512



>ref|XP_005514471.1| PREDICTED: alanine aminotransferase 2-like, partial [Columba 
livia]
Length=416

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 168/246 (68%), Gaps = 0/246 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ  S   ++++++F Y ENL L+ DEVYQ NIY     F S +KVL +MGPP SK +
Sbjct  171  PTGQVQSRQCIEDVIKFAYEENLFLMADEVYQDNIYAKGSAFYSFKKVLSEMGPPYSKTV  230

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
            +L SFH++SKG+ GECG RGGY E+ N+ P   E++ K+ S+ L P V GQI LG +V+P
Sbjct  231  ELASFHSISKGFMGECGFRGGYMEVINMDPEVKEQLVKLVSVRLCPPVSGQILLGALVDP  290

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            P+PG+ SY+ F+ E K +L +L  +A++  + FN    + CN  +GAMYSFP+I LPPRA
Sbjct  291  PQPGEPSYETFMAEKKAVLSTLAHKAQLTQEIFNKTPGIHCNPVQGAMYSFPRIDLPPRA  350

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I  A+  G+APD ++C++LLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E  
Sbjct  351  ITAAKEKGQAPDTFFCMRLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLKVLLEKL  410

Query  260  KKFNDE  243
              F  E
Sbjct  411  SSFYTE  416



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 172/253 (68%), Gaps = 1/253 (0%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKEL  801
            PTGQ L++ N ++I++FC +E LVLL DEVYQ+NIY  ++ F S +K+   MG    K++
Sbjct  237  PTGQVLTKENQEQIVKFCKQEGLVLLADEVYQENIYVPDKKFHSFKKISRTMGYG-EKDI  295

Query  800  QLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNP  621
             LVSF +VSKGY+GECG+RGGY E+T       E+IYKVAS++L  N+ GQI   L++NP
Sbjct  296  SLVSFQSVSKGYYGECGKRGGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNP  355

Query  620  PKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA  441
            PK GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +A
Sbjct  356  PKDGDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKA  415

Query  440  IETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  261
            I+ A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++   
Sbjct  416  IKAAEAANTAPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRL  475

Query  260  KKFNDEFMDQYED  222
              F+  FM++Y D
Sbjct  476  TDFHKAFMNEYRD  488



>ref|XP_002681562.1| alanine aminotransferase [Naegleria gruberi]
 gb|EFC48818.1| alanine aminotransferase [Naegleria gruberi]
Length=492

 Score =   269 bits (687),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/254 (51%), Positives = 180/254 (71%), Gaps = 4/254 (2%)
 Frame = -1

Query  980  PTGQCLSEANLKEILQFCYRENLVLLGDEVYQQNIYQD-ERPFLSSRKVLLDMGPPISKE  804
            PTGQ L   ++++I+QFC  + +VLL DEVYQ+N Y + ++PF S  K+  +MG  + KE
Sbjct  241  PTGQVLERKDMEQIIQFCVNKGVVLLADEVYQENNYTNGKKPFYSFNKIAYEMG--LQKE  298

Query  803  LQLVSFHTVSKGYWGECGQRGGYFEMTN-IPPRSVEEIYKVASISLSPNVPGQIFLGLMV  627
            L++VSFH+VSKG+ GECG+RGGYF+++  I P   EE+YK++S++L PN  GQI + LMV
Sbjct  299  LEMVSFHSVSKGFIGECGRRGGYFQLSEAIDPAVKEELYKISSVNLCPNADGQIMVDLMV  358

Query  626  NPPKPGDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP  447
             PP  G+ SY ++V E   IL SL++RA  +    NS   V C   EGAMY+FPQI LP 
Sbjct  359  RPPSQGEASYQEYVAERDNILNSLKRRAEKLVKMLNSLEGVSCQPVEGAMYAFPQITLPE  418

Query  446  RAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIME  267
            +AI+ A+ +G APD+ Y L+LLE TGI  VPGSGF QK G +H RTTILP+EE +  +++
Sbjct  419  KAIQKAKEMGVAPDLMYVLELLEETGICVVPGSGFQQKPGTYHFRTTILPSEEQIEGVVQ  478

Query  266  SFKKFNDEFMDQYE  225
            +  KF+D+FM QY+
Sbjct  479  TLAKFHDKFMKQYK  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2393765068816