BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10340

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009765001.1|  PREDICTED: serine/arginine-rich splicing fac...    252   2e-79   Nicotiana sylvestris
ref|XP_004246725.1|  PREDICTED: serine/arginine-rich splicing fac...    251   2e-79   Solanum lycopersicum
ref|XP_009593629.1|  PREDICTED: serine/arginine-rich splicing fac...    251   2e-79   Nicotiana tomentosiformis
emb|CDP06673.1|  unnamed protein product                                251   3e-79   Coffea canephora [robusta coffee]
ref|XP_010326036.1|  PREDICTED: serine/arginine-rich splicing fac...    251   4e-79   Solanum lycopersicum
ref|XP_006345685.1|  PREDICTED: serine/arginine-rich splicing fac...    249   1e-78   Solanum tuberosum [potatoes]
ref|XP_006345686.1|  PREDICTED: serine/arginine-rich splicing fac...    249   2e-78   Solanum tuberosum [potatoes]
ref|XP_011094784.1|  PREDICTED: serine/arginine-rich splicing fac...    244   1e-76   Sesamum indicum [beniseed]
gb|KJB73660.1|  hypothetical protein B456_011G242700                    243   3e-76   Gossypium raimondii
gb|KJB73656.1|  hypothetical protein B456_011G242700                    243   3e-76   Gossypium raimondii
gb|EPS69715.1|  hypothetical protein M569_05051                         242   2e-75   Genlisea aurea
ref|XP_009384815.1|  PREDICTED: serine/arginine-rich splicing fac...    240   6e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010101505.1|  Serine/arginine-rich splicing factor 4             238   4e-74   Morus notabilis
emb|CDP00008.1|  unnamed protein product                                237   6e-74   Coffea canephora [robusta coffee]
gb|KJB76484.1|  hypothetical protein B456_012G091800                    236   2e-73   Gossypium raimondii
ref|XP_006381987.1|  zinc knuckle family protein                        232   2e-73   
ref|XP_006843673.1|  PREDICTED: serine/arginine-rich splicing fac...    236   3e-73   
ref|XP_010922450.1|  PREDICTED: serine/arginine-rich splicing fac...    236   3e-73   Elaeis guineensis
ref|XP_002308490.2|  hypothetical protein POPTR_0006s23170g             234   7e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011019269.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    234   7e-73   Populus euphratica
ref|XP_008783623.1|  PREDICTED: serine/arginine-rich splicing fac...    234   2e-72   Phoenix dactylifera
gb|KJB67669.1|  hypothetical protein B456_010G203100                    233   3e-72   Gossypium raimondii
gb|KJB67670.1|  hypothetical protein B456_010G203100                    233   3e-72   Gossypium raimondii
gb|EYU41659.1|  hypothetical protein MIMGU_mgv1a011263mg                233   3e-72   Erythranthe guttata [common monkey flower]
gb|KJB67668.1|  hypothetical protein B456_010G203100                    233   3e-72   Gossypium raimondii
gb|KJB67671.1|  hypothetical protein B456_010G203100                    233   3e-72   Gossypium raimondii
ref|XP_012082225.1|  PREDICTED: serine/arginine-rich splicing fac...    231   9e-72   Jatropha curcas
ref|XP_004960314.1|  PREDICTED: serine/arginine-rich splicing fac...    232   1e-71   Setaria italica
ref|XP_011048452.1|  PREDICTED: serine/arginine-rich splicing fac...    231   1e-71   Populus euphratica
ref|NP_001054489.1|  Os05g0120100                                       232   1e-71   
gb|KJB78863.1|  hypothetical protein B456_013G024100                    231   2e-71   Gossypium raimondii
gb|EAY96334.1|  hypothetical protein OsI_18237                          231   2e-71   Oryza sativa Indica Group [Indian rice]
gb|KJB78864.1|  hypothetical protein B456_013G024100                    231   2e-71   Gossypium raimondii
ref|XP_002322837.2|  hypothetical protein POPTR_0016s08250g             230   2e-71   Populus trichocarpa [western balsam poplar]
gb|KJB78861.1|  hypothetical protein B456_013G024100                    231   3e-71   Gossypium raimondii
ref|XP_002525221.1|  arginine/serine-rich splicing factor, putative     230   4e-71   
gb|AGE46112.1|  arginine/serine-rich splicing factor R2SZ35 trans...    230   5e-71   Sorghum bicolor [broomcorn]
ref|XP_008445806.1|  PREDICTED: serine/arginine-rich splicing fac...    229   9e-71   Cucumis melo [Oriental melon]
ref|XP_007009623.1|  RNA-binding family protein with retrovirus z...    229   1e-70   Theobroma cacao [chocolate]
ref|XP_007009620.1|  RNA-binding family protein with retrovirus z...    229   1e-70   Theobroma cacao [chocolate]
ref|XP_007009622.1|  RNA-binding family protein with retrovirus z...    229   1e-70   Theobroma cacao [chocolate]
ref|XP_004143594.1|  PREDICTED: serine/arginine-rich splicing fac...    229   1e-70   Cucumis sativus [cucumbers]
ref|XP_006653980.1|  PREDICTED: serine/arginine-rich splicing fac...    229   1e-70   
ref|XP_004960312.1|  PREDICTED: serine/arginine-rich splicing fac...    229   2e-70   Setaria italica
ref|XP_004493916.1|  PREDICTED: serine/arginine-rich splicing fac...    228   2e-70   Cicer arietinum [garbanzo]
ref|XP_008371111.1|  PREDICTED: serine/arginine-rich splicing fac...    228   2e-70   Malus domestica [apple tree]
ref|XP_009335940.1|  PREDICTED: serine/arginine-rich splicing fac...    228   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_010067232.1|  PREDICTED: serine/arginine-rich splicing fac...    229   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010067231.1|  PREDICTED: serine/arginine-rich splicing fac...    229   3e-70   Eucalyptus grandis [rose gum]
ref|XP_006604540.1|  PREDICTED: serine/arginine-rich splicing fac...    227   3e-70   Glycine max [soybeans]
ref|XP_008366711.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    223   3e-70   
ref|XP_010086758.1|  Serine/arginine-rich splicing factor 7             228   3e-70   Morus notabilis
gb|KGN50491.1|  hypothetical protein Csa_5G177110                       229   4e-70   Cucumis sativus [cucumbers]
gb|EYU38493.1|  hypothetical protein MIMGU_mgv1a008403mg                229   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_004493914.1|  PREDICTED: serine/arginine-rich splicing fac...    227   6e-70   Cicer arietinum [garbanzo]
ref|XP_009357625.1|  PREDICTED: serine/arginine-rich splicing fac...    227   7e-70   
gb|ACU22814.1|  unknown                                                 222   9e-70   Glycine max [soybeans]
ref|XP_009357626.1|  PREDICTED: serine/arginine-rich splicing fac...    226   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_008233520.1|  PREDICTED: serine/arginine-rich splicing fac...    226   2e-69   Prunus mume [ume]
ref|XP_007218729.1|  hypothetical protein PRUPE_ppa009074mg             226   2e-69   Prunus persica
ref|XP_010909639.1|  PREDICTED: serine/arginine-rich splicing fac...    226   3e-69   Elaeis guineensis
ref|XP_008359700.1|  PREDICTED: serine/arginine-rich splicing fac...    226   3e-69   
ref|XP_010553022.1|  PREDICTED: serine/arginine-rich splicing fac...    224   3e-69   Tarenaya hassleriana [spider flower]
ref|NP_001132009.1|  uncharacterized protein LOC100193414               226   3e-69   Zea mays [maize]
ref|XP_003521358.1|  PREDICTED: serine/arginine-rich splicing fac...    225   3e-69   Glycine max [soybeans]
ref|XP_009341794.1|  PREDICTED: serine/arginine-rich splicing fac...    225   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_008647386.1|  PREDICTED: uncharacterized protein LOC100193...    227   4e-69   Zea mays [maize]
ref|XP_003554343.1|  PREDICTED: serine/arginine-rich splicing fac...    224   4e-69   Glycine max [soybeans]
ref|XP_008655203.1|  PREDICTED: hypothetical protein isoform X2         225   8e-69   Zea mays [maize]
ref|XP_003569022.1|  PREDICTED: serine/arginine-rich splicing fac...    225   8e-69   Brachypodium distachyon [annual false brome]
gb|AFK42610.1|  unknown                                                 224   9e-69   Medicago truncatula
ref|XP_008776205.1|  PREDICTED: serine/arginine-rich splicing fac...    224   9e-69   Phoenix dactylifera
ref|XP_010067229.1|  PREDICTED: serine/arginine-rich splicing fac...    224   1e-68   Eucalyptus grandis [rose gum]
ref|XP_010067230.1|  PREDICTED: serine/arginine-rich splicing fac...    224   1e-68   Eucalyptus grandis [rose gum]
gb|AAY84873.1|  alternative splicing regulator                          224   1e-68   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002440494.1|  hypothetical protein SORBIDRAFT_09g001910          224   2e-68   Sorghum bicolor [broomcorn]
ref|XP_004307445.1|  PREDICTED: serine/arginine-rich splicing fac...    223   3e-68   Fragaria vesca subsp. vesca
ref|NP_001049771.1|  Os03g0285900                                       223   3e-68   
ref|XP_008654709.1|  PREDICTED: uncharacterized protein LOC100276...    226   4e-68   
gb|ACN36972.1|  unknown                                                 224   5e-68   Zea mays [maize]
ref|XP_008647517.1|  PREDICTED: uncharacterized protein LOC100272...    223   9e-68   Zea mays [maize]
ref|XP_009133148.1|  PREDICTED: serine/arginine-rich splicing fac...    220   2e-67   Brassica rapa
gb|EEC75006.1|  hypothetical protein OsI_11073                          220   2e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001143694.1|  uncharacterized protein LOC100276428               222   2e-67   
ref|XP_004968259.1|  PREDICTED: serine/arginine-rich splicing fac...    220   4e-67   Setaria italica
ref|XP_006410917.1|  hypothetical protein EUTSA_v10017989mg             219   5e-67   Eutrema salsugineum [saltwater cress]
gb|ACG34035.1|  splicing factor, arginine/serine-rich 6                 221   5e-67   Zea mays [maize]
emb|CDY46773.1|  BnaA03g17170D                                          220   6e-67   Brassica napus [oilseed rape]
emb|CDX79732.1|  BnaC03g20680D                                          219   8e-67   
ref|XP_008241800.1|  PREDICTED: serine/arginine-rich splicing fac...    218   2e-66   Prunus mume [ume]
ref|XP_006398722.1|  hypothetical protein EUTSA_v10014414mg             217   2e-66   Eutrema salsugineum [saltwater cress]
ref|XP_006296724.1|  hypothetical protein CARUB_v10014335mg             218   2e-66   
ref|XP_007205643.1|  hypothetical protein PRUPE_ppa009294mg             218   2e-66   
gb|AFK35693.1|  unknown                                                 218   2e-66   Lotus japonicus
ref|XP_010486531.1|  PREDICTED: serine/arginine-rich splicing fac...    217   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010474235.1|  PREDICTED: serine/arginine-rich splicing fac...    216   2e-66   Camelina sativa [gold-of-pleasure]
ref|NP_001242616.1|  uncharacterized protein LOC100813237               218   3e-66   
ref|XP_004302812.1|  PREDICTED: serine/arginine-rich splicing fac...    217   3e-66   Fragaria vesca subsp. vesca
ref|XP_006576250.1|  PREDICTED: uncharacterized protein LOC100813...    217   4e-66   Glycine max [soybeans]
ref|XP_010558301.1|  PREDICTED: serine/arginine-rich splicing fac...    216   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_010505314.1|  PREDICTED: serine/arginine-rich splicing fac...    216   6e-66   Camelina sativa [gold-of-pleasure]
gb|KDO67845.1|  hypothetical protein CISIN_1g021599mg                   217   7e-66   Citrus sinensis [apfelsine]
ref|XP_010464607.1|  PREDICTED: serine/arginine-rich splicing fac...    216   9e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010558304.1|  PREDICTED: serine/arginine-rich splicing fac...    214   9e-66   Tarenaya hassleriana [spider flower]
ref|XP_006436157.1|  hypothetical protein CICLE_v10032170mg             216   1e-65   Citrus clementina [clementine]
ref|XP_002281756.2|  PREDICTED: serine/arginine-rich splicing fac...    216   1e-65   Vitis vinifera
emb|CBI25319.3|  unnamed protein product                                215   1e-65   Vitis vinifera
ref|XP_010509350.1|  PREDICTED: serine/arginine-rich splicing fac...    215   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006293506.1|  hypothetical protein CARUB_v10023766mg             215   2e-65   Capsella rubella
gb|KDO67846.1|  hypothetical protein CISIN_1g021599mg                   216   2e-65   Citrus sinensis [apfelsine]
ref|XP_010517000.1|  PREDICTED: serine/arginine-rich splicing fac...    214   2e-65   Camelina sativa [gold-of-pleasure]
gb|KJB16875.1|  hypothetical protein B456_002G252500                    214   3e-65   Gossypium raimondii
ref|XP_006436154.1|  hypothetical protein CICLE_v10032170mg             215   3e-65   Citrus clementina [clementine]
gb|KJB16873.1|  hypothetical protein B456_002G252500                    214   3e-65   Gossypium raimondii
gb|KJB16874.1|  hypothetical protein B456_002G252500                    214   3e-65   Gossypium raimondii
ref|XP_009776489.1|  PREDICTED: serine/arginine-rich splicing fac...    214   6e-65   Nicotiana sylvestris
ref|XP_008445803.1|  PREDICTED: serine/arginine-rich splicing fac...    215   7e-65   Cucumis melo [Oriental melon]
ref|XP_006485979.1|  PREDICTED: serine/arginine-rich splicing fac...    215   9e-65   Citrus sinensis [apfelsine]
ref|XP_011654929.1|  PREDICTED: serine/arginine-rich splicing fac...    214   1e-64   Cucumis sativus [cucumbers]
ref|XP_010558303.1|  PREDICTED: serine/arginine-rich splicing fac...    213   1e-64   Tarenaya hassleriana [spider flower]
ref|NP_850280.1|  arginine/serine-rich zinc knuckle-containing pr...    213   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345907.1|  PREDICTED: serine/arginine-rich splicing fac...    213   2e-64   Solanum tuberosum [potatoes]
ref|XP_007162697.1|  hypothetical protein PHAVU_001G172600g             213   2e-64   Phaseolus vulgaris [French bean]
ref|XP_007162696.1|  hypothetical protein PHAVU_001G172600g             213   2e-64   Phaseolus vulgaris [French bean]
ref|XP_007162698.1|  hypothetical protein PHAVU_001G172700g             212   3e-64   Phaseolus vulgaris [French bean]
ref|XP_003554342.1|  PREDICTED: serine/arginine-rich splicing fac...    212   3e-64   Glycine max [soybeans]
ref|XP_004239756.1|  PREDICTED: serine/arginine-rich splicing fac...    213   3e-64   Solanum lycopersicum
ref|XP_003567963.1|  PREDICTED: serine/arginine-rich splicing fac...    213   4e-64   Brachypodium distachyon [annual false brome]
emb|CAC03605.1|  splicing factor RSZ33                                  211   6e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44429.1|  unknown protein                                        211   6e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41599.1|  BnaC05g43360D                                          210   1e-63   Brassica napus [oilseed rape]
ref|XP_010230323.1|  PREDICTED: serine/arginine-rich splicing fac...    211   2e-63   
emb|CDY07586.1|  BnaC06g14780D                                          209   3e-63   Brassica napus [oilseed rape]
ref|XP_002455172.1|  hypothetical protein SORBIDRAFT_03g005500          209   4e-63   Sorghum bicolor [broomcorn]
ref|XP_009402244.1|  PREDICTED: serine/arginine-rich splicing fac...    209   5e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR25316.1|  splicing factor                                         206   5e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_002277105.1|  PREDICTED: serine/arginine-rich splicing fac...    209   5e-63   Vitis vinifera
dbj|BAK03402.1|  predicted protein                                      208   7e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010504113.1|  PREDICTED: serine/arginine-rich splicing fac...    208   9e-63   Camelina sativa [gold-of-pleasure]
emb|CAN60012.1|  hypothetical protein VITISV_036556                     209   1e-62   Vitis vinifera
ref|NP_001042066.1|  Os01g0155600                                       209   1e-62   
ref|XP_006643769.1|  PREDICTED: serine/arginine-rich splicing fac...    209   1e-62   Oryza brachyantha
ref|XP_010426999.1|  PREDICTED: serine/arginine-rich splicing fac...    207   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002877922.1|  hypothetical protein ARALYDRAFT_323893             207   2e-62   Arabidopsis lyrata subsp. lyrata
ref|NP_190918.3|  serine/arginine-rich splicing factor RS2Z32           207   2e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73550.1|  BnaC08g24530D                                          207   2e-62   
ref|XP_010253404.1|  PREDICTED: serine/arginine-rich splicing fac...    210   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010253405.1|  PREDICTED: serine/arginine-rich splicing fac...    210   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_006293063.1|  hypothetical protein CARUB_v10019350mg             207   2e-62   Capsella rubella
emb|CDY44717.1|  BnaA05g28890D                                          207   2e-62   Brassica napus [oilseed rape]
ref|XP_009116040.1|  PREDICTED: serine/arginine-rich splicing fac...    207   2e-62   Brassica rapa
ref|XP_009146916.1|  PREDICTED: serine/arginine-rich splicing fac...    207   3e-62   Brassica rapa
gb|EEE53899.1|  hypothetical protein OsJ_00434                          209   4e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006403682.1|  hypothetical protein EUTSA_v10010597mg             205   4e-62   
ref|XP_009103865.1|  PREDICTED: serine/arginine-rich splicing fac...    206   6e-62   Brassica rapa
ref|XP_006403683.1|  hypothetical protein EUTSA_v10010597mg             205   1e-61   Eutrema salsugineum [saltwater cress]
ref|XP_009404636.1|  PREDICTED: serine/arginine-rich splicing fac...    205   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421361.1|  PREDICTED: serine/arginine-rich splicing fac...    201   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421363.1|  PREDICTED: serine/arginine-rich splicing fac...    201   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010529753.1|  PREDICTED: serine/arginine-rich splicing fac...    198   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_010231673.1|  PREDICTED: serine/arginine-rich splicing fac...    197   2e-58   Brachypodium distachyon [annual false brome]
emb|CDX80835.1|  BnaC03g00890D                                          196   3e-58   
gb|ABK25831.1|  unknown                                                 197   4e-58   Picea sitchensis
gb|ABK25029.1|  unknown                                                 197   4e-58   Picea sitchensis
emb|CDY11223.1|  BnaA03g00590D                                          195   5e-58   Brassica napus [oilseed rape]
emb|CDM82006.1|  unnamed protein product                                197   6e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010528225.1|  PREDICTED: serine/arginine-rich splicing fac...    193   7e-57   Tarenaya hassleriana [spider flower]
ref|XP_010528207.1|  PREDICTED: serine/arginine-rich splicing fac...    193   9e-57   Tarenaya hassleriana [spider flower]
gb|AAO16998.1|  Unknown protein                                         194   3e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EMS55948.1|  Serine/arginine-rich splicing factor 4                  193   5e-56   Triticum urartu
ref|XP_009130745.1|  PREDICTED: serine/arginine-rich splicing fac...    189   8e-56   Brassica rapa
ref|XP_010528217.1|  PREDICTED: serine/arginine-rich splicing fac...    191   1e-55   Tarenaya hassleriana [spider flower]
gb|EMS65019.1|  Serine/arginine-rich splicing factor 4                  190   1e-55   Triticum urartu
gb|EMT10449.1|  Splicing factor, arginine/serine-rich 4                 191   1e-55   
gb|EMT01114.1|  Splicing factor, arginine/serine-rich 4                 183   1e-52   
ref|XP_010669745.1|  PREDICTED: serine/arginine-rich splicing fac...    180   2e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|AGE46165.1|  arginine/serine-rich splicing factor RS2Z37 trans...    180   2e-51   Physcomitrella patens
ref|XP_010326038.1|  PREDICTED: serine/arginine-rich splicing fac...    177   4e-51   Solanum lycopersicum
gb|KJB76488.1|  hypothetical protein B456_012G091800                    177   5e-51   Gossypium raimondii
ref|XP_009593630.1|  PREDICTED: serine/arginine-rich splicing fac...    177   6e-51   Nicotiana tomentosiformis
ref|XP_009765002.1|  PREDICTED: serine/arginine-rich splicing fac...    177   8e-51   Nicotiana sylvestris
ref|XP_008445809.1|  PREDICTED: serine/arginine-rich splicing fac...    177   1e-50   
ref|XP_011654931.1|  PREDICTED: serine/arginine-rich splicing fac...    177   1e-50   Cucumis sativus [cucumbers]
ref|XP_011469709.1|  PREDICTED: serine/arginine-rich splicing fac...    176   2e-50   Fragaria vesca subsp. vesca
ref|XP_010067235.1|  PREDICTED: serine/arginine-rich splicing fac...    177   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006345687.1|  PREDICTED: serine/arginine-rich splicing fac...    176   2e-50   Solanum tuberosum [potatoes]
ref|XP_010669744.1|  PREDICTED: serine/arginine-rich splicing fac...    177   3e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007027153.1|  RNA-binding family protein with retrovirus z...    176   4e-50   
gb|KJB73658.1|  hypothetical protein B456_011G242700                    172   3e-49   Gossypium raimondii
gb|KJB73655.1|  hypothetical protein B456_011G242700                    172   3e-49   Gossypium raimondii
ref|NP_001168362.1|  hypothetical protein                               174   3e-49   Zea mays [maize]
ref|XP_010067234.1|  PREDICTED: serine/arginine-rich splicing fac...    172   9e-49   Eucalyptus grandis [rose gum]
gb|KCW65330.1|  hypothetical protein EUGRSUZ_G02779                     172   1e-48   Eucalyptus grandis [rose gum]
ref|XP_009384820.1|  PREDICTED: serine/arginine-rich splicing fac...    171   1e-48   
gb|EYU41660.1|  hypothetical protein MIMGU_mgv1a011263mg                171   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_008371112.1|  PREDICTED: serine/arginine-rich splicing fac...    169   4e-48   Malus domestica [apple tree]
ref|XP_009335941.1|  PREDICTED: serine/arginine-rich splicing fac...    170   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_009357627.1|  PREDICTED: serine/arginine-rich splicing fac...    169   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_010922452.1|  PREDICTED: serine/arginine-rich splicing fac...    169   6e-48   
gb|KJB76483.1|  hypothetical protein B456_012G091800                    169   7e-48   Gossypium raimondii
gb|KHG08857.1|  Serine/arginine-rich splicing factor 7                  169   7e-48   Gossypium arboreum [tree cotton]
ref|XP_008783624.1|  PREDICTED: serine/arginine-rich splicing fac...    169   8e-48   Phoenix dactylifera
gb|KJB67675.1|  hypothetical protein B456_010G203100                    168   1e-47   Gossypium raimondii
ref|XP_008233521.1|  PREDICTED: serine/arginine-rich splicing fac...    167   3e-47   Prunus mume [ume]
ref|XP_002308491.2|  hypothetical protein POPTR_0006s23170g             166   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011466611.1|  PREDICTED: serine/arginine-rich splicing fac...    166   1e-46   Fragaria vesca subsp. vesca
gb|KJB78860.1|  hypothetical protein B456_013G024100                    166   1e-46   Gossypium raimondii
ref|XP_007009621.1|  RNA-binding family protein with retrovirus z...    165   2e-46   
ref|XP_012082227.1|  PREDICTED: serine/arginine-rich splicing fac...    164   4e-46   Jatropha curcas
ref|XP_008776214.1|  PREDICTED: serine/arginine-rich splicing fac...    164   9e-46   
ref|XP_011048453.1|  PREDICTED: serine/arginine-rich splicing fac...    163   1e-45   Populus euphratica
ref|XP_008241808.1|  PREDICTED: serine/arginine-rich splicing fac...    163   2e-45   Prunus mume [ume]
ref|XP_007205642.1|  hypothetical protein PRUPE_ppa009294mg             163   2e-45   
ref|XP_004246726.1|  PREDICTED: serine/arginine-rich splicing fac...    162   4e-45   Solanum lycopersicum
ref|NP_001054731.1|  Os05g0162600                                       164   4e-45   
ref|XP_010231675.1|  PREDICTED: serine/arginine-rich splicing fac...    161   4e-45   Brachypodium distachyon [annual false brome]
ref|XP_010326037.1|  PREDICTED: serine/arginine-rich splicing fac...    162   6e-45   
ref|XP_004493918.1|  PREDICTED: serine/arginine-rich splicing fac...    161   7e-45   
ref|XP_006576996.1|  PREDICTED: serine/arginine-rich splicing fac...    160   2e-44   Glycine max [soybeans]
ref|XP_006398723.1|  hypothetical protein EUTSA_v10014414mg             158   5e-44   Eutrema salsugineum [saltwater cress]
gb|AFW77206.1|  hypothetical protein ZEAMMB73_752942                    160   6e-44   
ref|XP_008649360.1|  PREDICTED: serine/arginine-rich splicing fac...    159   7e-44   
ref|XP_009341801.1|  PREDICTED: serine/arginine-rich splicing fac...    158   9e-44   Pyrus x bretschneideri [bai li]
ref|XP_008359701.1|  PREDICTED: serine/arginine-rich splicing fac...    158   1e-43   
gb|EAY96659.1|  hypothetical protein OsI_18573                          160   1e-43   Oryza sativa Indica Group [Indian rice]
gb|KJB16879.1|  hypothetical protein B456_002G252500                    156   4e-43   Gossypium raimondii
gb|KJB16878.1|  hypothetical protein B456_002G252500                    156   5e-43   Gossypium raimondii
ref|XP_009116042.1|  PREDICTED: serine/arginine-rich splicing fac...    155   1e-42   Brassica rapa
ref|XP_009146919.1|  PREDICTED: serine/arginine-rich splicing fac...    154   3e-42   Brassica rapa
ref|XP_006576253.1|  PREDICTED: uncharacterized protein LOC100813...    154   3e-42   Glycine max [soybeans]
ref|XP_010553024.1|  PREDICTED: serine/arginine-rich splicing fac...    153   4e-42   Tarenaya hassleriana [spider flower]
gb|KDO67848.1|  hypothetical protein CISIN_1g021599mg                   153   8e-42   Citrus sinensis [apfelsine]
ref|XP_006436153.1|  hypothetical protein CICLE_v10032170mg             153   1e-41   Citrus clementina [clementine]
ref|XP_010505315.1|  PREDICTED: serine/arginine-rich splicing fac...    152   2e-41   Camelina sativa [gold-of-pleasure]
gb|KDO67851.1|  hypothetical protein CISIN_1g021599mg                   152   2e-41   Citrus sinensis [apfelsine]
gb|KJB16876.1|  hypothetical protein B456_002G252500                    151   2e-41   Gossypium raimondii
ref|XP_006436152.1|  hypothetical protein CICLE_v10032170mg             152   4e-41   Citrus clementina [clementine]
ref|XP_009402246.1|  PREDICTED: serine/arginine-rich splicing fac...    152   4e-41   
ref|XP_010230324.1|  PREDICTED: serine/arginine-rich splicing fac...    151   5e-41   
gb|KDO67847.1|  hypothetical protein CISIN_1g021599mg                   152   5e-41   Citrus sinensis [apfelsine]
ref|XP_009103866.1|  PREDICTED: serine/arginine-rich splicing fac...    151   9e-41   Brassica rapa
ref|XP_010658146.1|  PREDICTED: serine/arginine-rich splicing fac...    150   1e-40   Vitis vinifera
ref|XP_006604543.1|  PREDICTED: serine/arginine-rich splicing fac...    149   2e-40   Glycine max [soybeans]
ref|XP_010486532.1|  PREDICTED: serine/arginine-rich splicing fac...    149   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010474332.1|  PREDICTED: serine/arginine-rich splicing fac...    148   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006293505.1|  hypothetical protein CARUB_v10023766mg             149   3e-40   
gb|AFW74826.1|  hypothetical protein ZEAMMB73_867689                    149   5e-40   
ref|XP_010464608.1|  PREDICTED: serine/arginine-rich splicing fac...    147   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009623929.1|  PREDICTED: serine/arginine-rich splicing fac...    147   2e-39   Nicotiana tomentosiformis
ref|NP_973620.1|  arginine/serine-rich zinc knuckle-containing pr...    146   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004493917.1|  PREDICTED: serine/arginine-rich splicing fac...    146   5e-39   
gb|KJB78862.1|  hypothetical protein B456_013G024100                    145   8e-39   Gossypium raimondii
ref|XP_006345909.1|  PREDICTED: serine/arginine-rich splicing fac...    145   9e-39   Solanum tuberosum [potatoes]
gb|KJB78869.1|  hypothetical protein B456_013G024100                    144   1e-38   Gossypium raimondii
ref|XP_004239757.1|  PREDICTED: serine/arginine-rich splicing fac...    145   1e-38   Solanum lycopersicum
ref|XP_002440655.1|  hypothetical protein SORBIDRAFT_09g004685          144   1e-38   
emb|CBI32649.3|  unnamed protein product                                142   1e-38   Vitis vinifera
gb|EMS67637.1|  Neurofilament heavy polypeptide                         148   2e-38   Triticum urartu
ref|XP_010653491.1|  PREDICTED: serine/arginine-rich splicing fac...    144   4e-38   Vitis vinifera
ref|XP_009421362.1|  PREDICTED: serine/arginine-rich splicing fac...    142   1e-37   
ref|XP_010504114.1|  PREDICTED: serine/arginine-rich splicing fac...    140   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010427000.1|  PREDICTED: serine/arginine-rich splicing fac...    140   5e-37   Camelina sativa [gold-of-pleasure]
ref|NP_851015.1|  serine/arginine-rich splicing factor RS2Z32           140   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403681.1|  hypothetical protein EUTSA_v10010597mg             140   7e-37   
ref|XP_006664991.1|  PREDICTED: serine/arginine-rich splicing fac...    135   8e-35   
ref|XP_010529754.1|  PREDICTED: serine/arginine-rich splicing fac...    130   5e-33   Tarenaya hassleriana [spider flower]
ref|NP_973619.1|  arginine/serine-rich zinc knuckle-containing pr...    129   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669747.1|  PREDICTED: serine/arginine-rich splicing fac...    126   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002976046.1|  hypothetical protein SELMODRAFT_415978             126   1e-30   
ref|XP_002968326.1|  hypothetical protein SELMODRAFT_409589             126   1e-30   
ref|XP_009130746.1|  PREDICTED: serine/arginine-rich splicing fac...    120   1e-29   
gb|KHN39205.1|  Serine/arginine-rich splicing factor 6                  115   9e-28   Glycine soja [wild soybean]
gb|AGE46118.1|  arginine/serine-rich splicing factor RS2Z34 trans...    113   6e-27   Sorghum bicolor [broomcorn]
gb|KCW65333.1|  hypothetical protein EUGRSUZ_G02779                     112   1e-26   Eucalyptus grandis [rose gum]
ref|XP_005705831.1|  splicing factor, arginine/serine-rich 7            111   8e-26   Galdieria sulphuraria
gb|AFW77205.1|  hypothetical protein ZEAMMB73_752942                    110   2e-25   
dbj|BAG96311.1|  unnamed protein product                                108   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|ACR36246.1|  unknown                                                 108   9e-25   Zea mays [maize]
gb|ACG34297.1|  hypothetical protein                                    108   9e-25   Zea mays [maize]
ref|XP_002440659.1|  hypothetical protein SORBIDRAFT_09g004723          104   2e-24   
ref|NP_001140880.1|  uncharacterized protein LOC100272956               107   2e-24   
gb|ACR33894.1|  unknown                                                 105   6e-24   
ref|XP_001020597.2|  hypothetical protein TTHERM_00219250             99.8    1e-21   
ref|XP_001455435.1|  hypothetical protein                             97.8    2e-21   
ref|XP_001442392.1|  hypothetical protein                             97.1    5e-21   
gb|ERZ96881.1|  hypothetical protein GLOINDRAFT_340466                97.4    5e-21   
gb|AFK44763.1|  unknown                                               91.3    2e-19   
dbj|BAH20350.1|  AT2G37340                                            92.4    2e-19   
ref|XP_001460219.1|  hypothetical protein                             92.0    4e-19   
gb|KHF97435.1|  Serine/arginine-rich splicing factor 4                91.3    2e-18   
gb|KFH64145.1|  hypothetical protein MVEG_09970                       90.1    4e-18   
ref|XP_004353475.1|  hypothetical protein ACA1_075260                 87.0    1e-17   
gb|AGE46055.1|  arginine/serine-rich splicing factor RS2Z37B tran...  81.6    2e-16   
gb|AFK35498.1|  unknown                                               78.6    4e-15   
gb|KFH64697.1|  hypothetical protein MVEG_09429                       79.7    1e-14   
gb|EXX52218.1|  hypothetical protein RirG_254860                      78.2    2e-14   
ref|XP_008663314.1|  PREDICTED: serine/arginine-rich splicing fac...  78.6    2e-14   
gb|KFH66863.1|  hypothetical protein MVEG_07388                       78.6    3e-14   
gb|AFW58592.1|  hypothetical protein ZEAMMB73_952615                  75.5    2e-13   
ref|XP_004031192.1|  hypothetical protein IMG5_145470                 74.3    6e-13   
gb|EXX52220.1|  hypothetical protein RirG_254860                      73.6    7e-13   
emb|CDS13801.1|  hypothetical protein LRAMOSA05975                    73.2    9e-13   
ref|XP_003739841.1|  PREDICTED: serine/arginine-rich splicing fac...  74.7    1e-12   
gb|ELU05591.1|  hypothetical protein CAPTEDRAFT_222188                73.6    1e-12   
gb|EAR99989.2|  RNA recognition motif protein                         75.5    2e-12   
emb|CDH55646.1|  hypothetical protein RO3G_05782                      72.4    2e-12   
emb|CDH55645.1|  hypothetical protein RO3G_05782                      72.8    3e-12   
ref|XP_011425214.1|  PREDICTED: RNA-binding protein lark-like         72.4    3e-12   
gb|EKC39200.1|  RNA-binding protein 4                                 72.4    3e-12   
gb|EPB90613.1|  hypothetical protein HMPREF1544_02523                 70.1    4e-12   
ref|XP_004357914.1|  RNA-binding region RNP-1 domain-containing p...  72.0    8e-12   
ref|XP_006825754.1|  PREDICTED: serine/arginine-rich splicing fac...  71.2    8e-12   
ref|XP_009017444.1|  hypothetical protein HELRODRAFT_191738           70.1    1e-11   
ref|XP_001641195.1|  predicted protein                                70.5    1e-11   
ref|XP_006825753.1|  PREDICTED: serine/arginine-rich splicing fac...  70.9    1e-11   
dbj|GAN08952.1|  arginine/serine-rich splicing factor                 70.9    1e-11   
gb|EFA84385.1|  CCHC-type Zn finger-containing protein                71.2    1e-11   
dbj|BAH71871.1|  ACYPI003349                                          69.7    1e-11   
ref|XP_008184391.1|  PREDICTED: serine-arginine protein 55-like i...  71.2    2e-11   
ref|XP_008184390.1|  PREDICTED: serine-arginine protein 55-like i...  71.2    2e-11   
ref|XP_001949124.1|  PREDICTED: serine-arginine protein 55-like i...  71.2    2e-11   
tpg|DAA34674.1|  TPA: alternative splicing factor SRp55/B52/SRp75     70.9    2e-11   
ref|XP_004362631.1|  hypothetical protein DFA_03024                   73.2    2e-11   
gb|ENN70791.1|  hypothetical protein YQE_12456                        69.7    3e-11   
ref|XP_005838069.1|  hypothetical protein GUITHDRAFT_161608           69.3    4e-11   
gb|EFA75300.1|  RNA-binding region RNP-1 domain-containing protein    69.7    7e-11   
emb|CEP07130.1|  hypothetical protein                                 67.8    9e-11   
ref|XP_002121331.1|  PREDICTED: serine/arginine-rich splicing fac...  68.9    1e-10   
ref|XP_002426878.1|  arginine/serine-rich splicing factor, putative   67.0    1e-10   
ref|XP_008554796.1|  PREDICTED: serine-arginine protein 55            68.9    1e-10   
gb|EFN75624.1|  Serine-arginine protein 55                            68.6    2e-10   
ref|XP_011607630.1|  PREDICTED: serine/arginine-rich splicing fac...  69.3    2e-10   
ref|XP_006817575.1|  PREDICTED: RNA-binding protein lark-like iso...  67.4    2e-10   
emb|CEJ03729.1|  hypothetical protein RMCBS344292_17708               68.2    2e-10   
ref|XP_008206903.1|  PREDICTED: serine-arginine protein 55 isofor...  68.6    2e-10   
ref|XP_011055703.1|  PREDICTED: serine-arginine protein 55 isofor...  68.6    2e-10   
ref|XP_008206906.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    2e-10   
ref|XP_006566509.1|  PREDICTED: serine/arginine-rich splicing fac...  68.6    3e-10   
ref|XP_006566499.1|  PREDICTED: serine/arginine-rich splicing fac...  68.6    3e-10   
ref|XP_011055704.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
gb|EZA60838.1|  Serine/arginine-rich splicing factor                  68.2    3e-10   
ref|XP_002735598.1|  PREDICTED: RNA-binding protein lark-like iso...  67.0    3e-10   
ref|XP_008206901.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_006817576.1|  PREDICTED: RNA-binding protein lark-like iso...  66.6    3e-10   
ref|XP_011055701.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011351896.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011351893.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_001603815.2|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011505665.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011870998.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011351889.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011684836.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_006566504.1|  PREDICTED: serine/arginine-rich splicing fac...  68.2    3e-10   
ref|XP_011152764.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011055700.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
dbj|GAM20881.1|  hypothetical protein SAMD00019534_040560             67.4    3e-10   
ref|XP_011870996.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011264660.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011162309.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011505626.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011152762.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011055699.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    3e-10   
ref|XP_011264705.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    4e-10   
ref|XP_011870993.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    4e-10   
ref|XP_011264627.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    4e-10   
ref|XP_011162305.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    4e-10   
ref|XP_011152758.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    4e-10   
ref|XP_011055697.1|  PREDICTED: serine-arginine protein 55 isofor...  68.2    4e-10   
ref|XP_006566495.1|  PREDICTED: serine/arginine-rich splicing fac...  68.2    4e-10   
gb|EAX00364.1|  splicing factor, arginine/serine-rich 7, 35kDa, i...  65.1    4e-10   
ref|XP_005390948.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    4e-10   
dbj|BAC03661.1|  unnamed protein product                              65.1    4e-10   
dbj|BAC28058.1|  unnamed protein product                              65.1    5e-10   
gb|AAH27391.1|  Sfrs7 protein                                         65.1    5e-10   
emb|CEI87017.1|  hypothetical protein RMCBS344292_01438               67.0    5e-10   
ref|XP_002735599.1|  PREDICTED: RNA-binding protein lark-like iso...  66.2    5e-10   
emb|CEG69074.1|  hypothetical protein RMATCC62417_05215               67.0    5e-10   
gb|AAH99175.1|  Splicing factor, arginine/serine-rich 7               65.1    5e-10   
gb|EDL38512.1|  mCG17902, isoform CRA_k                               65.1    6e-10   
ref|XP_638672.1|  RNA-binding region RNP-1 domain-containing protein  67.4    6e-10   
ref|XP_002121806.1|  PREDICTED: serine/arginine-rich splicing fac...  65.9    7e-10   
ref|XP_011425563.1|  PREDICTED: serine/arginine-rich splicing fac...  66.6    7e-10   
ref|XP_002799297.1|  PREDICTED: splicing factor, arginine/serine-...  64.7    7e-10   
ref|XP_011940538.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    7e-10   
ref|XP_011425562.1|  PREDICTED: serine/arginine-rich splicing fac...  66.6    7e-10   
tpd|FAA00192.1|  TPA: zinc finger protein                             65.9    7e-10   
ref|XP_002590090.1|  hypothetical protein BRAFLDRAFT_83361            67.0    8e-10   
ref|XP_011310904.1|  PREDICTED: serine-arginine protein 55 isofor...  67.0    8e-10   
ref|XP_006151426.1|  PREDICTED: serine/arginine-rich splicing fac...  66.2    9e-10   
ref|XP_005390947.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    9e-10   
gb|AGM32299.1|  serine-arginine protein 55-like protein               65.9    9e-10   
ref|XP_003768907.1|  PREDICTED: serine/arginine-rich splicing fac...  65.5    9e-10   
ref|XP_006151425.1|  PREDICTED: serine/arginine-rich splicing fac...  66.2    9e-10   
ref|XP_011310898.1|  PREDICTED: serine-arginine protein 55 isofor...  67.0    9e-10   
ref|XP_006239708.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_010751870.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  67.0    1e-09   
ref|XP_006151424.1|  PREDICTED: serine/arginine-rich splicing fac...  66.2    1e-09   
ref|XP_001367778.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
gb|EDL38510.1|  mCG17902, isoform CRA_i                               64.7    1e-09   
gb|EDL38503.1|  mCG17902, isoform CRA_b                               64.7    1e-09   
ref|XP_002799299.1|  PREDICTED: splicing factor, arginine/serine-...  64.7    1e-09   
ref|XP_006909724.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_005073678.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_004765571.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_003473086.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_008252733.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_006083502.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_004711176.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_006239706.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_005073677.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_003795722.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_004336077.1|  RNA recognition motif domain containing protein  65.1    1e-09   
ref|XP_006151423.1|  PREDICTED: serine/arginine-rich splicing fac...  65.9    1e-09   
gb|EKC28616.1|  Splicing factor, arginine/serine-rich 4               67.0    1e-09   
gb|EDM02777.1|  rCG61762, isoform CRA_f                               64.7    1e-09   
ref|XP_003216148.2|  PREDICTED: serine/arginine-rich splicing fac...  65.5    1e-09   
ref|XP_011791336.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_007431750.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  65.1    1e-09   
ref|XP_004466068.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|NP_001182416.1|  serine/arginine-rich splicing factor 7 isofo...  65.1    1e-09   
ref|XP_004369601.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|NP_001182375.1|  serine/arginine-rich splicing factor 7 isofo...  65.1    1e-09   
ref|XP_008160447.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_002399999.1|  alternative splicing factor SRp20/9G8, putative  63.5    1e-09   
ref|XP_006909723.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_004686338.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_003125259.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_005264542.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_006083501.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|NP_001182415.1|  serine/arginine-rich splicing factor 7 isofo...  64.7    1e-09   
gb|ABR68245.1|  arginine/serine-rich 7 splicing factor                64.7    1e-09   
gb|AAH14857.1|  Sfrs7 protein                                         64.7    1e-09   
ref|XP_006083500.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_003473085.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_006676413.1|  hypothetical protein BATDEDRAFT_85071            67.0    1e-09   
ref|XP_001812208.1|  PREDICTED: serine-arginine protein 55-like i...  65.9    1e-09   
ref|XP_008160446.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_010594178.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_005073676.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_003473084.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_005073675.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_004711175.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_003795721.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|XP_003416134.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
emb|CDY45333.1|  BnaC01g30370D                                        63.2    1e-09   
ref|NP_001182414.1|  serine/arginine-rich splicing factor 7 isofo...  64.7    1e-09   
ref|XP_005073679.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_004466066.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    1e-09   
ref|NP_001029449.1|  serine/arginine-rich splicing factor 7           64.7    1e-09   
ref|XP_004466067.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_006909722.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_005212641.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_007521053.1|  PREDICTED: serine/arginine-rich splicing fac...  63.5    1e-09   
ref|XP_001362853.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_005264541.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_004369600.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|NP_001026854.1|  serine/arginine-rich splicing factor 7 isofo...  64.7    1e-09   
gb|ETN80482.1|  hypothetical protein NECAME_09155                     65.1    1e-09   
ref|XP_007477078.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_006083499.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    1e-09   
ref|XP_006266228.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    2e-09   
ref|NP_001182517.1|  splicing factor, arginine/serine-rich 7          64.7    2e-09   
ref|XP_006909721.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    2e-09   
ref|XP_004686337.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    2e-09   
gb|AAP36622.1|  Homo sapiens splicing factor, arginine/serine-ric...  64.7    2e-09   
ref|XP_004935328.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    2e-09   
ref|NP_666195.1|  serine/arginine-rich splicing factor 7 isoform 1    64.7    2e-09   
gb|EFA11531.1|  hypothetical protein TcasGA2_TC016051                 65.9    2e-09   
ref|XP_007969082.1|  PREDICTED: serine/arginine-rich splicing fac...  65.9    2e-09   
ref|XP_005576135.1|  PREDICTED: serine/arginine-rich splicing fac...  65.9    2e-09   
ref|XP_008200528.1|  PREDICTED: serine-arginine protein 55-like i...  65.9    2e-09   
ref|XP_001850202.1|  52K active chromatin boundary protein            66.2    2e-09   
ref|XP_003037447.1|  hypothetical protein SCHCODRAFT_104251           66.6    2e-09   
ref|XP_005576134.1|  PREDICTED: serine/arginine-rich splicing fac...  65.9    2e-09   
gb|EDL38513.1|  mCG17902, isoform CRA_l                               64.7    2e-09   
gb|EPQ06816.1|  Serine/arginine-rich splicing factor 7                64.7    2e-09   
ref|XP_003436863.1|  AGAP004592-PD                                    63.2    2e-09   
ref|XP_004935327.1|  PREDICTED: serine/arginine-rich splicing fac...  64.7    2e-09   
ref|XP_005864789.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    2e-09   
ref|XP_003216147.2|  PREDICTED: serine/arginine-rich splicing fac...  65.1    2e-09   
ref|XP_005576133.1|  PREDICTED: serine/arginine-rich splicing fac...  65.5    2e-09   
ref|XP_007969081.1|  PREDICTED: serine/arginine-rich splicing fac...  65.5    2e-09   
ref|XP_003436864.1|  AGAP004592-PC                                    62.8    2e-09   
ref|XP_005576132.1|  PREDICTED: serine/arginine-rich splicing fac...  65.5    2e-09   
ref|XP_005155255.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  64.3    2e-09   
ref|XP_006638601.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    2e-09   
ref|XP_005525416.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    2e-09   
ref|XP_005864788.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    2e-09   
ref|XP_005103718.1|  PREDICTED: serine/arginine-rich splicing fac...  65.9    2e-09   
ref|XP_008100901.1|  PREDICTED: serine/arginine-rich splicing fac...  65.1    2e-09   
ref|XP_005489408.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    2e-09   
ref|XP_006024998.1|  PREDICTED: serine/arginine-rich splicing fac...  63.9    2e-09   
ref|XP_008165289.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    2e-09   
ref|XP_008165291.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    2e-09   
ref|XP_009008916.1|  hypothetical protein HELRODRAFT_62194            63.5    3e-09   
ref|XP_006007835.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    3e-09   
ref|XP_003640982.1|  PREDICTED: serine/arginine-rich splicing fac...  64.3    3e-09   
dbj|BAG57113.1|  unnamed protein product                              63.2    3e-09   
ref|NP_001232123.1|  putative splicing factor arginine/serine-ric...  64.3    3e-09   
ref|XP_006024996.1|  PREDICTED: serine/arginine-rich splicing fac...  63.9    3e-09   



>ref|XP_009765001.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Nicotiana sylvestris]
Length=319

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G++TRLYVGHLSSRTRSRDLER+F KYGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDRSGNSTRLYVGHLSSRTRSRDLERVFSKYGRVRDVDMKHDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+VDGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+EGHWARDCKA
Sbjct  61   ARYYLDGRDVDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGLEGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE KCPNSP+KL
Sbjct  121  GDWKNKCYRCGERGHIEKKCPNSPKKL  147



>ref|XP_004246725.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X1 [Solanum lycopersicum]
Length=315

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G++TRLYVGHLSSRTRSRDLER F KYGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDRVGNSTRLYVGHLSSRTRSRDLERAFSKYGRVRDVDMKHDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+EGHWARDCKA
Sbjct  61   ARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGLEGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE KCPNSP+KL R
Sbjct  121  GDWKNKCYRCGERGHIERKCPNSPKKLSR  149



>ref|XP_009593629.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X1 [Nicotiana tomentosiformis]
Length=317

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G++TRLYVGHLSSRTRSRDLER+F KYGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDRSGNSTRLYVGHLSSRTRSRDLERVFSKYGRVRDVDMKHDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+VDGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+EGHWARDCKA
Sbjct  61   ARYYLDGRDVDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGLEGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE KCPNSP+KL
Sbjct  121  GDWKNKCYRCGERGHIEKKCPNSPKKL  147



>emb|CDP06673.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVGHLSSRTRSRDLE LF +YGRVRDVDMK+D+AF+DFSDPRDADD
Sbjct  1    MPRYDDRYGNTTRLYVGHLSSRTRSRDLEHLFSRYGRVRDVDMKQDFAFVDFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            A    +GREVDGRRIIVE AKGVPRGPGG R+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  61   AIYSLNGREVDGRRIIVELAKGVPRGPGGVREYLGRGPPPGSGRCFNCGLDGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  121  GDWKNKCYRCGERGHIERNCKNSPKKLRRG  150



>ref|XP_010326036.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X2 [Solanum lycopersicum]
Length=314

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G++TRLYVGHLSSRTRSRDLER F KYGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDRVGNSTRLYVGHLSSRTRSRDLERAFSKYGRVRDVDMKHDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+EGHWARDCKA
Sbjct  61   ARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGLEGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE KCPNSP+KL R 
Sbjct  121  GDWKNKCYRCGERGHIERKCPNSPKKLRRS  150



>ref|XP_006345685.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Solanum tuberosum]
Length=315

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G++TRLYVGHLSSRTRSRDLER F KYGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDRMGNSTRLYVGHLSSRTRSRDLERAFSKYGRVRDVDMKHDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+EGHWARDCKA
Sbjct  61   ARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGLEGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE KCPNSP+K+ R
Sbjct  121  GDWKNKCYRCGERGHIERKCPNSPKKVSR  149



>ref|XP_006345686.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Solanum tuberosum]
Length=314

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G++TRLYVGHLSSRTRSRDLER F KYGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDRMGNSTRLYVGHLSSRTRSRDLERAFSKYGRVRDVDMKHDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+EGHWARDCKA
Sbjct  61   ARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGLEGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE KCPNSP+K+ R 
Sbjct  121  GDWKNKCYRCGERGHIERKCPNSPKKVRRS  150



>ref|XP_011094784.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like [Sesamum 
indicum]
Length=314

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRY+DRYGS TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYEDRYGSTTRLYVGHLSSRTRSRDLEHIFSRYGRVRDVDMKRDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDGRRIIVEFAKGVPRGPGG R+Y+GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  61   ARYNLDGRDVDGRRIIVEFAKGVPRGPGGVREYVGRGPAPGSGRCFNCGIDGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  121  GDWKNKCYRCGERGHIERNCQNSPKKL  147



>gb|KJB73660.1| hypothetical protein B456_011G242700 [Gossypium raimondii]
Length=303

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR GS TRLYVGHLSSRTRSRDLE +F +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRGSGTRLYVGHLSSRTRSRDLEDMFSRYGRIRDVDMKRDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDYLGRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  61   ARYSLNGRDLDGSRIIVEFAKGVPRGPGGSRDYLGRGPTPGSGRCFNCGIDGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  121  GDWKNKCYRCGERGHIERNCQNSPKKL  147



>gb|KJB73656.1| hypothetical protein B456_011G242700 [Gossypium raimondii]
Length=304

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR GS TRLYVGHLSSRTRSRDLE +F +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRGSGTRLYVGHLSSRTRSRDLEDMFSRYGRIRDVDMKRDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDYLGRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  61   ARYSLNGRDLDGSRIIVEFAKGVPRGPGGSRDYLGRGPTPGSGRCFNCGIDGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  121  GDWKNKCYRCGERGHIERNCQNSPKKL  147



>gb|EPS69715.1| hypothetical protein M569_05051 [Genlisea aurea]
Length=318

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRY+DRYGS TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYEDRYGSTTRLYVGHLSSRTRSRDLEHIFSRYGRVRDVDMKRDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDGRRI VEFAKGVPRGPGG R+Y+GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  61   ARYNLDGRDVDGRRITVEFAKGVPRGPGGVREYVGRGPAPGSGRCFNCGIDGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQK  533
            GDWKNKCYRCGERGHIE  CPNSP+K
Sbjct  121  GDWKNKCYRCGERGHIERNCPNSPKK  146



>ref|XP_009384815.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009384817.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009384818.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009384819.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=315

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTRSRDLE LF +YGRVRDVDMK DYAFI+FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRSRDLEDLFSRYGRVRDVDMKHDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GRE DG RIIVEFAKG+PRG GGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGREFDGSRIIVEFAKGIPRGSGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+ L RG
Sbjct  120  GDWKNKCYRCGERGHIERNCHNSPKTLKRG  149



>ref|XP_010101505.1| Serine/arginine-rich splicing factor 4 [Morus notabilis]
 gb|EXB88502.1| Serine/arginine-rich splicing factor 4 [Morus notabilis]
Length=313

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTRSRDLE LF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRSRDLEDLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG R+IVE AKG PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYALNGRDVDGSRVIVEVAKGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKL  146



>emb|CDP00008.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 136/152 (89%), Gaps = 3/152 (2%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR+G  TRLYVG LSSRTRSRDLE LF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRHG-VTRLYVGRLSSRTRSRDLEDLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD--YLGRGPPPGSGRCFNCGIEGHWARDC  449
            AR   +GREVDG RIIVEFAKGVPRGPGGSRD  YLG+GP PG+GRCFNCGI+GHWARDC
Sbjct  60   ARYSMNGREVDGSRIIVEFAKGVPRGPGGSRDRDYLGKGPAPGTGRCFNCGIDGHWARDC  119

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            KAGDWKNKCYRCGERGHIE  C NSPQKL RG
Sbjct  120  KAGDWKNKCYRCGERGHIERNCQNSPQKLKRG  151



>gb|KJB76484.1| hypothetical protein B456_012G091800 [Gossypium raimondii]
 gb|KJB76485.1| hypothetical protein B456_012G091800 [Gossypium raimondii]
Length=303

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRTRSRDLE +F +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRSSGTRLYVGHLSSRTRSRDLEDMFRRYGRIRDVDMKRDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG RI+VEFAKGVPRGPGGSRDY GRGP PG+GRCFNCGI+GHWARDCKA
Sbjct  61   ARYSLNGRDLDGSRIVVEFAKGVPRGPGGSRDYPGRGPAPGAGRCFNCGIDGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  121  GDWKNKCYRCGERGHIERNCQNSPKKL  147



>ref|XP_006381987.1| zinc knuckle family protein [Populus trichocarpa]
 gb|ERP59784.1| zinc knuckle family protein [Populus trichocarpa]
Length=181

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 135/150 (90%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHL++RTRSRDLE LF KYGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYAS-TRLYVGHLAARTRSRDLEHLFSKYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DG+E DG RIIVEFAKGVPRG   SR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARHYLDGKEFDGSRIIVEFAKGVPRG---SREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLTRG  146



>ref|XP_006843673.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 [Amborella 
trichopoda]
 gb|ERN05348.1| hypothetical protein AMTR_s00007p00189640 [Amborella trichopoda]
Length=320

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYGS+TRLYVG LSSRTRSRDLE LF +YGRVRDVD+K D+AFI+FSDPRDADD
Sbjct  1    MPRYDDRYGSSTRLYVGRLSSRTRSRDLEDLFSRYGRVRDVDLKHDFAFIEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GRE DG RIIVEFAKG PRG GGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  61   ARYSLNGREFDGSRIIVEFAKGGPRGAGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  120

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+ L
Sbjct  121  GDWKNKCYRCGERGHIERNCQNSPKSL  147



>ref|XP_010922450.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Elaeis guineensis]
Length=308

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTR RDLE LF +YGRVRDVDMKRDYAFI+FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRPRDLEDLFSRYGRVRDVDMKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG RIIVEFA+G PRGP GSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGSRIIVEFARGGPRGPRGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+ L RG
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKNLKRG  149



>ref|XP_002308490.2| hypothetical protein POPTR_0006s23170g [Populus trichocarpa]
 gb|EEE92013.2| hypothetical protein POPTR_0006s23170g [Populus trichocarpa]
Length=293

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 135/150 (90%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHL++RTRSRDLE LF KYGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYAS-TRLYVGHLAARTRSRDLEHLFSKYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DG+E DG RIIVEFAKGVPRG   SR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARHYLDGKEFDGSRIIVEFAKGVPRG---SREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLTRG  146



>ref|XP_011019269.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine-rich splicing 
factor RS2Z33 [Populus euphratica]
Length=295

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 135/150 (90%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHL++RTRSRDLE LF KYGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYAS-TRLYVGHLAARTRSRDLEHLFSKYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DG+E DG RIIVEFAKGVPRG   SR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARHYLDGKEFDGSRIIVEFAKGVPRG---SREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLTRG  146



>ref|XP_008783623.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Phoenix dactylifera]
Length=302

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTR R+LE LF +YGRVRDVDMKRDYAFI+FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRPRELEDLFSRYGRVRDVDMKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG RIIVEFA+G PRGP GSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGSRIIVEFARGGPRGPRGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+ L RG
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKSLRRG  149



>gb|KJB67669.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
Length=302

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRG-GTRLYVGHLSSRTRSRDLEDMFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDY GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDLDGCRIIVEFAKGVPRGPGGSRDYAGRGPTPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERDCQNSPKKL  146



>gb|KJB67670.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
Length=303

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRG-GTRLYVGHLSSRTRSRDLEDMFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDY GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDLDGCRIIVEFAKGVPRGPGGSRDYAGRGPTPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERDCQNSPKKL  146



>gb|EYU41659.1| hypothetical protein MIMGU_mgv1a011263mg [Erythranthe guttata]
Length=287

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRY+DRYGS TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYEDRYGSTTRLYVGHLSSRTRSRDLEHVFSRYGRVRDVDMKRDYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRG--PPPGSGRCFNCGIEGHWARDC  449
            AR   DGR+VDGRRIIVEFAKGVPRG GG+R+Y G G  P PGSGRCFNCG++GHWARDC
Sbjct  61   ARYSMDGRDVDGRRIIVEFAKGVPRGSGGAREYAGAGRDPAPGSGRCFNCGLDGHWARDC  120

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            KAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  121  KAGDWKNKCYRCGERGHIERSCQNSPKKL  149



>gb|KJB67668.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
 gb|KJB67673.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
Length=304

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRG-GTRLYVGHLSSRTRSRDLEDMFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDY GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDLDGCRIIVEFAKGVPRGPGGSRDYAGRGPTPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERDCQNSPKKL  146



>gb|KJB67671.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
 gb|KJB67672.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
 gb|KJB67674.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
Length=305

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRG-GTRLYVGHLSSRTRSRDLEDMFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDY GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDLDGCRIIVEFAKGVPRGPGGSRDYAGRGPTPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERDCQNSPKKL  146



>ref|XP_012082225.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X1 [Jatropha curcas]
 ref|XP_012082226.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X2 [Jatropha curcas]
 gb|KDP29037.1| hypothetical protein JCGZ_16426 [Jatropha curcas]
Length=297

 Score =   231 bits (590),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 135/150 (90%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY + TRLYVGHL+SRTRSRDLE LF KYGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYAN-TRLYVGHLASRTRSRDLEYLFSKYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR + DG++ DG RIIVEFAKGVPRG   SR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYHLDGKDFDGSRIIVEFAKGVPRG---SREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLKRG  146



>ref|XP_004960314.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Setaria 
italica]
Length=314

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG LSSRTRSRDLE LF KYGR+R+V++KRDYAFI+FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLSSRTRSRDLEYLFSKYGRIREVELKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            A+   DGREVDG RIIVEFAKGVPRG GGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   AQYNLDGREVDGSRIIVEFAKGVPRGAGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRNLRR  148



>ref|XP_011048452.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Populus euphratica]
Length=290

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 134/149 (90%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHL++RTRSRDLE LF KYGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYAS-TRLYVGHLAARTRSRDLEHLFSKYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DG+E DG RIIVEFAKGVPRG   SR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARHYLDGKEFDGSRIIVEFAKGVPRG---SREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL +
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLTK  145



>ref|NP_001054489.1| Os05g0120100 [Oryza sativa Japonica Group]
 dbj|BAF16403.1| Os05g0120100 [Oryza sativa Japonica Group]
 gb|EEE62137.1| hypothetical protein OsJ_16924 [Oryza sativa Japonica Group]
Length=323

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYGS TRLYVG LSSRTRSRDLE  F +YGR+R+V++KRDYAFI+FSDPRDA++
Sbjct  1    MPRYDDRYGS-TRLYVGRLSSRTRSRDLEYHFSRYGRIREVELKRDYAFIEFSDPRDAEE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VEFAKGVPRGPGGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGRDVDGSRILVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRNLRR  148



>gb|KJB78863.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
Length=304

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRG-GTRLYVGHLSSRTRSRDLEDMFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG R+IVEFAKGVPRG GGSRDY GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYALNGRDMDGSRMIVEFAKGVPRGSGGSRDYPGRGPTPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKL  146



>gb|EAY96334.1| hypothetical protein OsI_18237 [Oryza sativa Indica Group]
Length=331

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYGS TRLYVG LSSRTRSRDLE  F +YGR+R+V++KRDYAFI+FSDPRDA++
Sbjct  9    MPRYDDRYGS-TRLYVGRLSSRTRSRDLEYHFSRYGRIREVELKRDYAFIEFSDPRDAEE  67

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VEFAKGVPRGPGGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  68   ARYNLDGRDVDGSRILVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA  127

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  128  GDWKNKCYRCGERGHIERNCQNSPRNLRR  156



>gb|KJB78864.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
Length=305

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRG-GTRLYVGHLSSRTRSRDLEDMFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG R+IVEFAKGVPRG GGSRDY GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYALNGRDMDGSRMIVEFAKGVPRGSGGSRDYPGRGPTPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKL  146



>ref|XP_002322837.2| hypothetical protein POPTR_0016s08250g [Populus trichocarpa]
 gb|EEF04598.2| hypothetical protein POPTR_0016s08250g [Populus trichocarpa]
Length=290

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 134/149 (90%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHL++RTRSRDLE LF KYGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYAS-TRLYVGHLAARTRSRDLEHLFSKYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DG++ DG RIIVEFAKGVPRG   SR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARHYLDGKDFDGSRIIVEFAKGVPRG---SREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL +
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLTK  145



>gb|KJB78861.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
 gb|KJB78868.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
Length=306

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRRG-GTRLYVGHLSSRTRSRDLEDMFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR++DG R+IVEFAKGVPRG GGSRDY GRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYALNGRDMDGSRMIVEFAKGVPRGSGGSRDYPGRGPTPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKL  146



>ref|XP_002525221.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
 gb|EEF37187.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
Length=305

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRY+DRY + TRLYVGHL+SRTRSRDLE LF KYGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYEDRYAN-TRLYVGHLASRTRSRDLEYLFSKYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR + DG+++DG RIIVEFAKGVPRG   SR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYHLDGKDLDGSRIIVEFAKGVPRG---SREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLKRG  146



>gb|AGE46112.1| arginine/serine-rich splicing factor R2SZ35 transcript I [Sorghum 
bicolor]
Length=312

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG L+ RTRSRDLE LF KYGR+R+V++KRDYAFI+FSDP DADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLAPRTRSRDLEYLFSKYGRIREVELKRDYAFIEFSDPHDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            A+   DGREVDG RIIVEFAKGVPRG GGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   AQYNLDGREVDGSRIIVEFAKGVPRGSGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRNLRR  148



>ref|XP_008445806.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Cucumis melo]
 ref|XP_008445807.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Cucumis melo]
 ref|XP_008445808.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Cucumis melo]
Length=309

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG LSSRTRSRDL+ LF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLSSRTRSRDLDDLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+V G RIIVE AKGVPRGPGGSR+YLGRG PPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDVHGSRIIVEIAKGVPRGPGGSREYLGRG-PPGTGRCFNCGIDGHWARDCKA  118

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  119  GDWKNKCYRCGERGHIEKNCQNSPKKLKRG  148



>ref|XP_007009623.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 4 [Theobroma cacao]
 gb|EOY18433.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 4 [Theobroma cacao]
Length=299

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRTRSRDLE +F +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRR-SGTRLYVGHLSSRTRSRDLEDMFSRYGRIRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR-GPPPGSGRCFNCGIEGHWARDCK  452
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDY GR GP PGSGRCFNCGI+GHWARDCK
Sbjct  60   ARYALNGRDLDGSRIIVEFAKGVPRGPGGSRDYPGRGGPTPGSGRCFNCGIDGHWARDCK  119

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            AGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  AGDWKNKCYRCGERGHIERNCQNSPKKL  147



>ref|XP_007009620.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 1 [Theobroma cacao]
 gb|EOY18430.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 1 [Theobroma cacao]
Length=304

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRTRSRDLE +F +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRR-SGTRLYVGHLSSRTRSRDLEDMFSRYGRIRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR-GPPPGSGRCFNCGIEGHWARDCK  452
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDY GR GP PGSGRCFNCGI+GHWARDCK
Sbjct  60   ARYALNGRDLDGSRIIVEFAKGVPRGPGGSRDYPGRGGPTPGSGRCFNCGIDGHWARDCK  119

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            AGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  AGDWKNKCYRCGERGHIERNCQNSPKKL  147



>ref|XP_007009622.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 3 [Theobroma cacao]
 gb|EOY18432.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 3 [Theobroma cacao]
Length=302

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRTRSRDLE +F +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRR-SGTRLYVGHLSSRTRSRDLEDMFSRYGRIRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR-GPPPGSGRCFNCGIEGHWARDCK  452
            AR   +GR++DG RIIVEFAKGVPRGPGGSRDY GR GP PGSGRCFNCGI+GHWARDCK
Sbjct  60   ARYALNGRDLDGSRIIVEFAKGVPRGPGGSRDYPGRGGPTPGSGRCFNCGIDGHWARDCK  119

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            AGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  AGDWKNKCYRCGERGHIERNCQNSPKKL  147



>ref|XP_004143594.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Cucumis sativus]
 ref|XP_004143595.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Cucumis sativus]
Length=309

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG LSSRTRSRDL+ LF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLSSRTRSRDLDDLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+V G RIIVE AKGVPRGPGGSR+YLGRG PPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDVHGSRIIVEIAKGVPRGPGGSREYLGRG-PPGTGRCFNCGIDGHWARDCKA  118

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  119  GDWKNKCYRCGERGHIEKNCQNSPKKLKRG  148



>ref|XP_006653980.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Oryza 
brachyantha]
Length=330

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTRSRDLE LF +YGR+R+V++KRDYAFI+FSD RDA+D
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRSRDLEYLFSRYGRIREVELKRDYAFIEFSDSRDAED  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VEFAKGVPRGPGGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGRDVDGSRILVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRNLRR  148



>ref|XP_004960312.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Setaria italica]
 ref|XP_004960313.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Setaria italica]
Length=334

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYGS TRLYVG L+SRTRSRDLE LF +YGR+R+V++KRDYAFI+FSDPRDADD
Sbjct  1    MPRYDDRYGS-TRLYVGRLASRTRSRDLEYLFSRYGRIREVELKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DG++VDG  IIVEFAKGVPRGPGGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGKDVDGSHIIVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ + R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRSVRR  148



>ref|XP_004493916.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X3 [Cicer arietinum]
Length=296

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 4/152 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LSSRTRSRDLER+F +YGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSSRTRSRDLERVFSRYGRVRDVDMKHDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD---YLGRGPPPGSGRCFNCGIEGHWARD  446
            AR   DGR+VDG R+IVEFAKGVPRG   SRD   YLGRGPPPGSGRCFNCGI+GHWARD
Sbjct  60   ARYNLDGRDVDGSRLIVEFAKGVPRGSRDSRDSREYLGRGPPPGSGRCFNCGIDGHWARD  119

Query  447  CKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            CKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  CKAGDWKNKCYRCGERGHIEKNCKNSPKKLSR  151



>ref|XP_008371111.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Malus domestica]
Length=300

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDR+G  +RLYVG LSSRTRSR+LE +F +YGRVRDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRHDDRHG-GSRLYVGRLSSRTRSRELEDVFSRYGRVRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRIIVEFARGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+K  +
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKTTK  148



>ref|XP_009335940.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Pyrus x bretschneideri]
Length=306

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDR+G  +RLYVG LSSRTRSR+LE +F +YGRVRDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRHDDRHG-GSRLYVGRLSSRTRSRELEDVFSRYGRVRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRIIVEFARGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+K  +
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKTTK  148



>ref|XP_010067232.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X4 [Eucalyptus grandis]
Length=327

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRT++RDLE LF +YGR+R VDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRR-SNTRLYVGHLSSRTKTRDLEDLFARYGRIRAVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+  G RIIVEF+KG PR PGGSRDY+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGRDFKGSRIIVEFSKGTPRAPGGSRDYMGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRKLRR  148



>ref|XP_010067231.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Eucalyptus grandis]
 gb|KCW65329.1| hypothetical protein EUGRSUZ_G02779 [Eucalyptus grandis]
Length=328

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRT++RDLE LF +YGR+R VDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRR-SNTRLYVGHLSSRTKTRDLEDLFARYGRIRAVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+  G RIIVEF+KG PR PGGSRDY+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGRDFKGSRIIVEFSKGTPRAPGGSRDYMGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRKLRR  148



>ref|XP_006604540.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Glycine max]
Length=285

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 133/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVGHLSSRTRSRDLER F +YGRVR VDMK D+AF+DFSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGHLSSRTRSRDLERAFSRYGRVRGVDMKNDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RIIVEFAKG PRG   SR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYNLDGRDVDGSRIIVEFAKGAPRG---SREYLGRGPPPGSGRCFNCGLDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRRG  146



>ref|XP_008366711.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine-rich splicing 
factor RS2Z33-like [Malus domestica]
Length=179

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTRSRDLERLF +YGRVRDVDMKR++AF+DFSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRSRDLERLFNRYGRVRDVDMKREFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG R+IVEFAKG PRG   SR+YLGRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGSRLIVEFAKGAPRG---SREYLGRGPTPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE +C NSP++L RG
Sbjct  117  GDWKNKCYRCGERGHIERQCKNSPKELSRG  146



>ref|XP_010086758.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
 gb|EXB23437.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
Length=301

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 134/149 (90%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTRSRDLERLF +YGRVRDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRSRDLERLFSRYGRVRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE+DG RIIVEF+KG PRG   SR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYSLDGRELDGTRIIVEFSKGTPRG---SREYLGRGPPPGSGRCFNCGLDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE +C NSP+ L R
Sbjct  117  GDWKNKCYRCGERGHIERQCKNSPKDLRR  145



>gb|KGN50491.1| hypothetical protein Csa_5G177110 [Cucumis sativus]
Length=371

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 135/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  87   WVNMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrd  266
            +  MPRYDDRYG  TRLYVG LSSRTRSRDL+ LF +YGRVRDVDMKRDYAF++FSDPRD
Sbjct  60   FYKMPRYDDRYG-GTRLYVGRLSSRTRSRDLDDLFSRYGRVRDVDMKRDYAFVEFSDPRD  118

Query  267  addarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARD  446
            ADDAR   +GR+V G RIIVE AKGVPRGPGGSR+YLGRG PPG+GRCFNCGI+GHWARD
Sbjct  119  ADDARYSLNGRDVHGSRIIVEIAKGVPRGPGGSREYLGRG-PPGTGRCFNCGIDGHWARD  177

Query  447  CKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            CKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  178  CKAGDWKNKCYRCGERGHIEKNCQNSPKKLKRG  210



>gb|EYU38493.1| hypothetical protein MIMGU_mgv1a008403mg [Erythranthe guttata]
Length=374

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  90   VNMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrda  269
            + MPRYDD     TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDA
Sbjct  47   LRMPRYDD--SGNTRLYVGHLSSRTRSRDLEHVFSRYGRVRDVDMKRDYAFVEFSDPRDA  104

Query  270  ddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDC  449
            DDAR   DGR+VDGRRI VEFAKG+PRGPGG R+Y+GRGP PGSGRCFNCGI+GHWARDC
Sbjct  105  DDARYSLDGRDVDGRRITVEFAKGIPRGPGGVREYVGRGPAPGSGRCFNCGIDGHWARDC  164

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            KAGDWKNKCYRCGERGH+E  C NSP+KL
Sbjct  165  KAGDWKNKCYRCGERGHVERNCQNSPKKL  193



>ref|XP_004493914.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Cicer arietinum]
 ref|XP_004493915.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Cicer arietinum]
Length=297

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 133/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LSSRTRSRDLER+F +YGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSSRTRSRDLERVFSRYGRVRDVDMKHDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD---YLGRGPPPGSGRCFNCGIEGHWARD  446
            AR   DGR+VDG R+IVEFAKGVPRG   SRD   YLGRGPPPGSGRCFNCGI+GHWARD
Sbjct  60   ARYNLDGRDVDGSRLIVEFAKGVPRGSRDSRDSREYLGRGPPPGSGRCFNCGIDGHWARD  119

Query  447  CKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            CKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  CKAGDWKNKCYRCGERGHIEKNCKNSPKKL  149



>ref|XP_009357625.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Pyrus x bretschneideri]
Length=315

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  93   NMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdad  272
             MPR+DDR G  +RLYVG LSSRTRSR+LE +F +YGRVRDVDMKRD+AF++FSDPRDAD
Sbjct  9    TMPRHDDRNG-GSRLYVGRLSSRTRSRELEDVFSRYGRVRDVDMKRDFAFVEFSDPRDAD  67

Query  273  darryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            DAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCK
Sbjct  68   DARYSLNGRDVDGSRIIVEFARGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCK  127

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCGERGHIE  C NSP+K  +
Sbjct  128  AGDWKNKCYRCGERGHIERNCQNSPKKTTK  157



>gb|ACU22814.1| unknown [Glycine max]
 gb|ACU22820.1| unknown [Glycine max]
 gb|ACU22828.1| unknown [Glycine max]
 gb|ACU24482.1| unknown [Glycine max]
Length=167

 Score =   222 bits (565),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVGHLSSRTRSRDLER F +YGRVR VDMK D+AF+DFSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGHLSSRTRSRDLERAFSRYGRVRGVDMKNDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RIIVEFAKG PRG   SR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYNLDGRDVDGSRIIVEFAKGAPRG---SREYLGRGPPPGSGRCFNCGLDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+K+
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKI  143



>ref|XP_009357626.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Pyrus x bretschneideri]
Length=313

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  93   NMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdad  272
             MPR+DDR G  +RLYVG LSSRTRSR+LE +F +YGRVRDVDMKRD+AF++FSDPRDAD
Sbjct  7    TMPRHDDRNG-GSRLYVGRLSSRTRSRELEDVFSRYGRVRDVDMKRDFAFVEFSDPRDAD  65

Query  273  darryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            DAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCK
Sbjct  66   DARYSLNGRDVDGSRIIVEFARGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCK  125

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCGERGHIE  C NSP+K  +
Sbjct  126  AGDWKNKCYRCGERGHIERNCQNSPKKTTK  155



>ref|XP_008233520.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Prunus mume]
Length=301

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDR+G  +RLYVG LSSRTRSR+LE +F +YGRVRDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRHDDRHG-GSRLYVGRLSSRTRSRELEDVFSRYGRVRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG R+IVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRLIVEFARGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+K 
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKT  146



>ref|XP_007218729.1| hypothetical protein PRUPE_ppa009074mg [Prunus persica]
 gb|EMJ19928.1| hypothetical protein PRUPE_ppa009074mg [Prunus persica]
Length=307

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDR+G  +RLYVG LSSRTRSR+LE +F +YGRVRDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRHDDRHG-GSRLYVGRLSSRTRSRELEDVFSRYGRVRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG R+IVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRLIVEFARGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+K 
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKT  146



>ref|XP_010909639.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like [Elaeis 
guineensis]
Length=309

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG LSSRTR RDLE LF +YGRVRDVDMKRDYAFI+FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLSSRTRPRDLEDLFSRYGRVRDVDMKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG R+IVEFA+G PRGP GSR+Y+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGSRMIVEFARGGPRGPRGSREYIGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP+
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPK  144



>ref|XP_008359700.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Malus domestica]
Length=309

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTRSRDLERLF +YGRVRDVDMKR++AF+DFSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRSRDLERLFNRYGRVRDVDMKREFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG R+IVEFAKG PRG   SR+YLGRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGSRLIVEFAKGAPRG---SREYLGRGPTPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE +C NSP++L RG
Sbjct  117  GDWKNKCYRCGERGHIERQCKNSPKELSRG  146



>ref|XP_010553022.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010553023.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Tarenaya hassleriana]
Length=280

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S+TRLYVGHLSSRTRSRDLE+LF KYGRVRDVDMKRDYAF+DFSDPRDADD
Sbjct  1    MPRYDDRY-SSTRLYVGHLSSRTRSRDLEQLFAKYGRVRDVDMKRDYAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ DG RIIVEFA+G PRG   SR+Y  RGPPPG+GRCFNCG++GHWARDC A
Sbjct  60   ARHRLDGRDFDGSRIIVEFARGTPRG---SREYSSRGPPPGTGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>ref|NP_001132009.1| uncharacterized protein LOC100193414 [Zea mays]
 gb|ACF80676.1| unknown [Zea mays]
 gb|AFW74821.1| hypothetical protein ZEAMMB73_961242 [Zea mays]
 gb|AGE46056.1| arginine/serine-rich splicing factor RS2Z35 transcript I [Zea 
mays]
Length=314

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR+G+ TRLYVG L+ RTRSRDLE LF KYGR+R+V++KRDYAFI+FSDPRDADD
Sbjct  1    MPRYDDRHGN-TRLYVGRLAPRTRSRDLEYLFSKYGRIREVELKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            A+   DGREVDG RIIVEFAKGVPRG GGSR+Y+GRGPPPG+GRCFNCG++GHWARDCKA
Sbjct  60   AQYNLDGREVDGSRIIVEFAKGVPRGSGGSREYMGRGPPPGTGRCFNCGMDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGE GHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGESGHIERNCQNSPRNLRR  148



>ref|XP_003521358.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X1 [Glycine max]
 gb|KHN09452.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=287

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVGHLSSRTRSRDLER F +YGRVR VDMK D+AF+DFSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGHLSSRTRSRDLERAFSRYGRVRGVDMKNDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RIIVEFAKG PRG   SR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYNLDGRDVDGSRIIVEFAKGAPRG---SREYLGRGPPPGSGRCFNCGLDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKL  143



>ref|XP_009341794.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Pyrus x bretschneideri]
Length=309

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTRSRDLERLF +YGRVRDVDMKR++AF+DFSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRSRDLERLFNRYGRVRDVDMKREFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG R+IVEFAKG PRG   SR+YLGRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGSRLIVEFAKGAPRG---SREYLGRGPTPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE +C NSP++L RG
Sbjct  117  GDWKNKCYRCGERGHIERQCKNSPKELSRG  146



>ref|XP_008647386.1| PREDICTED: uncharacterized protein LOC100193414 isoform X1 [Zea 
mays]
Length=377

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  93   NMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdad  272
            +MPRYDDR+G+ TRLYVG L+ RTRSRDLE LF KYGR+R+V++KRDYAFI+FSDPRDAD
Sbjct  63   DMPRYDDRHGN-TRLYVGRLAPRTRSRDLEYLFSKYGRIREVELKRDYAFIEFSDPRDAD  121

Query  273  darryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            DA+   DGREVDG RIIVEFAKGVPRG GGSR+Y+GRGPPPG+GRCFNCG++GHWARDCK
Sbjct  122  DAQYNLDGREVDGSRIIVEFAKGVPRGSGGSREYMGRGPPPGTGRCFNCGMDGHWARDCK  181

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCGE GHIE  C NSP+ L R
Sbjct  182  AGDWKNKCYRCGESGHIERNCQNSPRNLRR  211



>ref|XP_003554343.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Glycine max]
Length=287

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVGHLSSRTRSRDLER F +YGRVR VDMK D+AF+DFSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGHLSSRTRSRDLERAFSRYGRVRGVDMKNDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RIIVEFAKG PRG   SR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYNLDGRDVDGSRIIVEFAKGAPRG---SREYLGRGPPPGSGRCFNCGLDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKL  143



>ref|XP_008655203.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACR38181.1| unknown [Zea mays]
 gb|AFW82803.1| hypothetical protein ZEAMMB73_678679 [Zea mays]
 gb|AGE46049.1| arginine/serine-rich splicing factor RS2Z37A transcript I [Zea 
mays]
Length=325

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR DDRYG+ TRLYVG LS RTRSRDLE LF KYGR+R+V++KRDYAFI+FSDPRDADD
Sbjct  1    MPRNDDRYGN-TRLYVGRLSPRTRSRDLEYLFSKYGRIREVELKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            A+   DGR+VDG RIIVEFAKGVPRG GGSRDY GRGPPPG+GRCFNCG++GHWARDC+A
Sbjct  60   AQYNLDGRDVDGSRIIVEFAKGVPRGSGGSRDYNGRGPPPGTGRCFNCGVDGHWARDCQA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRNLRR  148



>ref|XP_003569022.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 [Brachypodium 
distachyon]
Length=335

 Score =   225 bits (574),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  +RLYVG LSSRTR+RDLE LF +YGR+R+V++KRDYAFI++SDPRDADD
Sbjct  1    MPRYDDRYG-KSRLYVGRLSSRTRTRDLEYLFSRYGRIREVELKRDYAFIEYSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD--YLGRGPPPGSGRCFNCGIEGHWARDC  449
            A+   DGR+VDG RIIVEFAKG+PRGPGGSR+  Y+GRGPPPG+GRCFNCGI+GHWARDC
Sbjct  60   AQYNLDGRDVDGSRIIVEFAKGIPRGPGGSREREYMGRGPPPGTGRCFNCGIDGHWARDC  119

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            KAGDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  KAGDWKNKCYRCGERGHIERNCQNSPRSLRR  150



>gb|AFK42610.1| unknown [Medicago truncatula]
Length=305

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 4/152 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LSSRTRSRDLER+F +YG VRDVDMK DYAF++F DPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSSRTRSRDLERVFSRYGSVRDVDMKHDYAFVEFRDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD---YLGRGPPPGSGRCFNCGIEGHWARD  446
            AR   DGR++DG R+IVEFAKGVPRG   SRD   YLGRGPPPGSGRCFNCGI+GHWARD
Sbjct  60   ARYNLDGRDIDGSRLIVEFAKGVPRGSRDSRDSREYLGRGPPPGSGRCFNCGIDGHWARD  119

Query  447  CKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            CKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  CKAGDWKNKCYRCGERGHIEKNCKNSPKKLSR  151



>ref|XP_008776205.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Phoenix dactylifera]
Length=308

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G  TRLYVG LSSRTR RDLE LF +YGRVRDVDMKRDYAFI+FSDPRDADD
Sbjct  1    MPRYDDRSG-GTRLYVGRLSSRTRPRDLEDLFSRYGRVRDVDMKRDYAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG RIIVEFA+G PRGP GSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGGRIIVEFARGGPRGPRGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+ +
Sbjct  120  GDWKNKCYRCGERGHIERDCQNSPKNI  146



>ref|XP_010067229.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW65328.1| hypothetical protein EUGRSUZ_G02779 [Eucalyptus grandis]
Length=332

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 132/153 (86%), Gaps = 5/153 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRT++RDLE LF +YGR+R VDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRR-SNTRLYVGHLSSRTKTRDLEDLFARYGRIRAVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGV----PRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWAR  443
            AR   DGR+  G RIIVEF+KGV    PR PGGSRDY+GRGPPPGSGRCFNCGI+GHWAR
Sbjct  60   ARYSLDGRDFKGSRIIVEFSKGVSDLTPRAPGGSRDYMGRGPPPGSGRCFNCGIDGHWAR  119

Query  444  DCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            DCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  DCKAGDWKNKCYRCGERGHIERNCQNSPRKLRR  152



>ref|XP_010067230.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Eucalyptus grandis]
Length=331

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 132/153 (86%), Gaps = 5/153 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVGHLSSRT++RDLE LF +YGR+R VDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRR-SNTRLYVGHLSSRTKTRDLEDLFARYGRIRAVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGV----PRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWAR  443
            AR   DGR+  G RIIVEF+KGV    PR PGGSRDY+GRGPPPGSGRCFNCGI+GHWAR
Sbjct  60   ARYSLDGRDFKGSRIIVEFSKGVSDLTPRAPGGSRDYMGRGPPPGSGRCFNCGIDGHWAR  119

Query  444  DCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            DCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  DCKAGDWKNKCYRCGERGHIERNCQNSPRKLRR  152



>gb|AAY84873.1| alternative splicing regulator [Triticum aestivum]
Length=333

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+A RLYVG LSSRTRSRDLE LF KYGR+R+V++KRDYAFI++SDPRDAD+
Sbjct  1    MPRYDDRYGNA-RLYVGRLSSRTRSRDLEYLFSKYGRIREVELKRDYAFIEYSDPRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD--YLGRGPPPGSGRCFNCGIEGHWARDC  449
            AR   DGR+VDG RIIVEFAKGVPRG GGSR+  Y+GRGPPPG+GRCFNCGI+GHWARDC
Sbjct  60   ARYNLDGRDVDGSRIIVEFAKGVPRGSGGSREREYVGRGPPPGTGRCFNCGIDGHWARDC  119

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            KAGDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  KAGDWKNKCYRCGERGHIERNCQNSPRSLRR  150



>ref|XP_002440494.1| hypothetical protein SORBIDRAFT_09g001910 [Sorghum bicolor]
 gb|EES18924.1| hypothetical protein SORBIDRAFT_09g001910 [Sorghum bicolor]
 gb|AGE46111.1| arginine/serine-rich splicing factor RS2Z39 [Sorghum bicolor]
Length=341

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L+ RTRSRDLE LF +YGR+R+V++KRDYAFI+FSD RDAD+
Sbjct  1    MPRYDDRYG-GTRLYVGRLAPRTRSRDLEYLFGRYGRIREVELKRDYAFIEFSDHRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VEFAKGVPRGPGGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYQLDGRDVDGSRIVVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ + R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRSVRR  148



>ref|XP_004307445.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=306

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDR G  +RLYVG LSSRTRSR+LE +F +YGRVRDVDMKRD+AF++F+DPRDADD
Sbjct  1    MPRHDDRSG-GSRLYVGRLSSRTRSRELEDVFSRYGRVRDVDMKRDFAFVEFNDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG R+IVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCG++GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRLIVEFARGAPRGPGGSREYLGRGPPPGSGRCFNCGLDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCG+RGHIE  C NSP+K 
Sbjct  120  GDWKNKCYRCGDRGHIERNCQNSPKKT  146



>ref|NP_001049771.1| Os03g0285900 [Oryza sativa Japonica Group]
 gb|ABF95355.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11685.1| Os03g0285900 [Oryza sativa Japonica Group]
 gb|EEE58838.1| hypothetical protein OsJ_10413 [Oryza sativa Japonica Group]
Length=330

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD YGS TRLYVG LSSRTRSRDLE LF +YGR+R+V++KRDYAFI+FSDPRDAD+
Sbjct  1    MPRYDDHYGS-TRLYVGRLSSRTRSRDLEYLFGRYGRIREVELKRDYAFIEFSDPRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGP-GGSRDYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            AR   DGR+VDG RI+VEFAKGVPRG  GGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCK
Sbjct  60   ARYNLDGRDVDGSRILVEFAKGVPRGAAGGSREYMGRGPPPGTGRCFNCGIDGHWARDCK  119

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  AGDWKNKCYRCGERGHIERNCQNSPRNLRR  149



>ref|XP_008654709.1| PREDICTED: uncharacterized protein LOC100276428 isoform X1 [Zea 
mays]
Length=416

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  93   NMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdad  272
            +MPRYDDRYG  TRLYVG L++RTRSRDLE LF +YGR+R+V++KRDYAFI+FSD RDAD
Sbjct  63   DMPRYDDRYG-GTRLYVGRLATRTRSRDLEHLFGRYGRIREVELKRDYAFIEFSDHRDAD  121

Query  273  darryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            +AR   DGR+VDG RI+VEFAKGVPRG GGSR+Y+GRGPPPG+GRCFNCG++GHWARDCK
Sbjct  122  EARYQLDGRDVDGSRIVVEFAKGVPRGSGGSREYMGRGPPPGTGRCFNCGVDGHWARDCK  181

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  182  AGDWKNKCYRCGERGHIERNCQNSPRSLRR  211



>gb|ACN36972.1| unknown [Zea mays]
 gb|AFW82805.1| splicing factor, arginine/serine-rich 6 [Zea mays]
 gb|AGE46045.1| arginine/serine-rich splicing factor RS2Z39 transcript III [Zea 
mays]
 gb|AGE46046.1| arginine/serine-rich splicing factor RS2Z39 transcript IV [Zea 
mays]
Length=353

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L++RTRSRDLE LF +YGR+R+V++KRDYAFI+FSD RDAD+
Sbjct  1    MPRYDDRYG-GTRLYVGRLATRTRSRDLEHLFGRYGRIREVELKRDYAFIEFSDHRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VEFAKGVPRG GGSR+Y+GRGPPPG+GRCFNCG++GHWARDCKA
Sbjct  60   ARYQLDGRDVDGSRIVVEFAKGVPRGSGGSREYMGRGPPPGTGRCFNCGVDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRSLRR  148



>ref|XP_008647517.1| PREDICTED: uncharacterized protein LOC100272956 isoform X1 [Zea 
mays]
 gb|ACG27529.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACN30993.1| unknown [Zea mays]
 gb|AFW74824.1| Splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW74825.1| Splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
 gb|AGE46052.1| arginine/serine-rich splicing factor RS2Z37B transcript I [Zea 
mays]
Length=333

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L+ RTRSRDLE LF KYGR+R+V++KRDYAFI+FS+ RDAD+
Sbjct  1    MPRYDDRYG-GTRLYVGRLAPRTRSRDLEYLFGKYGRIREVELKRDYAFIEFSEHRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VEFAKGVPRGPGGSR+Y+GRGPPPG+GRCFNCG++GHWARDCKA
Sbjct  60   ARYQLDGRDVDGSRIVVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGMDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ + R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRSVRR  148



>ref|XP_009133148.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 [Brassica 
rapa]
Length=295

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVGHLSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGHLSSRTRTRDLERLFNRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRDY  RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDYDSRGPPPGSGRCFNCGLDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>gb|EEC75006.1| hypothetical protein OsI_11073 [Oryza sativa Indica Group]
Length=294

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 2/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD YGS TRLYVG LSSRTRSRDLE LF +YGR+R+V++KRDYAFI+FSD RDAD+
Sbjct  1    MPRYDDHYGS-TRLYVGRLSSRTRSRDLEYLFGRYGRIREVELKRDYAFIEFSDTRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGP-GGSRDYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            AR   DGR+VDG RI+VEFAKGVPRG  GGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCK
Sbjct  60   ARYNLDGRDVDGSRILVEFAKGVPRGAAGGSREYMGRGPPPGTGRCFNCGIDGHWARDCK  119

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  AGDWKNKCYRCGERGHIERNCQNSPRNLRR  149



>ref|NP_001143694.1| uncharacterized protein LOC100276428 [Zea mays]
 gb|ACG31886.1| splicing factor, arginine/serine-rich 6 [Zea mays]
 gb|AGE46048.1| arginine/serine-rich splicing factor RS2Z39 transcript VI [Zea 
mays]
Length=353

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYV  L++RTRSRDLE LF +YGR+R+V++KRDYAFI+FSD RDAD+
Sbjct  1    MPRYDDRYG-GTRLYVSRLATRTRSRDLEHLFGRYGRIREVELKRDYAFIEFSDHRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VEFAKGVPRG GGSR+Y+GRGPPPG+GRCFNCG++GHWARDCKA
Sbjct  60   ARYQLDGRDVDGSRIVVEFAKGVPRGSGGSREYMGRGPPPGTGRCFNCGVDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRSLRR  148



>ref|XP_004968259.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Setaria 
italica]
Length=301

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG LSSRTR+ DLE +F +YGRVR VD+K ++AF++FSDPRDADD
Sbjct  1    MPRYDDRYGGNTRLYVGRLSSRTRTEDLEDIFSRYGRVRYVDLKHEFAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD--YLGRGPPPGSGRCFNCGIEGHWARDC  449
            AR   DGRE DG RIIVEFAKGVPRG GGSRD  Y+GRGPPPGSGRCFNCGI+GHWARDC
Sbjct  61   ARYNLDGREFDGSRIIVEFAKGVPRGTGGSRDREYMGRGPPPGSGRCFNCGIDGHWARDC  120

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            KAGDWKN+CYRCG+RGHIE  C NSP+ L RG
Sbjct  121  KAGDWKNRCYRCGDRGHIERDCRNSPKNLRRG  152



>ref|XP_006410917.1| hypothetical protein EUTSA_v10017989mg [Eutrema salsugineum]
 gb|ESQ52370.1| hypothetical protein EUTSA_v10017989mg [Eutrema salsugineum]
Length=280

 Score =   219 bits (557),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVGHLSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGHLSSRTRTRDLERLFNRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRDY  RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDYDSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>gb|ACG34035.1| splicing factor, arginine/serine-rich 6 [Zea mays]
 gb|AGE46043.1| arginine/serine-rich splicing factor RS2Z39 transcript I [Zea 
mays]
Length=353

 Score =   221 bits (563),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L++RTRSRDLE LF +YGR+R+V++KRDYAFI+FSD RDAD+
Sbjct  1    MPRYDDRYG-GTRLYVGRLATRTRSRDLEHLFGRYGRIREVELKRDYAFIEFSDHRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+VDG RI+VE AKGVPRG GGSR+Y+GRGPPPG+GRCFNCG++GHWARDCKA
Sbjct  60   ARYQLDGRDVDGSRIVVESAKGVPRGSGGSREYMGRGPPPGTGRCFNCGVDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPRSLRR  148



>emb|CDY46773.1| BnaA03g17170D [Brassica napus]
Length=316

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVGHLSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  22   MPRYDDRYGN-TRLYVGHLSSRTRTRDLERLFNRYGRVRDVDMKRDYAFVEFSDPRDADD  80

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRDY  RGPPPGSGRCFNCG++GHWARDC A
Sbjct  81   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDYDSRGPPPGSGRCFNCGLDGHWARDCTA  137

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  138  GDWKNKCYRCGERGHIERNCKNSPKKLRR  166



>emb|CDX79732.1| BnaC03g20680D [Brassica napus]
Length=293

 Score =   219 bits (557),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVGHLSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGHLSSRTRTRDLERLFNRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRDY  RGPPPG+GRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDYDSRGPPPGAGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>ref|XP_008241800.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Prunus mume]
Length=303

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG L+SRTRSRDLERLF +YGRVRDVDMKR++AF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLASRTRSRDLERLFSRYGRVRDVDMKREFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG R+IVEFAKG   GP GSR+YLGRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGTRLIVEFAKG---GPRGSREYLGRGPTPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE +C NSP++L
Sbjct  117  GDWKNKCYRCGERGHIERQCKNSPKEL  143



>ref|XP_006398722.1| hypothetical protein EUTSA_v10014414mg [Eutrema salsugineum]
 gb|ESQ40175.1| hypothetical protein EUTSA_v10014414mg [Eutrema salsugineum]
Length=263

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR+GS TRLYVGHLSSRTR+RD+ERLF KYGRVRDVDMKRD+AF+DFSDPRDADD
Sbjct  1    MPRYDDRHGS-TRLYVGHLSSRTRTRDVERLFSKYGRVRDVDMKRDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPG-GSRDYLG-RGPPPGSGRCFNCGIEGHWARDC  449
            AR   DGR+ DG RI+VEFAKG PRG G GSR+    RGPPPGSGRCFNCG++GHWARDC
Sbjct  60   ARYRLDGRDFDGSRIVVEFAKGTPRGSGSGSREISSSRGPPPGSGRCFNCGLDGHWARDC  119

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
             AGDWKNKCYRCG+RGHIE  C NSP+K  R
Sbjct  120  TAGDWKNKCYRCGDRGHIERNCKNSPKKQKR  150



>ref|XP_006296724.1| hypothetical protein CARUB_v10014335mg [Capsella rubella]
 gb|EOA29622.1| hypothetical protein CARUB_v10014335mg [Capsella rubella]
Length=282

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 130/150 (87%), Gaps = 5/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S++RLYVGHLSSRTR RDLERLF KYGR+RD+DMKRDYAFIDFSDPRDADD
Sbjct  1    MPRYDDRY-SSSRLYVGHLSSRTRERDLERLFSKYGRIRDLDMKRDYAFIDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPPGSGRCFNCGIEGHWARDCK  452
            AR   DGR+ DG RIIVEFAKG PRG   SRD+   RGPPPGSGRCFNCG++GHWARDC 
Sbjct  60   ARYRLDGRDFDGSRIIVEFAKGTPRG---SRDFSSSRGPPPGSGRCFNCGLDGHWARDCS  116

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  117  AGDWKNKCYRCGDRGHIERNCKNSPKKLRR  146



>ref|XP_007205643.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica]
 gb|EMJ06842.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica]
Length=298

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG L+SRTRSRDLERLF +YGRVRDVDMKR++AF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLASRTRSRDLERLFSRYGRVRDVDMKREFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG R+IVEFAKG   GP GSR+YLGRGP PGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGTRLIVEFAKG---GPRGSREYLGRGPTPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE +C NSP++L
Sbjct  117  GDWKNKCYRCGERGHIERQCKNSPKEL  143



>gb|AFK35693.1| unknown [Lotus japonicus]
Length=300

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 8/156 (5%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LSSRTRSRDLER+F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSSRTRSRDLERVFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRD-------YLGRGPPPGSGRCFNCGIEGH  434
            AR   DGR+VDG R+IVEFAKGVPRG             Y+GRGPPPGSGRCFNCGI+GH
Sbjct  60   ARYNLDGRDVDGSRLIVEFAKGVPRGSREGGGGRDRDREYMGRGPPPGSGRCFNCGIDGH  119

Query  435  WARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            WARDCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  WARDCKAGDWKNKCYRCGERGHIEKNCKNSPKKLSR  155



>ref|XP_010486531.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Camelina sativa]
Length=282

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 129/150 (86%), Gaps = 5/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHLSSRTR RDLERLF KYGR+RD+DMKRDYAFIDFSDPRDADD
Sbjct  1    MPRYDDRY-SGTRLYVGHLSSRTRERDLERLFSKYGRIRDLDMKRDYAFIDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPPGSGRCFNCGIEGHWARDCK  452
            AR   DGR+ DG RIIVEFAKG PRG   SR++   RGPPPGSGRCFNCG++GHWARDC 
Sbjct  60   ARYRLDGRDFDGSRIIVEFAKGTPRG---SREFSSSRGPPPGSGRCFNCGLDGHWARDCS  116

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  117  AGDWKNKCYRCGDRGHIERNCKNSPKKLRR  146



>ref|XP_010474235.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Camelina sativa]
 ref|XP_010474278.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Camelina sativa]
Length=262

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 129/150 (86%), Gaps = 5/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHLSSRTR RDLERLF KYGR+RD+DMKRDYAFIDFSDPRDADD
Sbjct  1    MPRYDDRY-SGTRLYVGHLSSRTRERDLERLFSKYGRIRDLDMKRDYAFIDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPPGSGRCFNCGIEGHWARDCK  452
            AR   DGR+ DG RIIVEFAKG PRG   SR++   RGPPPGSGRCFNCG++GHWARDC 
Sbjct  60   ARYRLDGRDFDGSRIIVEFAKGTPRG---SREFSSSRGPPPGSGRCFNCGLDGHWARDCS  116

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  117  AGDWKNKCYRCGDRGHIERNCKNSPKKLRR  146



>ref|NP_001242616.1| uncharacterized protein LOC100813237 [Glycine max]
 gb|ACU24121.1| unknown [Glycine max]
Length=299

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LSSRTRSRDLER+F +YGRVR VDMK D+AF++FSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSSRTRSRDLERVFSRYGRVRGVDMKNDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+V+G RIIVEFAKG PRG    R+Y+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGRDVEGSRIIVEFAKGGPRG-SRDREYMGRGPPPGSGRCFNCGIDGHWARDCKA  118

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL +
Sbjct  119  GDWKNKCYRCGERGHIEKNCKNSPKKLSQ  147



>ref|XP_004302812.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=285

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 133/147 (90%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ +RLYVG L+SRTR+RDL+R+F +YGRVRDVDMKR++AF++F DPRDADD
Sbjct  1    MPRYDDRYGN-SRLYVGRLASRTRTRDLDRIFSRYGRVRDVDMKREFAFVEFYDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGREVDG R+IVEFAKG PRG   SR+Y+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREVDGSRLIVEFAKGAPRG---SREYMGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE +C NSP++L
Sbjct  117  GDWKNKCYRCGERGHIERQCKNSPKEL  143



>ref|XP_006576250.1| PREDICTED: uncharacterized protein LOC100813237 isoform X1 [Glycine 
max]
 ref|XP_006576251.1| PREDICTED: uncharacterized protein LOC100813237 isoform X2 [Glycine 
max]
 ref|XP_006576252.1| PREDICTED: uncharacterized protein LOC100813237 isoform X3 [Glycine 
max]
 gb|KHN09453.1| Serine/arginine-rich splicing factor 4 [Glycine soja]
Length=299

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 2/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LSSRTRSRDLER+F +YGRVR VDMK D+AF++FSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSSRTRSRDLERVFSRYGRVRGVDMKNDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+V+G RIIVEFAKG PRG    R+Y+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGRDVEGSRIIVEFAKGGPRG-SRDREYMGRGPPPGSGRCFNCGIDGHWARDCKA  118

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL +
Sbjct  119  GDWKNKCYRCGERGHIEKNCKNSPKKLSQ  147



>ref|XP_010558301.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Tarenaya hassleriana]
Length=271

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 130/154 (84%), Gaps = 4/154 (3%)
 Frame = +3

Query  84   AWVNMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPr  263
            + + MPRYDDR  S TRLYVG LSSRTR RDLERLF +YGRVRDVD+KRDYAF+DFSDPR
Sbjct  22   SLLKMPRYDDR-DSTTRLYVGRLSSRTRERDLERLFSRYGRVRDVDVKRDYAFVDFSDPR  80

Query  264  daddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWAR  443
            DADDAR   DGR+ DG RIIVEFAKG PRG   SR+Y  RGPPPG+GRCFNCG++GHWAR
Sbjct  81   DADDARYRLDGRDFDGSRIIVEFAKGTPRG---SREYSSRGPPPGTGRCFNCGVDGHWAR  137

Query  444  DCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            DC AGDWKNKCYRCG++GHIE  C NSP+KL RG
Sbjct  138  DCTAGDWKNKCYRCGDKGHIERDCKNSPKKLSRG  171



>ref|XP_010505314.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Camelina sativa]
Length=285

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF ++GRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFDRFGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR++DG RI VEF++G PRG   SRDY  RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDIDGSRITVEFSRGAPRG---SRDYDSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>gb|KDO67845.1| hypothetical protein CISIN_1g021599mg [Citrus sinensis]
Length=310

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L+SRTRSRDLE +F +YGR+RDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKLRR  148



>ref|XP_010464607.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Camelina sativa]
Length=282

 Score =   216 bits (549),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 128/150 (85%), Gaps = 5/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRY S TRLYVGHLSSRTR RDLERLF KYGR+RD+DMKRDYAFIDFSDPRDADD
Sbjct  1    MPRYDDRY-SGTRLYVGHLSSRTRERDLERLFSKYGRIRDLDMKRDYAFIDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPPGSGRCFNCGIEGHWARDCK  452
            AR   DGR+ DG RIIVEFAKG PRG   SR+    RGPPPGSGRCFNCG++GHWARDC 
Sbjct  60   ARYRLDGRDFDGSRIIVEFAKGTPRG---SREISSSRGPPPGSGRCFNCGLDGHWARDCS  116

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  117  AGDWKNKCYRCGDRGHIERNCKNSPKKLRR  146



>ref|XP_010558304.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X3 [Tarenaya hassleriana]
Length=246

 Score =   214 bits (546),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR  S TRLYVG LSSRTR RDLERLF +YGRVRDVD+KRDYAF+DFSDPRDADD
Sbjct  1    MPRYDDR-DSTTRLYVGRLSSRTRERDLERLFSRYGRVRDVDVKRDYAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ DG RIIVEFAKG PRG   SR+Y  RGPPPG+GRCFNCG++GHWARDC A
Sbjct  60   ARYRLDGRDFDGSRIIVEFAKGTPRG---SREYSSRGPPPGTGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCG++GHIE  C NSP+KL RG
Sbjct  117  GDWKNKCYRCGDKGHIERDCKNSPKKLSRG  146



>ref|XP_006436157.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 ref|XP_006485980.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Citrus sinensis]
 gb|ESR49397.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
Length=312

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L+SRTRSRDLE +F +YGR+RDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKLRR  148



>ref|XP_002281756.2| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Vitis vinifera]
Length=304

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR+GS TRLYVG LSSRTRSRDLE LF +YGRVRDVDMK D+AF++FSDPRDADD
Sbjct  1    MPRYDDRHGS-TRLYVGRLSSRTRSRDLEDLFSRYGRVRDVDMKHDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+ DG RIIVEFAKG PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDFDGSRIIVEFAKGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKLKRG  149



>emb|CBI25319.3| unnamed protein product [Vitis vinifera]
Length=278

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR+GS TRLYVG LSSRTRSRDLE LF +YGRVRDVDMK D+AF++FSDPRDADD
Sbjct  33   MPRYDDRHGS-TRLYVGRLSSRTRSRDLEDLFSRYGRVRDVDMKHDFAFVEFSDPRDADD  91

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+ DG RIIVEFAKG PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  92   ARYSLNGRDFDGSRIIVEFAKGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  151

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  152  GDWKNKCYRCGERGHIERNCQNSPKKLKRG  181



>ref|XP_010509350.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Camelina 
sativa]
Length=286

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF ++GRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFDRFGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRDY  RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDYDSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>ref|XP_006293506.1| hypothetical protein CARUB_v10023766mg [Capsella rubella]
 gb|EOA26404.1| hypothetical protein CARUB_v10023766mg [Capsella rubella]
Length=291

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFNRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SR+Y  RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SREYDSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>gb|KDO67846.1| hypothetical protein CISIN_1g021599mg [Citrus sinensis]
Length=309

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L+SRTRSRDLE +F +YGR+RDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKL  146



>ref|XP_010517000.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 [Camelina 
sativa]
Length=285

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF ++GRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFDRFGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRDY  RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDYDSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>gb|KJB16875.1| hypothetical protein B456_002G252500 [Gossypium raimondii]
Length=278

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            M RYDDRY   TRLYVGH+SSRTR+RDLERLF +YGR+ DVDMKRDYAF+DFSDPRDADD
Sbjct  1    MRRYDDRY-CHTRLYVGHISSRTRTRDLERLFSRYGRILDVDMKRDYAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ DG RI+VEFA+GVPRG   SR+YLGRGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYSLDGRDFDGSRIVVEFARGVPRG---SREYLGRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
             DWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  EDWKNKCYRCGERGHIERNCRNSPRKL  143



>ref|XP_006436154.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 ref|XP_006485981.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Citrus sinensis]
 gb|ESR49394.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
Length=311

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L+SRTRSRDLE +F +YGR+RDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKL  146



>gb|KJB16873.1| hypothetical protein B456_002G252500 [Gossypium raimondii]
 gb|KJB16877.1| hypothetical protein B456_002G252500 [Gossypium raimondii]
Length=284

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            M RYDDRY   TRLYVGH+SSRTR+RDLERLF +YGR+ DVDMKRDYAF+DFSDPRDADD
Sbjct  1    MRRYDDRY-CHTRLYVGHISSRTRTRDLERLFSRYGRILDVDMKRDYAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ DG RI+VEFA+GVPRG   SR+YLGRGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYSLDGRDFDGSRIVVEFARGVPRG---SREYLGRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
             DWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  EDWKNKCYRCGERGHIERNCRNSPRKL  143



>gb|KJB16874.1| hypothetical protein B456_002G252500 [Gossypium raimondii]
Length=285

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            M RYDDRY   TRLYVGH+SSRTR+RDLERLF +YGR+ DVDMKRDYAF+DFSDPRDADD
Sbjct  1    MRRYDDRY-CHTRLYVGHISSRTRTRDLERLFSRYGRILDVDMKRDYAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ DG RI+VEFA+GVPRG   SR+YLGRGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYSLDGRDFDGSRIVVEFARGVPRG---SREYLGRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
             DWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  EDWKNKCYRCGERGHIERNCRNSPRKL  143



>ref|XP_009776489.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Nicotiana 
sylvestris]
Length=316

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRSRDLEDVFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RI VEFAKGVPRGPGGSR++ GRGPPPG+GRCFNCG++GHWARDCKA
Sbjct  60   ARYGLNGRDVDGSRITVEFAKGVPRGPGGSREFGGRGPPPGTGRCFNCGLDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKLKRG  149



>ref|XP_008445803.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Cucumis melo]
 ref|XP_008445804.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Cucumis melo]
 ref|XP_008445805.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Cucumis melo]
Length=337

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 134/178 (75%), Gaps = 30/178 (17%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYG------------------------  203
            MPRYDDRYG  TRLYVG LSSRTRSRDL+ LF +YG                        
Sbjct  1    MPRYDDRYG-GTRLYVGRLSSRTRSRDLDDLFSRYGSSSMRGEVSTLWYLYQMMALPVSG  59

Query  204  ----RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD  371
                RVRDVDMKRDYAF++FSDPRDADDAR   +GR+V G RIIVE AKGVPRGPGGSR+
Sbjct  60   TNLRRVRDVDMKRDYAFVEFSDPRDADDARYSLNGRDVHGSRIIVEIAKGVPRGPGGSRE  119

Query  372  YLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            YLGRGPP G+GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  120  YLGRGPP-GTGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIEKNCQNSPKKLKRG  176



>ref|XP_006485979.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Citrus sinensis]
Length=340

 Score =   215 bits (547),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVG L+SRTRSRDLE +F +YGR+RDVDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKL  146



>ref|XP_011654929.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Cucumis sativus]
 ref|XP_011654930.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Cucumis sativus]
Length=337

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 134/178 (75%), Gaps = 30/178 (17%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYG------------------------  203
            MPRYDDRYG  TRLYVG LSSRTRSRDL+ LF +YG                        
Sbjct  1    MPRYDDRYG-GTRLYVGRLSSRTRSRDLDDLFSRYGSSSMRGEVSTLWYLYQMMALPVSG  59

Query  204  ----RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD  371
                RVRDVDMKRDYAF++FSDPRDADDAR   +GR+V G RIIVE AKGVPRGPGGSR+
Sbjct  60   TNLRRVRDVDMKRDYAFVEFSDPRDADDARYSLNGRDVHGSRIIVEIAKGVPRGPGGSRE  119

Query  372  YLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            YLGRGPP G+GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  120  YLGRGPP-GTGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIEKNCQNSPKKLKRG  176



>ref|XP_010558303.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Tarenaya hassleriana]
Length=270

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +3

Query  84   AWVNMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPr  263
            + + MPRYDDR  S TRLYVG LSSRTR RDLERLF +YGRVRDVD+KRDYAF+DFSDPR
Sbjct  22   SLLKMPRYDDR-DSTTRLYVGRLSSRTRERDLERLFSRYGRVRDVDVKRDYAFVDFSDPR  80

Query  264  daddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWAR  443
            DADDAR   DGR+ DG RIIVEFAKG PRG   SR+Y  RGPPPG+GRCFNCG++GHWAR
Sbjct  81   DADDARYRLDGRDFDGSRIIVEFAKGTPRG---SREYSSRGPPPGTGRCFNCGVDGHWAR  137

Query  444  DCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            DC AGDWKNKCYRCG++GHIE  C NSP+KL
Sbjct  138  DCTAGDWKNKCYRCGDKGHIERDCKNSPKKL  168



>ref|NP_850280.1| arginine/serine-rich zinc knuckle-containing protein 33 [Arabidopsis 
thaliana]
 sp|Q8VYA5.1|RSZ33_ARATH RecName: Full=Serine/arginine-rich splicing factor RS2Z33; AltName: 
Full=RS-containing zinc finger protein 33; Short=At-RS2Z33; 
Short=At-RSZ33; Short=AtRSZ33 [Arabidopsis thaliana]
 gb|AAL61922.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47882.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44314.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09387.1| arginine/serine-rich zinc knuckle-containing protein 33 [Arabidopsis 
thaliana]
Length=290

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++F DPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRD+  RGPPPG+GRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDFDSRGPPPGAGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>ref|XP_006345907.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006345908.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Solanum tuberosum]
Length=300

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRSRDLEDVFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG R+IVEFAKGVPRGPGGSR++ GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYGLNGRDVDGSRVIVEFAKGVPRGPGGSREFGGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  120  GDWKNKCYRCGDRGHIERNCQNSPKKLKR  148



>ref|XP_007162697.1| hypothetical protein PHAVU_001G172600g [Phaseolus vulgaris]
 gb|ESW34691.1| hypothetical protein PHAVU_001G172600g [Phaseolus vulgaris]
Length=295

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LS  TRSRDLER+F +YGRVR VDMK D+AF++FSDPRDAD+
Sbjct  1    MPRYDDKYGN-TRLYVGRLSLDTRSRDLERVFGRYGRVRGVDMKNDFAFVEFSDPRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+V+G RIIVEFAKG   GP GSR+Y+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGRDVEGSRIIVEFAKG---GPRGSREYMGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  GDWKNKCYRCGERGHIEKNCKNSPKKL  143



>ref|XP_007162696.1| hypothetical protein PHAVU_001G172600g [Phaseolus vulgaris]
 gb|ESW34690.1| hypothetical protein PHAVU_001G172600g [Phaseolus vulgaris]
Length=296

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LS  TRSRDLER+F +YGRVR VDMK D+AF++FSDPRDAD+
Sbjct  1    MPRYDDKYGN-TRLYVGRLSLDTRSRDLERVFGRYGRVRGVDMKNDFAFVEFSDPRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+V+G RIIVEFAKG   GP GSR+Y+GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGRDVEGSRIIVEFAKG---GPRGSREYMGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  GDWKNKCYRCGERGHIEKNCKNSPKKL  143



>ref|XP_007162698.1| hypothetical protein PHAVU_001G172700g [Phaseolus vulgaris]
 gb|ESW34692.1| hypothetical protein PHAVU_001G172700g [Phaseolus vulgaris]
Length=300

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LS  TRSRDLER+F +YGRVR VDMK D+AF++FSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSQNTRSRDLERVFGRYGRVRGVDMKNDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ +G RIIVEFAKG   GP GSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYNLDGRDFEGSRIIVEFAKG---GPRGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  117  GDWKNKCYRCGERGHIEKNCKNSPKKL  143



>ref|XP_003554342.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Glycine max]
 ref|XP_006604541.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Glycine max]
 ref|XP_006604542.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X3 [Glycine max]
 gb|KHN02391.1| Serine/arginine-rich splicing factor 4 [Glycine soja]
Length=297

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDD+YG+ TRLYVG LSSRTRSRDLER+F +YGR+R VDMK D+AF++FSDPRDADD
Sbjct  1    MPRYDDKYGN-TRLYVGRLSSRTRSRDLERVFSRYGRIRGVDMKNDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+V+G RIIVEFAKG   GP GSR+ LGRG PPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGRDVEGSRIIVEFAKG---GPRGSRENLGRGLPPGSGRCFNCGIDGHWARDCKA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+K  R
Sbjct  117  GDWKNKCYRCGERGHIEKNCKNSPKKSSR  145



>ref|XP_004239756.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321361.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Solanum lycopersicum]
Length=306

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTRSRDLE +F +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRSRDLEDVFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GR+VDG R+IVEFAKGVPRGPGGSR++ GRGPPPG+GRCFNCGI+GHWARDCKA
Sbjct  60   ARYGLNGRDVDGSRVIVEFAKGVPRGPGGSREFGGRGPPPGTGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  120  GDWKNKCYRCGDRGHIERNCQNSPKKLKR  148



>ref|XP_003567963.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Brachypodium distachyon]
Length=319

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 131/160 (82%), Gaps = 10/160 (6%)
 Frame = +3

Query  96   MPRYD--DRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrda  269
            MPRYD  DRYG  TRLYVG LSSRTRSRDLE LF +YGRVR VDMK ++AF++FSDPRDA
Sbjct  1    MPRYDERDRYGGNTRLYVGRLSSRTRSRDLEDLFGRYGRVRYVDMKHEFAFVEFSDPRDA  60

Query  270  ddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD--------YLGRGPPPGSGRCFNCGI  425
            DDAR   DGR+ DG R+IVEFAKGVPRG GGSRD        Y+GRGPPPGSGRCFNCGI
Sbjct  61   DDARYNLDGRDFDGSRMIVEFAKGVPRGQGGSRDRDRGGDREYMGRGPPPGSGRCFNCGI  120

Query  426  EGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            +GHWARDCKAGDWKN+CYRCG+ GHIE  C NSP+ L RG
Sbjct  121  DGHWARDCKAGDWKNRCYRCGDSGHIERDCQNSPKNLRRG  160



>emb|CAC03605.1| splicing factor RSZ33 [Arabidopsis thaliana]
Length=290

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++F DPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRD+  RGPPPG+GRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDFDSRGPPPGAGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C N P+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNQPKKLRR  145



>dbj|BAD44429.1| unknown protein [Arabidopsis thaliana]
Length=290

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 128/149 (86%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF+ F DPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVVFGDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VEF++G PRG   SRD+  RGPPPG+GRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEFSRGAPRG---SRDFDSRGPPPGAGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPKKLRR  145



>emb|CDY41599.1| BnaC05g43360D [Brassica napus]
Length=287

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 126/156 (81%), Gaps = 10/156 (6%)
 Frame = +3

Query  96   MPRYDDRYGS-----ATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDP  260
            MPRYDDRY S       RLYVGHLSSRTR RDLE LF KYGR+RD+DMKRDYAFI+FSDP
Sbjct  1    MPRYDDRYSSNDRYGGARLYVGHLSSRTRERDLEHLFSKYGRIRDLDMKRDYAFIEFSDP  60

Query  261  rdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG--RGPPPGSGRCFNCGIEGH  434
            RDADDAR   DGR+ DG RI VEFA+G PRG   SR++    RGPPPGSGRCFNCG+EGH
Sbjct  61   RDADDARYRLDGRDFDGSRITVEFARGTPRG---SREFSSSSRGPPPGSGRCFNCGLEGH  117

Query  435  WARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            WARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  118  WARDCSAGDWKNKCYRCGDRGHIERNCKNSPKKLRR  153



>ref|XP_010230323.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Brachypodium distachyon]
Length=320

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 130/159 (82%), Gaps = 10/159 (6%)
 Frame = +3

Query  96   MPRYD--DRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrda  269
            MPRYD  DRYG  TRLYVG LSSRTRSRDLE LF +YGRVR VDMK ++AF++FSDPRDA
Sbjct  1    MPRYDERDRYGGNTRLYVGRLSSRTRSRDLEDLFGRYGRVRYVDMKHEFAFVEFSDPRDA  60

Query  270  ddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD--------YLGRGPPPGSGRCFNCGI  425
            DDAR   DGR+ DG R+IVEFAKGVPRG GGSRD        Y+GRGPPPGSGRCFNCGI
Sbjct  61   DDARYNLDGRDFDGSRMIVEFAKGVPRGQGGSRDRDRGGDREYMGRGPPPGSGRCFNCGI  120

Query  426  EGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            +GHWARDCKAGDWKN+CYRCG+ GHIE  C NSP+ L R
Sbjct  121  DGHWARDCKAGDWKNRCYRCGDSGHIERDCQNSPKNLSR  159



>emb|CDY07586.1| BnaC06g14780D [Brassica napus]
Length=288

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRFDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEASRGAPRGSRDSRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  120  GDWKNKCYRCGERGHIERNCKNSPS  144



>ref|XP_002455172.1| hypothetical protein SORBIDRAFT_03g005500 [Sorghum bicolor]
 gb|EES00292.1| hypothetical protein SORBIDRAFT_03g005500 [Sorghum bicolor]
 gb|AGE46114.1| arginine/serine-rich splicing factor RS2Z34 transcript I [Sorghum 
bicolor]
Length=296

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +3

Query  120  GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgr  299
            G  TRLYVG +SSRTR+RDLE LF +YGRVR VDMK ++AF++FSDPRDADDAR + D R
Sbjct  21   GGNTRLYVGRVSSRTRTRDLEDLFGRYGRVRYVDMKHEFAFVEFSDPRDADDARYHLDDR  80

Query  300  EVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCY  479
            E DG R+IVEFAKG+PRGPGGSR+Y+G+GPPPGSGRCFNCG++GHWARDCKAGDWKN+CY
Sbjct  81   EFDGSRLIVEFAKGIPRGPGGSREYMGKGPPPGSGRCFNCGMDGHWARDCKAGDWKNRCY  140

Query  480  RCGERGHIEXKCPNSPQKLXRG  545
            RCG+RGHIE  C NSP+ L RG
Sbjct  141  RCGDRGHIERDCQNSPKNLRRG  162



>ref|XP_009402244.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009402245.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=304

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG  TRLYVGHLSSRTRSRDLE LF +YGRVRDVDMK DYAF++FSDPRDADD
Sbjct  1    MPRYDDRYG-GTRLYVGHLSSRTRSRDLEDLFSRYGRVRDVDMKHDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GRE DG RIIVEFAKGVPRG GGSR+Y GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGREFDGSRIIVEFAKGVPRGSGGSREYPGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+ L  G
Sbjct  120  GDWKNKCYRCGERGHIERNCHNSPKNLKPG  149



>gb|ABR25316.1| splicing factor [Oryza sativa Indica Group]
Length=209

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  120  GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgr  299
            G  TRLYVG LSSRTR+RDLE LF +YGRVR VDMK ++AF++FSD RDAD+AR   DGR
Sbjct  15   GGNTRLYVGRLSSRTRTRDLEDLFGRYGRVRYVDMKHEFAFVEFSDARDADEARYNLDGR  74

Query  300  EVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCY  479
            + DG R+IVEFAKGVPRGPGGSR+Y+GRGPPPGSGRCFNCGI+GHWARDCKAGDWKN+CY
Sbjct  75   DFDGSRMIVEFAKGVPRGPGGSREYMGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNRCY  134

Query  480  RCGERGHIEXKCPNSPQKLXRG  545
            RCG+RGHIE  C NSP+ L RG
Sbjct  135  RCGDRGHIERDCRNSPKNLKRG  156



>ref|XP_002277105.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Vitis vinifera]
Length=307

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLE LF +YGRVRDVDMK D+AF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLESLFSRYGRVRDVDMKHDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSR-DYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            AR   +GR+ DG RIIVEFAKG PRG  G   +YLGRGPPPGSGRCFNCGI+GHWARDCK
Sbjct  60   ARYNLNGRDFDGSRIIVEFAKGGPRGGSGGSREYLGRGPPPGSGRCFNCGIDGHWARDCK  119

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            AGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  120  AGDWKNKCYRCGERGHIERNCQNSPRKLSR  149



>dbj|BAK03402.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=282

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +3

Query  114  RYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryyd  293
            +YG  T+LYVGHLS+ TR++D+E LF +YGR+R V++K DY F++FS+PRDADDAR   D
Sbjct  34   QYGGNTKLYVGHLSTHTRTKDVEYLFGRYGRIRCVELKHDYGFVEFSNPRDADDARYELD  93

Query  294  grEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNK  473
            G++VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDC AGDWKNK
Sbjct  94   GQDVDGSRIIVEFARGTPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCNAGDWKNK  153

Query  474  CYRCGERGHIEXKCPNSPQKLXRG  545
            CYRCGE+GHIE  C NSP+ L RG
Sbjct  154  CYRCGEKGHIEKNCQNSPKNLKRG  177



>ref|XP_010504113.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Camelina sativa]
 ref|XP_010515844.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Camelina sativa]
Length=284

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 123/145 (85%), Gaps = 4/145 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYSLDGRDFDGSRITVEASRGAPRG---SRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPS  141



>emb|CAN60012.1| hypothetical protein VITISV_036556 [Vitis vinifera]
Length=306

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLE LF +YGRVRDVDMK D+AF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLESLFSRYGRVRDVDMKHDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSR-DYLGRGPPPGSGRCFNCGIEGHWARDCK  452
            AR   +GR+ DG RIIVEFAKG PRG  G   +YLGRGPPPGSGRCFNCGI+GHWARDCK
Sbjct  60   ARYNLNGRDFDGSRIIVEFAKGGPRGGSGGSREYLGRGPPPGSGRCFNCGIDGHWARDCK  119

Query  453  AGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            AGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  120  AGDWKNKCYRCGERGHIERNCQNSPRKL  147



>ref|NP_001042066.1| Os01g0155600 [Oryza sativa Japonica Group]
 dbj|BAD61423.1| putative splicing factor [Oryza sativa Japonica Group]
 dbj|BAF03980.1| Os01g0155600 [Oryza sativa Japonica Group]
 gb|EAY72601.1| hypothetical protein OsI_00466 [Oryza sativa Indica Group]
 dbj|BAG87361.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  120  GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgr  299
            G  TRLYVG LSSRTR+RDLE LF +YGRVR VDMK ++AF++FSD RDAD+AR   DGR
Sbjct  15   GGNTRLYVGRLSSRTRTRDLEDLFGRYGRVRYVDMKHEFAFVEFSDARDADEARYNLDGR  74

Query  300  EVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCY  479
            + DG R+IVEFAKGVPRGPGGSR+Y+GRGPPPGSGRCFNCGI+GHWARDCKAGDWKN+CY
Sbjct  75   DFDGSRMIVEFAKGVPRGPGGSREYMGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNRCY  134

Query  480  RCGERGHIEXKCPNSPQKLXRG  545
            RCG+RGHIE  C NSP+ L RG
Sbjct  135  RCGDRGHIERDCRNSPKNLKRG  156



>ref|XP_006643769.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like [Oryza 
brachyantha]
Length=325

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  129  TRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVD  308
            TRLYVG LSSRTR+RDLE LF +YGRVR VDMK ++AF++FSDPRDADDAR   DGRE D
Sbjct  17   TRLYVGRLSSRTRTRDLEDLFGRYGRVRYVDMKHEFAFVEFSDPRDADDARYNLDGREFD  76

Query  309  GRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCG  488
            G R+IVEFAKGVPRGPGGSR+Y+GRGPPPGSGRCFNCGI+GHWARDCKAGDWKN+CYRCG
Sbjct  77   GSRMIVEFAKGVPRGPGGSREYMGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNRCYRCG  136

Query  489  ERGHIEXKCPNSPQKL  536
            +RGHIE  C NSP+ L
Sbjct  137  DRGHIERDCRNSPKNL  152



>ref|XP_010426999.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Camelina sativa]
Length=284

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 123/145 (85%), Gaps = 4/145 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYSLDGRDFDGSRITVEASRGAPRG---SRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPS  141



>ref|XP_002877922.1| hypothetical protein ARALYDRAFT_323893 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54181.1| hypothetical protein ARALYDRAFT_323893 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRARDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYYLDGRDFDGSRITVEASRGAPRG---SRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPS  141



>ref|NP_190918.3| serine/arginine-rich splicing factor RS2Z32 [Arabidopsis thaliana]
 sp|Q9FYB7.1|RSZ32_ARATH RecName: Full=Serine/arginine-rich splicing factor RS2Z32; AltName: 
Full=RS-containing zinc finger protein 32; Short=At-RS2Z32; 
Short=At-RSZ32; Short=AtRSZ32; AltName: Full=Serine/arginine-rich 
splicing factor RSZ34; Short=AtRSZ34 [Arabidopsis 
thaliana]
 emb|CAB67657.2| splicing factor-like protein [Arabidopsis thaliana]
 dbj|BAH19424.1| AT3G53500 [Arabidopsis thaliana]
 gb|AEE79098.1| serine/arginine-rich splicing factor RS2Z32 [Arabidopsis thaliana]
Length=284

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYYLDGRDFDGSRITVEASRGAPRG---SRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPS  141



>emb|CDX73550.1| BnaC08g24530D [Brassica napus]
Length=284

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 128/152 (84%), Gaps = 6/152 (4%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYG+ TRLYVG LSSRTRSRDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRFDDRYGN-TRLYVGRLSSRTRSRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYYLDGRDFDGSRITVEASRGAPRG---SRDSGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPN--SPQKLXRG  545
            GDWKNKCYRCGERGHIE  C N  SP+K  RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPSPKKARRG  148



>ref|XP_010253404.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Nelumbo nucifera]
Length=375

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYGS TRLYVG LSSRTR+RDLE LF KYGRVRDVD+K D+AFI+FSDPRDADD
Sbjct  1    MPRHDDRYGS-TRLYVGRLSSRTRTRDLEDLFSKYGRVRDVDLKHDFAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GRE DG RIIVEFAKG PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGREFDGSRIIVEFAKGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+ L
Sbjct  120  GDWKNKCYRCGERGHIERNCKNSPKNL  146



>ref|XP_010253405.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010253406.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Nelumbo nucifera]
Length=376

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYGS TRLYVG LSSRTR+RDLE LF KYGRVRDVD+K D+AFI+FSDPRDADD
Sbjct  1    MPRHDDRYGS-TRLYVGRLSSRTRTRDLEDLFSKYGRVRDVDLKHDFAFIEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   +GRE DG RIIVEFAKG PRGPGGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLNGREFDGSRIIVEFAKGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKNKCYRCGERGHIE  C NSP+ L
Sbjct  120  GDWKNKCYRCGERGHIERNCKNSPKNL  146



>ref|XP_006293063.1| hypothetical protein CARUB_v10019350mg [Capsella rubella]
 gb|EOA25961.1| hypothetical protein CARUB_v10019350mg [Capsella rubella]
Length=283

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYYLDGRDFDGSRITVEASRGAPRG---SRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPS  141



>emb|CDY44717.1| BnaA05g28890D [Brassica napus]
Length=295

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 126/156 (81%), Gaps = 10/156 (6%)
 Frame = +3

Query  96   MPRYDDRYGS-----ATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDP  260
            MPRYDDRY S       RLYVGHLSSRTR RDLE LF KYGR+RD+DMKRDYAFI+FSDP
Sbjct  1    MPRYDDRYSSNDRYGGARLYVGHLSSRTRERDLEHLFSKYGRIRDLDMKRDYAFIEFSDP  60

Query  261  rdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPP-GSGRCFNCGIEGH  434
            RDADDAR   DGR+ DG RI VEFA+G PRG   SRD+   RGPPP GSGRCFNCG+EGH
Sbjct  61   RDADDARYRLDGRDFDGSRITVEFARGTPRG---SRDFSSSRGPPPPGSGRCFNCGLEGH  117

Query  435  WARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            WARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  118  WARDCSAGDWKNKCYRCGDRGHIERNCKNSPKKLRR  153



>ref|XP_009116040.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Brassica rapa]
 ref|XP_009116041.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Brassica rapa]
 emb|CDX78183.1| BnaA09g33780D [Brassica napus]
Length=283

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 128/152 (84%), Gaps = 6/152 (4%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYG+ TRLYVG LSSRTRSRDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRFDDRYGN-TRLYVGRLSSRTRSRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYYLDGRDFDGSRITVEASRGAPRG---SRDSGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPN--SPQKLXRG  545
            GDWKNKCYRCGERGHIE  C N  SP+K  RG
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPSPKKARRG  148



>ref|XP_009146916.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Brassica rapa]
 ref|XP_009146918.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Brassica rapa]
Length=287

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 126/156 (81%), Gaps = 10/156 (6%)
 Frame = +3

Query  96   MPRYDDRYGS-----ATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDP  260
            MPRYDDRY S       RLYVGHLSSRTR RDLE LF KYGR+RD+DMKRDYAFI+FSDP
Sbjct  1    MPRYDDRYSSNDRYGGARLYVGHLSSRTRERDLEHLFSKYGRIRDLDMKRDYAFIEFSDP  60

Query  261  rdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPP-GSGRCFNCGIEGH  434
            RDADDAR   DGR+ DG RI VEFA+G PRG   SRD+   RGPPP GSGRCFNCG+EGH
Sbjct  61   RDADDARYRLDGRDFDGSRITVEFARGTPRG---SRDFSSSRGPPPPGSGRCFNCGLEGH  117

Query  435  WARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            WARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  118  WARDCSAGDWKNKCYRCGDRGHIERNCKNSPKKLRR  153



>gb|EEE53899.1| hypothetical protein OsJ_00434 [Oryza sativa Japonica Group]
Length=377

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  120  GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgr  299
            G  TRLYVG LSSRTR+RDLE LF +YGRVR VDMK ++AF++FSD RDAD+AR   DGR
Sbjct  68   GGNTRLYVGRLSSRTRTRDLEDLFGRYGRVRYVDMKHEFAFVEFSDARDADEARYNLDGR  127

Query  300  EVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCY  479
            + DG R+IVEFAKGVPRGPGGSR+Y+GRGPPPGSGRCFNCGI+GHWARDCKAGDWKN+CY
Sbjct  128  DFDGSRMIVEFAKGVPRGPGGSREYMGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNRCY  187

Query  480  RCGERGHIEXKCPNSPQKLXRG  545
            RCG+RGHIE  C NSP+ L RG
Sbjct  188  RCGDRGHIERDCRNSPKNLKRG  209



>ref|XP_006403682.1| hypothetical protein EUTSA_v10010597mg [Eutrema salsugineum]
 gb|ESQ45135.1| hypothetical protein EUTSA_v10010597mg [Eutrema salsugineum]
Length=254

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYG+ TRLYVG LSSRTR+RDLERLF +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRFDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRLRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYYLDGRDFDGSRITVEASRGAPRG---SRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPS  141



>ref|XP_009103865.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X1 [Brassica rapa]
 emb|CDY52755.1| BnaA07g37700D [Brassica napus]
Length=291

 Score =   206 bits (524),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYG+ TRLYVG LSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRFDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   +RD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDFDGSRITVEASRGAPRGSRDARDNGSRGPPPGSGRCFNCGVDGHWARDCTA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNS  524
            GDWKNKCYRCGERGHIE  C NS
Sbjct  120  GDWKNKCYRCGERGHIERNCKNS  142



>ref|XP_006403683.1| hypothetical protein EUTSA_v10010597mg [Eutrema salsugineum]
 gb|ESQ45136.1| hypothetical protein EUTSA_v10010597mg [Eutrema salsugineum]
Length=288

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPR+DDRYG+ TRLYVG LSSRTR+RDLERLF +YGR+RDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRFDDRYGN-TRLYVGRLSSRTRTRDLERLFSRYGRLRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI VE ++G PRG   SRD   RGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARYYLDGRDFDGSRITVEASRGAPRG---SRDNGSRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQ  530
            GDWKNKCYRCGERGHIE  C NSP 
Sbjct  117  GDWKNKCYRCGERGHIERNCKNSPS  141



>ref|XP_009404636.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Musa 
acuminata subsp. malaccensis]
Length=314

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYGS TRLYVG +S RTR+RDLE LF +YGRVR+VD+K D+AF++FSD RDADD
Sbjct  1    MPRYDDRYGS-TRLYVGRISYRTRARDLEDLFSRYGRVRNVDLKHDFAFVEFSDSRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG RIIVEFA+G PRG GGSR+YLGRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARYSLDGREFDGSRIIVEFARGGPRGSGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  120  GDWKNKCYRCGERGHIERNCQNSPKKLRRG  149



>ref|XP_009421361.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=300

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR+G+ TRLYVG +S RTRSRDLE LF +YGRVR+VDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRHGN-TRLYVGRISYRTRSRDLEDLFGRYGRVRNVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG RIIVEFA+G PRGPGGSRD+ GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARHSLDGREFDGSRIIVEFARGGPRGPGGSRDHAGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKN+CYRCGE GH+E  C NSP+ L
Sbjct  120  GDWKNRCYRCGEGGHVERNCQNSPRNL  146



>ref|XP_009421363.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=306

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR+G+ TRLYVG +S RTRSRDLE LF +YGRVR+VDMKRD+AF++FSDPRDADD
Sbjct  1    MPRYDDRHGN-TRLYVGRISYRTRSRDLEDLFGRYGRVRNVDMKRDFAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR   DGRE DG RIIVEFA+G PRGPGGSRD+ GRGPPPGSGRCFNCGI+GHWARDCKA
Sbjct  60   ARHSLDGREFDGSRIIVEFARGGPRGPGGSRDHAGRGPPPGSGRCFNCGIDGHWARDCKA  119

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GDWKN+CYRCGE GH+E  C NSP+ L
Sbjct  120  GDWKNRCYRCGEGGHVERNCQNSPRNL  146



>ref|XP_010529753.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Tarenaya hassleriana]
Length=288

 Score =   198 bits (504),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 4/149 (3%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDRYG+  RLYVGHLSSRTR+RDLERLF +YGRVRDVDMKRDYAF++FSDPRDADD
Sbjct  1    MPRYDDRYGN-NRLYVGHLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKA  455
            AR Y DGR+ DG RI+VEF++G PRG   SRDY GRGPPPGSGRCFNCG++GHWARDC A
Sbjct  60   ARHYLDGRDYDGSRIVVEFSRGAPRG---SRDYGGRGPPPGSGRCFNCGVDGHWARDCTA  116

Query  456  GDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  117  GDWKNKCYRCGERGHIERNCNNSPKKLKR  145



>ref|XP_010231673.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010231674.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X1 [Brachypodium distachyon]
Length=310

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  TRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVD  308
            T+LYVG LS+RTR++D+E LF +YGRVR+V++K DY F++FSDPRDADDAR   DGR+ D
Sbjct  39   TKLYVGRLSTRTRTQDVEYLFGRYGRVRNVELKHDYGFVEFSDPRDADDARYELDGRDFD  98

Query  309  GRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCG  488
            G RIIVEFAKG PRGPGGS +Y+GR  PPGSGRCFNCGIEGHWARDCKAG+WKNKCYRCG
Sbjct  99   GSRIIVEFAKGTPRGPGGSFNYVGRSLPPGSGRCFNCGIEGHWARDCKAGNWKNKCYRCG  158

Query  489  ERGHIEXKCPNSPQKLXRG  545
            E GHIE  C NSP+ L RG
Sbjct  159  EMGHIEKNCQNSPKNLKRG  177



>emb|CDX80835.1| BnaC03g00890D [Brassica napus]
Length=265

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 132/155 (85%), Gaps = 7/155 (5%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRY+DR+GS TRLYVGHLSSRTR+RD+ERLF KYGRVRDVDMKRD+AF+DFSDPRDADD
Sbjct  1    MPRYEDRHGS-TRLYVGHLSSRTRTRDVERLFSKYGRVRDVDMKRDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPG---GSRDY---LGRGPPPGSGRCFNCGIEGHW  437
            AR   DGR+VDG RI+VEFAKG PRG G   GSR+     G  PPPGSGRCFNCG++GHW
Sbjct  60   ARYRLDGRDVDGSRIVVEFAKGTPRGSGSGYGSREISSSRGGPPPPGSGRCFNCGLDGHW  119

Query  438  ARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            ARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  120  ARDCTAGDWKNKCYRCGDRGHIERNCKNSPKKLKR  154



>gb|ABK25831.1| unknown [Picea sitchensis]
 gb|ACN39968.1| unknown [Picea sitchensis]
Length=316

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 3/147 (2%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G+ TRLYVG LSSRTR+RDLE LF +YGRVRDVD+K D+AFI+FSDPRDAD+
Sbjct  1    MPRYDDRSGN-TRLYVGRLSSRTRTRDLEDLFNRYGRVRDVDLKHDFAFIEFSDPRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGG--SRDYLGRGPPPGSGRCFNCGIEGHWARDC  449
            AR Y +GR++DG RI+VEFA+G PRG  G  +R+YLGRGPPPGSGRCFNCG +GHWARDC
Sbjct  60   ARYYLNGRDLDGSRIVVEFARGGPRGAAGGRTREYLGRGPPPGSGRCFNCGNDGHWARDC  119

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQ  530
            KAGDWKNKCYRCGERGHIE  C NSP+
Sbjct  120  KAGDWKNKCYRCGERGHIERNCQNSPK  146



>gb|ABK25029.1| unknown [Picea sitchensis]
Length=316

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 3/147 (2%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRYDDR G+ TRLYVG LSSRTR+RDLE LF +YGRVRDVD+K D+AFI+FSDPRDAD+
Sbjct  1    MPRYDDRSGN-TRLYVGRLSSRTRTRDLEDLFNRYGRVRDVDLKHDFAFIEFSDPRDADE  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGG--SRDYLGRGPPPGSGRCFNCGIEGHWARDC  449
            AR Y +GR++DG RI+VEFA+G PRG  G  +R+YLGRGPPPGSGRCFNCG +GHWARDC
Sbjct  60   ARYYLNGRDLDGSRIVVEFARGGPRGAAGGRTREYLGRGPPPGSGRCFNCGNDGHWARDC  119

Query  450  KAGDWKNKCYRCGERGHIEXKCPNSPQ  530
            KAGDWKNKCYRCGERGHIE  C NSP+
Sbjct  120  KAGDWKNKCYRCGERGHIERNCQNSPK  146



>emb|CDY11223.1| BnaA03g00590D [Brassica napus]
Length=263

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 132/155 (85%), Gaps = 7/155 (5%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRY+DR+GS TRLYVGHLSSRTR+RD+ERLF KYGRVRDVDMKRD+AF+DFSDPRDADD
Sbjct  1    MPRYEDRHGS-TRLYVGHLSSRTRTRDVERLFSKYGRVRDVDMKRDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPG---GSRDY---LGRGPPPGSGRCFNCGIEGHW  437
            AR   DGR+VDG RI+VEFAKG PRG G   GSR+     G  PPPGSGRCFNCG++GHW
Sbjct  60   ARYRLDGRDVDGSRIVVEFAKGTPRGSGSGYGSREISSSRGGPPPPGSGRCFNCGLDGHW  119

Query  438  ARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            ARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  120  ARDCTAGDWKNKCYRCGDRGHIERNCKNSPKKLKR  154



>emb|CDM82006.1| unnamed protein product [Triticum aestivum]
Length=323

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 128/162 (79%), Gaps = 12/162 (7%)
 Frame = +3

Query  96   MPRYD--DRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrda  269
            MPRYD  DRYG  TRLYVG L SRTR+RDLE LF +YGRVR VDMK ++AF++FSDPRDA
Sbjct  1    MPRYDERDRYGGNTRLYVGRLPSRTRTRDLEDLFGRYGRVRHVDMKHEFAFVEFSDPRDA  60

Query  270  ddarryydgrEVDGRRIIVEFAKGVPRGPGGSR----------DYLGRGPPPGSGRCFNC  419
            D+AR   DGR+ DG R+IVEFAKGVPRG GG            +Y+GRGPPPGSGRCFNC
Sbjct  61   DEARYNLDGRDFDGSRMIVEFAKGVPRGQGGGGDRDRGRGGDREYMGRGPPPGSGRCFNC  120

Query  420  GIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GI+GHWARDCKAGDWKN+CYRCG+ GHIE  C NSP+ L RG
Sbjct  121  GIDGHWARDCKAGDWKNRCYRCGDSGHIERDCQNSPKNLKRG  162



>ref|XP_010528225.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Tarenaya hassleriana]
Length=286

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 124/153 (81%), Gaps = 6/153 (4%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            M  YDDR    TRLYVG LSS TR+RDLERLF +YGRV+DVDMKR+YAF++FSDPRDADD
Sbjct  1    MAPYDDRRHGITRLYVGQLSSTTRTRDLERLFSRYGRVQDVDMKRNYAFVEFSDPRDADD  60

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDY---LGRGPPPGSGRCFNCGIEGHWARD  446
            AR + D RE DG R++V+F++G PR    SR+Y    GRGPP GSGRCFNCG++GHWARD
Sbjct  61   ARYHLDRREYDGSRLVVKFSRGAPRS---SREYGGGSGRGPPAGSGRCFNCGVDGHWARD  117

Query  447  CKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            C+AGDWK+KCYRCGE+GHIE  C  SP+KL RG
Sbjct  118  CRAGDWKDKCYRCGEKGHIERNCRKSPKKLRRG  150



>ref|XP_010528207.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Tarenaya hassleriana]
Length=313

 Score =   193 bits (491),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 6/155 (4%)
 Frame = +3

Query  90   VNMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrda  269
            + M  YDDR    TRLYVG LSS TR+RDLERLF +YGRV+DVDMKR+YAF++FSDPRDA
Sbjct  26   LKMAPYDDRRHGITRLYVGQLSSTTRTRDLERLFSRYGRVQDVDMKRNYAFVEFSDPRDA  85

Query  270  ddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDY---LGRGPPPGSGRCFNCGIEGHWA  440
            DDAR + D RE DG R++V+F++G PR    SR+Y    GRGPP GSGRCFNCG++GHWA
Sbjct  86   DDARYHLDRREYDGSRLVVKFSRGAPRS---SREYGGGSGRGPPAGSGRCFNCGVDGHWA  142

Query  441  RDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            RDC+AGDWK+KCYRCGE+GHIE  C  SP+KL RG
Sbjct  143  RDCRAGDWKDKCYRCGEKGHIERNCRKSPKKLRRG  177



>gb|AAO16998.1| Unknown protein [Oryza sativa Japonica Group]
Length=389

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 129/189 (68%), Gaps = 48/189 (25%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGR-----------------------  206
            MPRYDD YGS TRLYVG LSSRTRSRDLE LF +YGR                       
Sbjct  46   MPRYDDHYGS-TRLYVGRLSSRTRSRDLEYLFGRYGRSCVFDLNDLVEGFSVFYTTREWK  104

Query  207  -----------------------VRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRR  317
                                   +R+V++KRDYAFI+FSDPRDAD+AR   DGR+VDG R
Sbjct  105  LQVGDAFEYLSHDGLLFGNHWCRIREVELKRDYAFIEFSDPRDADEARYNLDGRDVDGSR  164

Query  318  IIVEFAKGVPRGP-GGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGER  494
            I+VEFAKGVPRG  GGSR+Y+GRGPPPG+GRCFNCGI+GHWARDCKAGDWKNKCYRCGER
Sbjct  165  ILVEFAKGVPRGAAGGSREYMGRGPPPGTGRCFNCGIDGHWARDCKAGDWKNKCYRCGER  224

Query  495  GHIEXKCPN  521
            GHIE  C N
Sbjct  225  GHIERNCQN  233



>gb|EMS55948.1| Serine/arginine-rich splicing factor 4 [Triticum urartu]
Length=375

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 127/164 (77%), Gaps = 16/164 (10%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGR--------VRDVDMKRDYAFI--  245
            MPRYDDRYG+A RLYVG LSSRTRSRDLE LF KYGR        +   D+   ++    
Sbjct  7    MPRYDDRYGNA-RLYVGRLSSRTRSRDLEYLFSKYGRCLTPRSCVLNLNDLVEGFSVFNT  65

Query  246  ---DFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD--YLGRGPPPGSGRC  410
               ++SDPRDAD+AR   DGR+VDG RIIVEFAKGVPRG GGSR+  Y+GRGPPPG+GRC
Sbjct  66   IRKEYSDPRDADEARYNLDGRDVDGSRIIVEFAKGVPRGSGGSREREYVGRGPPPGTGRC  125

Query  411  FNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            FNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  126  FNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPRSLRR  169



>ref|XP_009130745.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Brassica rapa]
Length=262

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 9/157 (6%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            MPRY+DR+GS TRLYVGHLSSRTR+RD+ERLF KYGRVRDVDMKRD+AF+DFSDPRDADD
Sbjct  1    MPRYEDRHGS-TRLYVGHLSSRTRTRDVERLFSKYGRVRDVDMKRDFAFVDFSDPRDADD  59

Query  276  arryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR--------GPPPGSGRCFNCGIEG  431
            AR   DG++VDG RI+VEFAKG PRG G    Y  R         PPPGSGRCFNCG++G
Sbjct  60   ARYRLDGKDVDGSRIVVEFAKGTPRGSGSGSGYGSREISSSRGGPPPPGSGRCFNCGLDG  119

Query  432  HWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            HWARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  120  HWARDCTAGDWKNKCYRCGDRGHIERNCKNSPKKLKR  156



>ref|XP_010528217.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Tarenaya hassleriana]
Length=309

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = +3

Query  90   VNMPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrda  269
            + M  YDDR    TRLYVG LSS TR+RDLERLF +YGRV+DVDMKR+YAF++FSDPRDA
Sbjct  26   LKMAPYDDRRHGITRLYVGQLSSTTRTRDLERLFSRYGRVQDVDMKRNYAFVEFSDPRDA  85

Query  270  ddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDY---LGRGPPPGSGRCFNCGIEGHWA  440
            DDAR + D RE DG R++V+F++G PR    SR+Y    GRGPP GSGRCFNCG++GHWA
Sbjct  86   DDARYHLDRREYDGSRLVVKFSRGAPRS---SREYGGGSGRGPPAGSGRCFNCGVDGHWA  142

Query  441  RDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            RDC+AGDWK+KCYRCGE+GHIE  C  SP+KL
Sbjct  143  RDCRAGDWKDKCYRCGEKGHIERNCRKSPKKL  174



>gb|EMS65019.1| Serine/arginine-rich splicing factor 4 [Triticum urartu]
Length=311

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 127/172 (74%), Gaps = 24/172 (14%)
 Frame = +3

Query  102  RYD--DRYGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdadd  275
            RYD  DRYG  T+LYVGHLS+ TR++D+E LF +YGR+R V++K DY F++FSDPRDADD
Sbjct  44   RYDRYDRYGGNTKLYVGHLSTHTRTKDVEYLFGRYGRIRCVELKYDYGFVEFSDPRDADD  103

Query  276  arryydgrEVDGRRIIVEFAKGVP----------------RGP------GGSRDYLGRGP  389
            AR   DG+E+DG RIIVEFA+G                  RG       GGSR+YLGRGP
Sbjct  104  ARYELDGQEIDGSRIIVEFARGKEVKALMEGDWMMNLVKIRGSKKCATHGGSREYLGRGP  163

Query  390  PPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            PPGSGRCFNCGI+GHWARDC AGDWKNKCYRCGE+GHIE  C NSP+ L RG
Sbjct  164  PPGSGRCFNCGIDGHWARDCNAGDWKNKCYRCGEKGHIEKNCQNSPKNLKRG  215



>gb|EMT10449.1| Splicing factor, arginine/serine-rich 4 [Aegilops tauschii]
Length=346

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 127/164 (77%), Gaps = 16/164 (10%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGR--------VRDVDMKRDYAFID-  248
            MPRYDDRYG+A RLYVG LSSRTRSRDLE LF KYGR        +   D+   ++  + 
Sbjct  1    MPRYDDRYGNA-RLYVGRLSSRTRSRDLEYLFSKYGRCLTPRSCVLNLNDLVEGFSVFNT  59

Query  249  ----FSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD--YLGRGPPPGSGRC  410
                +SDPRDAD+AR   DGR+VDG RIIVEFAKGVPRG GGSR+  Y+GRGPPPG+GRC
Sbjct  60   IRKEYSDPRDADEARYNLDGRDVDGSRIIVEFAKGVPRGSGGSREREYVGRGPPPGTGRC  119

Query  411  FNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            FNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+ L R
Sbjct  120  FNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPRSLRR  163



>gb|EMT01114.1| Splicing factor, arginine/serine-rich 4 [Aegilops tauschii]
Length=321

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 119/164 (73%), Gaps = 22/164 (13%)
 Frame = +3

Query  120  GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgr  299
            G  T+LYVGHLS+ TR++D+E LF +YGR+R V++K DY F++FSDPRDADDAR   DG+
Sbjct  53   GGNTKLYVGHLSTHTRTKDVEYLFGRYGRIRCVELKYDYGFVEFSDPRDADDARYELDGQ  112

Query  300  EVDGRRIIVEFAKGVP----------------------RGPGGSRDYLGRGPPPGSGRCF  413
            E+DG RIIVEFA+G                           GGSR+YLGRGPPPGSGRCF
Sbjct  113  EIDGSRIIVEFARGKEVKALMEGDWMMNLVKIRCSKKCATHGGSREYLGRGPPPGSGRCF  172

Query  414  NCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            NCGI+GHWARDC AGDWKNKCYRCGE+GHIE  C NSP+ L RG
Sbjct  173  NCGIDGHWARDCNAGDWKNKCYRCGEKGHIEKNCQNSPKNLKRG  216



>ref|XP_010669745.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  117  YGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydg  296
            +GS TRLYVG LSSRTR+ DL+ LF +YGRVRDVDMKRDYAF+++SDPRDA+DAR   +G
Sbjct  20   HGSGTRLYVGRLSSRTRTHDLDDLFSRYGRVRDVDMKRDYAFVEYSDPRDAEDARYSLNG  79

Query  297  rEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKC  476
            R+VDG RIIVEFAKG PRGPGGSRDY GRGPPPGSGRCFNCGI+GHWARDCKAGDWKNKC
Sbjct  80   RDVDGTRIIVEFAKGGPRGPGGSRDYGGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNKC  139

Query  477  YRCGERGHIEXKCPNSPQKLXRG  545
            YRCGERGHIE  C NSP+KL RG
Sbjct  140  YRCGERGHIERNCQNSPKKLRRG  162



>gb|AGE46165.1| arginine/serine-rich splicing factor RS2Z37 transcript I [Physcomitrella 
patens]
Length=331

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +3

Query  126  ATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEV  305
            ATRLYVG LS+RTRSRDLE LF KYGRVRDVD+K D+AF++F+D RDADDAR Y +G++ 
Sbjct  42   ATRLYVGRLSTRTRSRDLEDLFAKYGRVRDVDVKHDFAFVEFADARDADDARHYVNGKDF  101

Query  306  DGRRIIVEFAKGVPRGP-GGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYR  482
            DG R+IVEFA+  PRG  GG+R+YLGRGPPPG+GRC+NCG +GHWARDCKAGDW++KCYR
Sbjct  102  DGNRLIVEFARRGPRGASGGAREYLGRGPPPGTGRCYNCGNDGHWARDCKAGDWRDKCYR  161

Query  483  CGERGHIEXKCPN  521
            CG+RGHIE  C N
Sbjct  162  CGQRGHIERNCRN  174



>ref|XP_010326038.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X5 [Solanum lycopersicum]
Length=273

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK DYAF++FSDPRDADDAR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGS
Sbjct  1    MKHDYAFVEFSDPRDADDARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG+EGHWARDCKAGDWKNKCYRCGERGHIE KCPNSP+KL R
Sbjct  61   GRCFNCGLEGHWARDCKAGDWKNKCYRCGERGHIERKCPNSPKKLSR  107



>gb|KJB76488.1| hypothetical protein B456_012G091800 [Gossypium raimondii]
Length=283

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  LFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGS  365
            +F     +RDVDMKRDYAF++FSDPRDADDAR   +GR++DG RI+VEFAKGVPRGPGGS
Sbjct  11   VFHIKHEIRDVDMKRDYAFVEFSDPRDADDARYSLNGRDLDGSRIVVEFAKGVPRGPGGS  70

Query  366  RDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            RDY GRGP PG+GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  71   RDYPGRGPAPGAGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  127



>ref|XP_009593630.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X2 [Nicotiana tomentosiformis]
Length=275

 Score =   177 bits (449),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK DYAF++FSDPRDADDAR Y DGR+VDGRRIIVEFAKGVPRGPGGSR+YLG+GP PGS
Sbjct  1    MKHDYAFVEFSDPRDADDARYYLDGRDVDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCG+EGHWARDCKAGDWKNKCYRCGERGHIE KCPNSP+KL
Sbjct  61   GRCFNCGLEGHWARDCKAGDWKNKCYRCGERGHIEKKCPNSPKKL  105



>ref|XP_009765002.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Nicotiana sylvestris]
Length=277

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK DYAF++FSDPRDADDAR Y DGR+VDGRRIIVEFAKGVPRGPGGSR+YLG+GP PGS
Sbjct  1    MKHDYAFVEFSDPRDADDARYYLDGRDVDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCG+EGHWARDCKAGDWKNKCYRCGERGHIE KCPNSP+KL
Sbjct  61   GRCFNCGLEGHWARDCKAGDWKNKCYRCGERGHIEKKCPNSPKKL  105



>ref|XP_008445809.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Cucumis melo]
 ref|XP_008445810.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Cucumis melo]
 ref|XP_008445811.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Cucumis melo]
Length=305

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR  383
            RVRDVDMKRDYAF++FSDPRDADDAR   +GR+V G RIIVE AKGVPRGPGGSR+YLGR
Sbjct  32   RVRDVDMKRDYAFVEFSDPRDADDARYSLNGRDVHGSRIIVEIAKGVPRGPGGSREYLGR  91

Query  384  GPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GPP G+GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  92   GPP-GTGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIEKNCQNSPKKLKRG  144



>ref|XP_011654931.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Cucumis sativus]
 ref|XP_011654932.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Cucumis sativus]
Length=305

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +3

Query  204  RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR  383
            RVRDVDMKRDYAF++FSDPRDADDAR   +GR+V G RIIVE AKGVPRGPGGSR+YLGR
Sbjct  32   RVRDVDMKRDYAFVEFSDPRDADDARYSLNGRDVHGSRIIVEIAKGVPRGPGGSREYLGR  91

Query  384  GPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GPP G+GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  92   GPP-GTGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIEKNCQNSPKKLKRG  144



>ref|XP_011469709.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=285

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +3

Query  204  RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR  383
            RVRDVDMKRD+AF++F+DPRDADDAR   +GR+VDG R+IVEFA+G PRGPGGSR+YLGR
Sbjct  15   RVRDVDMKRDFAFVEFNDPRDADDARYSLNGRDVDGSRLIVEFARGAPRGPGGSREYLGR  74

Query  384  GPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GPPPGSGRCFNCG++GHWARDCKAGDWKNKCYRCG+RGHIE  C NSP+K 
Sbjct  75   GPPPGSGRCFNCGLDGHWARDCKAGDWKNKCYRCGDRGHIERNCQNSPKKT  125



>ref|XP_010067235.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X6 [Eucalyptus grandis]
 gb|KCW65331.1| hypothetical protein EUGRSUZ_G02779 [Eucalyptus grandis]
 gb|KCW65332.1| hypothetical protein EUGRSUZ_G02779 [Eucalyptus grandis]
Length=304

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  204  RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR  383
            R+R VDMKRDYAF++FSDPRDADDAR   DGR+  G RIIVEF+KG PR PGGSRDY+GR
Sbjct  12   RIRAVDMKRDYAFVEFSDPRDADDARYSLDGRDFKGSRIIVEFSKGTPRAPGGSRDYMGR  71

Query  384  GPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GPPPGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  72   GPPPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPRKLRR  124



>ref|XP_006345687.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Solanum tuberosum]
Length=273

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK DYAF++FSDPRDADDAR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGS
Sbjct  1    MKHDYAFVEFSDPRDADDARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG+EGHWARDCKAGDWKNKCYRCGERGHIE KCPNSP+K+ R
Sbjct  61   GRCFNCGLEGHWARDCKAGDWKNKCYRCGERGHIERKCPNSPKKVSR  107



>ref|XP_010669744.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  117  YGSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydg  296
            +GS TRLYVG LSSRTR+ DL+ LF +YGRVRDVDMKRDYAF+++SDPRDA+DAR   +G
Sbjct  20   HGSGTRLYVGRLSSRTRTHDLDDLFSRYGRVRDVDMKRDYAFVEYSDPRDAEDARYSLNG  79

Query  297  rEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKC  476
            R+VDG RIIVEFAKG PRGPGGSRDY GRGPPPGSGRCFNCGI+GHWARDCKAGDWKNKC
Sbjct  80   RDVDGTRIIVEFAKGGPRGPGGSRDYGGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNKC  139

Query  477  YRCGERGHIEXKCPNSPQKL  536
            YRCGERGHIE  C NSP+KL
Sbjct  140  YRCGERGHIERNCQNSPKKL  159



>ref|XP_007027153.1| RNA-binding family protein with retrovirus zinc finger-like domain, 
putative [Theobroma cacao]
 gb|EOY07655.1| RNA-binding family protein with retrovirus zinc finger-like domain, 
putative [Theobroma cacao]
Length=312

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 123/192 (64%), Gaps = 47/192 (24%)
 Frame = +3

Query  96   MPRYDDRYGSATRLYVGHLSSRTRSRDLERLFCKYGR-----------------------  206
            MPR+D RYG+ TRLYVG LSSRTR+RDLE +F +YGR                       
Sbjct  1    MPRFDGRYGT-TRLYVGRLSSRTRARDLEHIFSRYGRFLGFCLTWRPMVRGSALAELVEI  59

Query  207  --------------------VRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIV  326
                                +RDVDMK D+AF++ S PRDAD AR   DGR+ DG  IIV
Sbjct  60   PAQCYLSNDGLTVSSNNFRRIRDVDMKHDFAFVELSYPRDADGARYSLDGRDFDGSCIIV  119

Query  327  EFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIE  506
            E A+G   GP GSR+YLGRGPPPGSGRCFNCGI+GHWARDC+AGDWKNKC RCGERGHIE
Sbjct  120  ELARG---GPRGSREYLGRGPPPGSGRCFNCGIDGHWARDCRAGDWKNKCDRCGERGHIE  176

Query  507  XKCPNSPQKLXR  542
              C NS +KL R
Sbjct  177  RNCKNSAKKLNR  188



>gb|KJB73658.1| hypothetical protein B456_011G242700 [Gossypium raimondii]
Length=261

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR   +GR++DG RIIVEFAKGVPRGPGGSRDYLGRGP PGS
Sbjct  1    MKRDYAFVEFSDPRDADDARYSLNGRDLDGSRIIVEFAKGVPRGPGGSRDYLGRGPTPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  105



>gb|KJB73655.1| hypothetical protein B456_011G242700 [Gossypium raimondii]
 gb|KJB73657.1| hypothetical protein B456_011G242700 [Gossypium raimondii]
 gb|KJB73659.1| hypothetical protein B456_011G242700 [Gossypium raimondii]
Length=262

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR   +GR++DG RIIVEFAKGVPRGPGGSRDYLGRGP PGS
Sbjct  1    MKRDYAFVEFSDPRDADDARYSLNGRDLDGSRIIVEFAKGVPRGPGGSRDYLGRGPTPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  105



>ref|NP_001168362.1| hypothetical protein [Zea mays]
 ref|XP_008655204.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN26888.1| unknown [Zea mays]
 gb|ACN27966.1| unknown [Zea mays]
 gb|AFW82801.1| hypothetical protein ZEAMMB73_678679 [Zea mays]
Length=315

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +3

Query  168  SRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVP  347
            SR L      + R+R+V++KRDYAFI+FSDPRDADDA+   DGR+VDG RIIVEFAKGVP
Sbjct  14   SRQLIVCGNHFRRIREVELKRDYAFIEFSDPRDADDAQYNLDGRDVDGSRIIVEFAKGVP  73

Query  348  RGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSP  527
            RG GGSRDY GRGPPPG+GRCFNCG++GHWARDC+AGDWKNKCYRCGERGHIE  C NSP
Sbjct  74   RGSGGSRDYNGRGPPPGTGRCFNCGVDGHWARDCQAGDWKNKCYRCGERGHIERNCQNSP  133

Query  528  QKLXR  542
            + L R
Sbjct  134  RNLRR  138



>ref|XP_010067234.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X5 [Eucalyptus grandis]
Length=308

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  204  RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGV----PRGPGGSRD  371
            R+R VDMKRDYAF++FSDPRDADDAR   DGR+  G RIIVEF+KGV    PR PGGSRD
Sbjct  12   RIRAVDMKRDYAFVEFSDPRDADDARYSLDGRDFKGSRIIVEFSKGVSDLTPRAPGGSRD  71

Query  372  YLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            Y+GRGPPPGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  72   YMGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPRKLRR  128



>gb|KCW65330.1| hypothetical protein EUGRSUZ_G02779 [Eucalyptus grandis]
Length=307

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +3

Query  204  RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGV----PRGPGGSRD  371
            R+R VDMKRDYAF++FSDPRDADDAR   DGR+  G RIIVEF+KGV    PR PGGSRD
Sbjct  12   RIRAVDMKRDYAFVEFSDPRDADDARYSLDGRDFKGSRIIVEFSKGVSDLTPRAPGGSRD  71

Query  372  YLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            Y+GRGPPPGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  72   YMGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPRKLRR  128



>ref|XP_009384820.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=274

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK DYAFI+FSDPRDADDAR   +GRE DG RIIVEFAKG+PRG GGSR+YLGRGPPPGS
Sbjct  1    MKHDYAFIEFSDPRDADDARYSLNGREFDGSRIIVEFAKGIPRGSGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+ L RG
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCHNSPKTLKRG  108



>gb|EYU41660.1| hypothetical protein MIMGU_mgv1a011263mg [Erythranthe guttata]
Length=262

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 102/115 (89%), Gaps = 2/115 (2%)
 Frame = +3

Query  198  YGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYL  377
            + RVRDVDMKRDYAF++FSDPRDADDAR   DGR+VDGRRIIVEFAKGVPRG GG+R+Y 
Sbjct  10   FRRVRDVDMKRDYAFVEFSDPRDADDARYSMDGRDVDGRRIIVEFAKGVPRGSGGAREYA  69

Query  378  GRG--PPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            G G  P PGSGRCFNCG++GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  70   GAGRDPAPGSGRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIERSCQNSPKKL  124



>ref|XP_008371112.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Malus domestica]
Length=259

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGAPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG++GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+K  +
Sbjct  61   GRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKTTK  107



>ref|XP_009335941.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Pyrus x bretschneideri]
Length=265

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGAPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG++GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+K  +
Sbjct  61   GRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKTTK  107



>ref|XP_009357627.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Pyrus x bretschneideri]
Length=265

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGAPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG++GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+K  +
Sbjct  61   GRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKTTK  107



>ref|XP_010922452.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Elaeis guineensis]
Length=267

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAFI+FSDPRDADDAR   DGRE DG RIIVEFA+G PRGP GSR+YLGRGPPPGS
Sbjct  1    MKRDYAFIEFSDPRDADDARYSLDGREFDGSRIIVEFARGGPRGPRGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+ L RG
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKNLKRG  108



>gb|KJB76483.1| hypothetical protein B456_012G091800 [Gossypium raimondii]
 gb|KJB76486.1| hypothetical protein B456_012G091800 [Gossypium raimondii]
 gb|KJB76487.1| hypothetical protein B456_012G091800 [Gossypium raimondii]
 gb|KJB76489.1| hypothetical protein B456_012G091800 [Gossypium raimondii]
Length=261

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR   +GR++DG RI+VEFAKGVPRGPGGSRDY GRGP PG+
Sbjct  1    MKRDYAFVEFSDPRDADDARYSLNGRDLDGSRIVVEFAKGVPRGPGGSRDYPGRGPAPGA  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  105



>gb|KHG08857.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
 gb|KHG21738.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
Length=264

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR   +GR++DG RIIVEFAKGVPRGPGGSRDY GRGP PGS
Sbjct  1    MKRDYAFVEFSDPRDADDARYSLNGRDLDGCRIIVEFAKGVPRGPGGSRDYAGRGPTPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERDCQNSPKKL  105



>ref|XP_008783624.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008783625.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008783626.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Phoenix dactylifera]
Length=261

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAFI+FSDPRDADDAR   DGRE DG RIIVEFA+G PRGP GSR+YLGRGPPPGS
Sbjct  1    MKRDYAFIEFSDPRDADDARYSLDGREFDGSRIIVEFARGGPRGPRGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+ L RG
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKSLRRG  108



>gb|KJB67675.1| hypothetical protein B456_010G203100 [Gossypium raimondii]
Length=264

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR   +GR++DG RIIVEFAKGVPRGPGGSRDY GRGP PGS
Sbjct  1    MKRDYAFVEFSDPRDADDARYSLNGRDLDGCRIIVEFAKGVPRGPGGSRDYAGRGPTPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERDCQNSPKKL  105



>ref|XP_008233521.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Prunus mume]
Length=260

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG R+IVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRLIVEFARGAPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCG++GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+K 
Sbjct  61   GRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKT  105



>ref|XP_002308491.2| hypothetical protein POPTR_0006s23170g [Populus trichocarpa]
 gb|ABK95577.1| unknown [Populus trichocarpa]
 gb|EEE92014.2| hypothetical protein POPTR_0006s23170g [Populus trichocarpa]
Length=252

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 97/108 (90%), Gaps = 3/108 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR Y DG+E DG RIIVEFAKGVPRG   SR+YLGRGPPPGS
Sbjct  1    MKRDYAFVEFSDPRDADDARHYLDGKEFDGSRIIVEFAKGVPRG---SREYLGRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  58   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCKNSPKKLTRG  105



>ref|XP_011466611.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=264

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 3/111 (3%)
 Frame = +3

Query  204  RVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGR  383
            RVRDVDMKR++AF++F DPRDADDAR   DGREVDG R+IVEFAKG PRG   SR+Y+GR
Sbjct  15   RVRDVDMKREFAFVEFYDPRDADDARYSLDGREVDGSRLIVEFAKGAPRG---SREYMGR  71

Query  384  GPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GPPPGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE +C NSP++L
Sbjct  72   GPPPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERQCKNSPKEL  122



>gb|KJB78860.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
 gb|KJB78865.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
 gb|KJB78866.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
 gb|KJB78867.1| hypothetical protein B456_013G024100 [Gossypium raimondii]
Length=265

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR   +GR++DG R+IVEFAKGVPRG GGSRDY GRGP PGS
Sbjct  1    MKRDYAFVEFSDPRDADDARYALNGRDMDGSRMIVEFAKGVPRGSGGSRDYPGRGPTPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  105



>ref|XP_007009621.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 2 [Theobroma cacao]
 gb|EOY18431.1| RNA-binding family protein with retrovirus zinc finger-like domain 
isoform 2 [Theobroma cacao]
Length=261

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRG-PPPG  398
            MKRDYAF++FSDPRDADDAR   +GR++DG RIIVEFAKGVPRGPGGSRDY GRG P PG
Sbjct  1    MKRDYAFVEFSDPRDADDARYALNGRDLDGSRIIVEFAKGVPRGPGGSRDYPGRGGPTPG  60

Query  399  SGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            SGRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   SGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  106



>ref|XP_012082227.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X3 [Jatropha curcas]
Length=256

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 3/108 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR + DG++ DG RIIVEFAKGVPRG   SR+YLGRGPPPGS
Sbjct  1    MKRDYAFVEFSDPRDADDARYHLDGKDFDGSRIIVEFAKGVPRG---SREYLGRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  58   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCKNSPKKLKRG  105



>ref|XP_008776214.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X2 [Phoenix dactylifera]
Length=267

 Score =   164 bits (414),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAFI+FSDPRDADDAR   DGRE DG RIIVEFA+G PRGP GSR+YLGRGPPPGS
Sbjct  1    MKRDYAFIEFSDPRDADDARYSLDGREFDGGRIIVEFARGGPRGPRGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+ +
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERDCQNSPKNI  105



>ref|XP_011048453.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Populus euphratica]
Length=249

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 96/107 (90%), Gaps = 3/107 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR Y DG+E DG RIIVEFAKGVPRG   SR+YLGRGPPPGS
Sbjct  1    MKRDYAFVEFSDPRDADDARHYLDGKEFDGSRIIVEFAKGVPRG---SREYLGRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL +
Sbjct  58   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCKNSPKKLTK  104



>ref|XP_008241808.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X2 [Prunus mume]
Length=287

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 7/134 (5%)
 Frame = +3

Query  135  LYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGR  314
            +++ +LS+ + +    RL     RVRDVDMKR++AF++FSDPRDADDAR   DGRE DG 
Sbjct  1    MHLKYLSNDSLTVSGNRLR----RVRDVDMKREFAFVEFSDPRDADDARYSLDGREFDGT  56

Query  315  RIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGER  494
            R+IVEFAKG   GP GSR+YLGRGP PGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGER
Sbjct  57   RLIVEFAKG---GPRGSREYLGRGPTPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGER  113

Query  495  GHIEXKCPNSPQKL  536
            GHIE +C NSP++L
Sbjct  114  GHIERQCKNSPKEL  127



>ref|XP_007205642.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica]
 gb|EMJ06841.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica]
Length=282

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 7/134 (5%)
 Frame = +3

Query  135  LYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGR  314
            +++ +LS+ + +    RL     RVRDVDMKR++AF++FSDPRDADDAR   DGRE DG 
Sbjct  1    MHLKYLSNDSLTVSGNRLR----RVRDVDMKREFAFVEFSDPRDADDARYSLDGREFDGT  56

Query  315  RIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGER  494
            R+IVEFAKG   GP GSR+YLGRGP PGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGER
Sbjct  57   RLIVEFAKG---GPRGSREYLGRGPTPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGER  113

Query  495  GHIEXKCPNSPQKL  536
            GHIE +C NSP++L
Sbjct  114  GHIERQCKNSPKEL  127



>ref|XP_004246726.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X3 [Solanum lycopersicum]
Length=295

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +3

Query  246  DFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGI  425
            +FSDPRDADDAR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+
Sbjct  31   EFSDPRDADDARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGL  90

Query  426  EGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            EGHWARDCKAGDWKNKCYRCGERGHIE KCPNSP+KL R
Sbjct  91   EGHWARDCKAGDWKNKCYRCGERGHIERKCPNSPKKLSR  129



>ref|NP_001054731.1| Os05g0162600 [Oryza sativa Japonica Group]
 gb|AAT07654.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16645.1| Os05g0162600 [Oryza sativa Japonica Group]
 dbj|BAG88748.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00691.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62432.1| hypothetical protein OsJ_17224 [Oryza sativa Japonica Group]
Length=338

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 113/153 (74%), Gaps = 7/153 (5%)
 Frame = +3

Query  96   MPRY---DDRY---GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSD  257
            M RY   +DRY   G  +RLYVGH+S RTR+ DLE LF +YGRVR VD+K +Y F++FSD
Sbjct  1    MSRYVDPNDRYEPRGRNSRLYVGHISLRTRAEDLENLFSRYGRVRFVDLKNEYGFVEFSD  60

Query  258  PrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHW  437
            PRDA+DAR   DGR+ DG  IIV+FA+GV RG GGSR Y  R P  GS  CFNCG+EGHW
Sbjct  61   PRDANDARLDLDGRKYDGSDIIVQFARGVERGLGGSRGYKAR-PAHGSDHCFNCGMEGHW  119

Query  438  ARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
             R+C AGDW N+CY CGERGHI  +C NSP+ L
Sbjct  120  HRNCTAGDWTNRCYGCGERGHILRECKNSPKDL  152



>ref|XP_010231675.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Brachypodium distachyon]
Length=257

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +3

Query  207  VRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRG  386
            VR+V++K DY F++FSDPRDADDAR   DGR+ DG RIIVEFAKG PRGPGGS +Y+GR 
Sbjct  12   VRNVELKHDYGFVEFSDPRDADDARYELDGRDFDGSRIIVEFAKGTPRGPGGSFNYVGRS  71

Query  387  PPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
             PPGSGRCFNCGIEGHWARDCKAG+WKNKCYRCGE GHIE  C NSP+ L RG
Sbjct  72   LPPGSGRCFNCGIEGHWARDCKAGNWKNKCYRCGEMGHIEKNCQNSPKNLKRG  124



>ref|XP_010326037.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X4 [Solanum lycopersicum]
Length=294

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  246  DFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGI  425
            +FSDPRDADDAR Y DGR++DGRRIIVEFAKGVPRGPGGSR+YLG+GP PGSGRCFNCG+
Sbjct  31   EFSDPRDADDARYYLDGRDIDGRRIIVEFAKGVPRGPGGSREYLGKGPAPGSGRCFNCGL  90

Query  426  EGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            EGHWARDCKAGDWKNKCYRCGERGHIE KCPNSP+KL R 
Sbjct  91   EGHWARDCKAGDWKNKCYRCGERGHIERKCPNSPKKLRRS  130



>ref|XP_004493918.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X5 [Cicer arietinum]
Length=256

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 94/108 (87%), Gaps = 3/108 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD---YLGRGPP  392
            MK DYAF++FSDPRDADDAR   DGR+VDG R+IVEFAKGVPRG   SRD   YLGRGPP
Sbjct  1    MKHDYAFVEFSDPRDADDARYNLDGRDVDGSRLIVEFAKGVPRGSRDSRDSREYLGRGPP  60

Query  393  PGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            PGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   PGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIEKNCKNSPKKL  108



>ref|XP_006576996.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X2 [Glycine max]
Length=246

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK D+AF+DFSDPRDADDAR   DGR+VDG RIIVEFAKG PRG   SR+YLGRGPPPGS
Sbjct  1    MKNDFAFVDFSDPRDADDARYNLDGRDVDGSRIIVEFAKGAPRG---SREYLGRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCG++GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  58   GRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIERNCKNSPKKL  102



>ref|XP_006398723.1| hypothetical protein EUTSA_v10014414mg [Eutrema salsugineum]
 gb|ESQ40176.1| hypothetical protein EUTSA_v10014414mg [Eutrema salsugineum]
Length=242

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +3

Query  186  LFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPG-G  362
            L   + RVRDVDMKRD+AF+DFSDPRDADDAR   DGR+ DG RI+VEFAKG PRG G G
Sbjct  9    LPNNFRRVRDVDMKRDFAFVDFSDPRDADDARYRLDGRDFDGSRIVVEFAKGTPRGSGSG  68

Query  363  SRDYLG-RGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLX  539
            SR+    RGPPPGSGRCFNCG++GHWARDC AGDWKNKCYRCG+RGHIE  C NSP+K  
Sbjct  69   SREISSSRGPPPGSGRCFNCGLDGHWARDCTAGDWKNKCYRCGDRGHIERNCKNSPKKQK  128

Query  540  R  542
            R
Sbjct  129  R  129



>gb|AFW77206.1| hypothetical protein ZEAMMB73_752942 [Zea mays]
Length=330

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 116/162 (72%), Gaps = 14/162 (9%)
 Frame = +3

Query  96   MPRYDDRY------------GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYA  239
            M RY+DRY            GS T+LYVG +S  TR++DLE +F KYGR+R+VDMKR++ 
Sbjct  67   MSRYNDRYDHNNRYDRHGRHGSNTKLYVGQISPYTRTQDLEDIFRKYGRLRNVDMKREFG  126

Query  240  FIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNC  419
            F++F+DPRDADDAR   DGR  DG  +IVEFA+G  RGPGG     G+GP    GRC+NC
Sbjct  127  FVEFTDPRDADDARHDLDGRIFDGSHLIVEFARGAQRGPGGV-PLDGKGPS-FPGRCYNC  184

Query  420  GIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            G++GHW RDCKAGDW++KC+RCGE GHIE  C NS + L RG
Sbjct  185  GMDGHWVRDCKAGDWRDKCFRCGELGHIERNCKNSSKDLKRG  226



>ref|XP_008649360.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Zea 
mays]
 ref|XP_008649361.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Zea 
mays]
Length=264

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 116/162 (72%), Gaps = 14/162 (9%)
 Frame = +3

Query  96   MPRYDDRY------------GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYA  239
            M RY+DRY            GS T+LYVG +S  TR++DLE +F KYGR+R+VDMKR++ 
Sbjct  1    MSRYNDRYDHNNRYDRHGRHGSNTKLYVGQISPYTRTQDLEDIFRKYGRLRNVDMKREFG  60

Query  240  FIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNC  419
            F++F+DPRDADDAR   DGR  DG  +IVEFA+G  RGPGG     G+GP    GRC+NC
Sbjct  61   FVEFTDPRDADDARHDLDGRIFDGSHLIVEFARGAQRGPGGV-PLDGKGPS-FPGRCYNC  118

Query  420  GIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            G++GHW RDCKAGDW++KC+RCGE GHIE  C NS + L RG
Sbjct  119  GMDGHWVRDCKAGDWRDKCFRCGELGHIERNCKNSSKDLKRG  160



>ref|XP_009341801.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Pyrus x bretschneideri]
Length=268

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 3/108 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKR++AF+DFSDPRDADDAR   DGRE DG R+IVEFAKG PRG   SR+YLGRGP PGS
Sbjct  1    MKREFAFVDFSDPRDADDARYSLDGREFDGSRLIVEFAKGAPRG---SREYLGRGPTPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE +C NSP++L RG
Sbjct  58   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERQCKNSPKELSRG  105



>ref|XP_008359701.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Malus domestica]
Length=268

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 3/108 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKR++AF+DFSDPRDADDAR   DGRE DG R+IVEFAKG PRG   SR+YLGRGP PGS
Sbjct  1    MKREFAFVDFSDPRDADDARYSLDGREFDGSRLIVEFAKGAPRG---SREYLGRGPTPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE +C NSP++L RG
Sbjct  58   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERQCKNSPKELSRG  105



>gb|EAY96659.1| hypothetical protein OsI_18573 [Oryza sativa Indica Group]
Length=338

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 112/153 (73%), Gaps = 7/153 (5%)
 Frame = +3

Query  96   MPRY---DDRY---GSATRLYVGHLSSRTRSRDLERLFCKYGRVRDVDMKRDYAFIDFSD  257
            M RY   +DRY   G  +RLYVGH+S  TR+ DLE LF +YGRVR VD+K +Y F++FSD
Sbjct  1    MSRYVDPNDRYEPRGRNSRLYVGHISLCTRAEDLENLFSRYGRVRFVDLKNEYGFVEFSD  60

Query  258  PrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHW  437
            PRDA+DAR   DGR+ DG  IIV+FA+GV RG GGSR Y  R P  GS  CFNCG+EGHW
Sbjct  61   PRDANDARLDLDGRKYDGSDIIVQFARGVERGLGGSRGYKAR-PAHGSDHCFNCGMEGHW  119

Query  438  ARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
             R+C AGDW N+CY CGERGHI  +C NSP+ L
Sbjct  120  HRNCTAGDWTNRCYGCGERGHILRECKNSPKDL  152



>gb|KJB16879.1| hypothetical protein B456_002G252500 [Gossypium raimondii]
Length=243

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF+DFSDPRDADDAR   DGR+ DG RI+VEFA+GVPRG   SR+YLGRGPPPGS
Sbjct  1    MKRDYAFVDFSDPRDADDARYSLDGRDFDGSRIVVEFARGVPRG---SREYLGRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCG++GHWARDC A DWKNKCYRCGERGHIE  C NSP+KL
Sbjct  58   GRCFNCGVDGHWARDCTAEDWKNKCYRCGERGHIERNCRNSPRKL  102



>gb|KJB16878.1| hypothetical protein B456_002G252500 [Gossypium raimondii]
Length=244

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF+DFSDPRDADDAR   DGR+ DG RI+VEFA+GVPRG   SR+YLGRGPPPGS
Sbjct  1    MKRDYAFVDFSDPRDADDARYSLDGRDFDGSRIVVEFARGVPRG---SREYLGRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCG++GHWARDC A DWKNKCYRCGERGHIE  C NSP+KL
Sbjct  58   GRCFNCGVDGHWARDCTAEDWKNKCYRCGERGHIERNCRNSPRKL  102



>ref|XP_009116042.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Brassica rapa]
Length=267

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 98/122 (80%), Gaps = 5/122 (4%)
 Frame = +3

Query  186  LFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGS  365
            L C + RVRDVDMKRDYAF++FSDPRDADDAR Y DGR+ DG RI VE ++G PRG   S
Sbjct  14   LDCTFHRVRDVDMKRDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASRGAPRG---S  70

Query  366  RDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPN--SPQKLX  539
            RD   RGPPPGSGRCFNCG++GHWARDC AGDWKNKCYRCGERGHIE  C N  SP+K  
Sbjct  71   RDSGSRGPPPGSGRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNSPSPKKAR  130

Query  540  RG  545
            RG
Sbjct  131  RG  132



>ref|XP_009146919.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Brassica rapa]
Length=258

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 98/121 (81%), Gaps = 5/121 (4%)
 Frame = +3

Query  186  LFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGS  365
            L   + R+RD+DMKRDYAFI+FSDPRDADDAR   DGR+ DG RI VEFA+G PRG   S
Sbjct  7    LANHFRRIRDLDMKRDYAFIEFSDPRDADDARYRLDGRDFDGSRITVEFARGTPRG---S  63

Query  366  RDYLG-RGPPP-GSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLX  539
            RD+   RGPPP GSGRCFNCG+EGHWARDC AGDWKNKCYRCG+RGHIE  C NSP+KL 
Sbjct  64   RDFSSSRGPPPPGSGRCFNCGLEGHWARDCSAGDWKNKCYRCGDRGHIERNCKNSPKKLR  123

Query  540  R  542
            R
Sbjct  124  R  124



>ref|XP_006576253.1| PREDICTED: uncharacterized protein LOC100813237 isoform X4 [Glycine 
max]
Length=258

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK D+AF++FSDPRDADDAR   DGR+V+G RIIVEFAKG PRG    R+Y+GRGPPPGS
Sbjct  1    MKNDFAFVEFSDPRDADDARYNLDGRDVEGSRIIVEFAKGGPRG-SRDREYMGRGPPPGS  59

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL +
Sbjct  60   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIEKNCKNSPKKLSQ  106



>ref|XP_010553024.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010553025.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Tarenaya hassleriana]
Length=239

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF+DFSDPRDADDAR   DGR+ DG RIIVEFA+G PRG   SR+Y  RGPPPG+
Sbjct  1    MKRDYAFVDFSDPRDADDARHRLDGRDFDGSRIIVEFARGTPRG---SREYSSRGPPPGT  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG++GHWARDC AGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  58   GRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNSPKKLRR  104



>gb|KDO67848.1| hypothetical protein CISIN_1g021599mg [Citrus sinensis]
 gb|KDO67849.1| hypothetical protein CISIN_1g021599mg [Citrus sinensis]
 gb|KDO67850.1| hypothetical protein CISIN_1g021599mg [Citrus sinensis]
Length=269

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKLRR  107



>ref|XP_006436153.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 ref|XP_006436155.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 ref|XP_006436156.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 ref|XP_006485982.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X4 [Citrus sinensis]
 gb|ESR49393.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 gb|ESR49395.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 gb|ESR49396.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
Length=271

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKLRR  107



>ref|XP_010505315.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Camelina sativa]
Length=244

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 92/107 (86%), Gaps = 3/107 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR Y DGR++DG RI VEF++G PRG   SRDY  RGPPPGS
Sbjct  1    MKRDYAFVEFSDPRDADDARHYLDGRDIDGSRITVEFSRGAPRG---SRDYDSRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG++GHWARDC AGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  58   GRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNSPKKLRR  104



>gb|KDO67851.1| hypothetical protein CISIN_1g021599mg [Citrus sinensis]
Length=268

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  105



>gb|KJB16876.1| hypothetical protein B456_002G252500 [Gossypium raimondii]
Length=244

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = +3

Query  222  MKRDYAFI-DFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPG  398
            MKRDYAF+ DFSDPRDADDAR   DGR+ DG RI+VEFA+GVPRG   SR+YLGRGPPPG
Sbjct  1    MKRDYAFVQDFSDPRDADDARYSLDGRDFDGSRIVVEFARGVPRG---SREYLGRGPPPG  57

Query  399  SGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            SGRCFNCG++GHWARDC A DWKNKCYRCGERGHIE  C NSP+KL
Sbjct  58   SGRCFNCGVDGHWARDCTAEDWKNKCYRCGERGHIERNCRNSPRKL  103



>ref|XP_006436152.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
 ref|XP_006485983.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X5 [Citrus sinensis]
 gb|ESR49392.1| hypothetical protein CICLE_v10032170mg [Citrus clementina]
Length=270

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  105



>ref|XP_009402246.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  198  YGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYL  377
            + RVRDVDMK DYAF++FSDPRDADDAR   +GRE DG RIIVEFAKGVPRG GGSR+Y 
Sbjct  17   FRRVRDVDMKHDYAFVEFSDPRDADDARYSLNGREFDGSRIIVEFAKGVPRGSGGSREYP  76

Query  378  GRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRGPPPGSGRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+ L  G
Sbjct  77   GRGPPPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCHNSPKNLKPG  132



>ref|XP_010230324.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X3 [Brachypodium distachyon]
Length=276

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 94/115 (82%), Gaps = 8/115 (7%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRD--------YL  377
            MK ++AF++FSDPRDADDAR   DGR+ DG R+IVEFAKGVPRG GGSRD        Y+
Sbjct  1    MKHEFAFVEFSDPRDADDARYNLDGRDFDGSRMIVEFAKGVPRGQGGSRDRDRGGDREYM  60

Query  378  GRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRGPPPGSGRCFNCGI+GHWARDCKAGDWKN+CYRCG+ GHIE  C NSP+ L R
Sbjct  61   GRGPPPGSGRCFNCGIDGHWARDCKAGDWKNRCYRCGDSGHIERDCQNSPKNLSR  115



>gb|KDO67847.1| hypothetical protein CISIN_1g021599mg [Citrus sinensis]
Length=297

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRD+AF++FSDPRDADDAR   +GR+VDG RIIVEFA+G PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKL  536
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKL  105



>ref|XP_009103866.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32 isoform 
X2 [Brassica rapa]
Length=283

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  186  LFCKYGRVRDVDMKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGS  365
            L   + RVRDVDMKRDYAF++FSDPRDADDAR Y DGR+ DG RI VE ++G PRG   +
Sbjct  22   LIFWFRRVRDVDMKRDYAFVEFSDPRDADDARHYLDGRDFDGSRITVEASRGAPRGSRDA  81

Query  366  RDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNS  524
            RD   RGPPPGSGRCFNCG++GHWARDC AGDWKNKCYRCGERGHIE  C NS
Sbjct  82   RDNGSRGPPPGSGRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNS  134



>ref|XP_010658146.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Vitis vinifera]
Length=263

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK D+AF++FSDPRDADDAR   +GR+ DG RIIVEFAKG PRGPGGSR+YLGRGPPPGS
Sbjct  1    MKHDFAFVEFSDPRDADDARYSLNGRDFDGSRIIVEFAKGGPRGPGGSREYLGRGPPPGS  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  61   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKLKRG  108



>ref|XP_006604543.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 
X4 [Glycine max]
Length=256

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MK D+AF++FSDPRDADDAR   DGR+V+G RIIVEFAKG   GP GSR+ LGRG PPGS
Sbjct  1    MKNDFAFVEFSDPRDADDARYSLDGRDVEGSRIIVEFAKG---GPRGSRENLGRGLPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCGI+GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+K  R
Sbjct  58   GRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIEKNCKNSPKKSSR  104



>ref|XP_010486532.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Camelina sativa]
Length=241

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 91/108 (84%), Gaps = 4/108 (4%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPPG  398
            MKRDYAFIDFSDPRDADDAR   DGR+ DG RIIVEFAKG PRG   SR++   RGPPPG
Sbjct  1    MKRDYAFIDFSDPRDADDARYRLDGRDFDGSRIIVEFAKGTPRG---SREFSSSRGPPPG  57

Query  399  SGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            SGRCFNCG++GHWARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  58   SGRCFNCGLDGHWARDCSAGDWKNKCYRCGDRGHIERNCKNSPKKLRR  105



>ref|XP_010474332.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Camelina sativa]
Length=221

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 91/108 (84%), Gaps = 4/108 (4%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPPG  398
            MKRDYAFIDFSDPRDADDAR   DGR+ DG RIIVEFAKG PRG   SR++   RGPPPG
Sbjct  1    MKRDYAFIDFSDPRDADDARYRLDGRDFDGSRIIVEFAKGTPRG---SREFSSSRGPPPG  57

Query  399  SGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            SGRCFNCG++GHWARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  58   SGRCFNCGLDGHWARDCSAGDWKNKCYRCGDRGHIERNCKNSPKKLRR  105



>ref|XP_006293505.1| hypothetical protein CARUB_v10023766mg [Capsella rubella]
 gb|EOA26403.1| hypothetical protein CARUB_v10023766mg [Capsella rubella]
Length=250

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR Y DGR+ DG RI VEF++G PRG   SR+Y  RGPPPGS
Sbjct  1    MKRDYAFVEFSDPRDADDARHYLDGRDFDGSRITVEFSRGAPRG---SREYDSRGPPPGS  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG++GHWARDC AGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  58   GRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNSPKKLRR  104



>gb|AFW74826.1| hypothetical protein ZEAMMB73_867689 [Zea mays]
Length=285

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  300  EVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGSGRCFNCGIEGHWARDCKAGDWKNKCY  479
            +VDG RI+VEFAKGVPRGPGGSR+Y+GRGPPPG+GRCFNCG++GHWARDCKAGDWKNKCY
Sbjct  20   DVDGSRIVVEFAKGVPRGPGGSREYMGRGPPPGTGRCFNCGMDGHWARDCKAGDWKNKCY  79

Query  480  RCGERGHIEXKCPNSPQKLXR  542
            RCGERGHIE  C NSP+ + R
Sbjct  80   RCGERGHIERNCQNSPRSVRR  100



>ref|XP_010464608.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform 
X2 [Camelina sativa]
Length=241

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 90/108 (83%), Gaps = 4/108 (4%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLG-RGPPPG  398
            MKRDYAFIDFSDPRDADDAR   DGR+ DG RIIVEFAKG PRG   SR+    RGPPPG
Sbjct  1    MKRDYAFIDFSDPRDADDARYRLDGRDFDGSRIIVEFAKGTPRG---SREISSSRGPPPG  57

Query  399  SGRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            SGRCFNCG++GHWARDC AGDWKNKCYRCG+RGHIE  C NSP+KL R
Sbjct  58   SGRCFNCGLDGHWARDCSAGDWKNKCYRCGDRGHIERNCKNSPKKLRR  105



>ref|XP_009623929.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33-like [Nicotiana 
tomentosiformis]
Length=261

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++FSDPRDADDAR   +GR+VDG RI VEFAKGVPRGPGGSR++ GRGPPPG+
Sbjct  1    MKRDYAFVEFSDPRDADDARYGLNGRDVDGSRITVEFAKGVPRGPGGSREFGGRGPPPGT  60

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXRG  545
            GRCFNCG++GHWARDCKAGDWKNKCYRCGERGHIE  C NSP+KL RG
Sbjct  61   GRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKLKRG  108



>ref|NP_973620.1| arginine/serine-rich zinc knuckle-containing protein 33 [Arabidopsis 
thaliana]
 gb|AAC98054.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09386.1| arginine/serine-rich zinc knuckle-containing protein 33 [Arabidopsis 
thaliana]
Length=249

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 3/107 (3%)
 Frame = +3

Query  222  MKRDYAFIDFSDPrdaddarryydgrEVDGRRIIVEFAKGVPRGPGGSRDYLGRGPPPGS  401
            MKRDYAF++F DPRDADDAR Y DGR+ DG RI VEF++G PRG   SRD+  RGPPPG+
Sbjct  1    MKRDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSRGAPRG---SRDFDSRGPPPGA  57

Query  402  GRCFNCGIEGHWARDCKAGDWKNKCYRCGERGHIEXKCPNSPQKLXR  542
            GRCFNCG++GHWARDC AGDWKNKCYRCGERGHIE  C NSP+KL R
Sbjct  58   GRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNSPKKLRR  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 913772722720