BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10248

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011070909.1|  PREDICTED: cytochrome P450 CYP749A22-like          120   1e-27   Sesamum indicum [beniseed]
ref|XP_008358468.1|  PREDICTED: cytochrome P450 CYP749A22-like          114   8e-26   
ref|XP_007222983.1|  hypothetical protein PRUPE_ppa004319mg             114   9e-26   Prunus persica
ref|XP_008367032.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    113   2e-25   
ref|XP_007224155.1|  hypothetical protein PRUPE_ppa016800mg             113   2e-25   
ref|XP_009356202.1|  PREDICTED: cytochrome P450 CYP749A22-like          112   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_007224838.1|  hypothetical protein PRUPE_ppa023100mg             112   4e-25   
ref|XP_008351041.1|  PREDICTED: cytochrome P450 CYP749A22-like          114   5e-25   
ref|XP_009356542.1|  PREDICTED: uncharacterized protein LOC103947363    114   6e-25   
ref|XP_008243804.1|  PREDICTED: cytochrome P450 CYP749A22-like          110   2e-24   Prunus mume [ume]
ref|XP_007226460.1|  hypothetical protein PRUPE_ppa024660mg             110   3e-24   Prunus persica
ref|XP_008243805.1|  PREDICTED: cytochrome P450 CYP749A22-like          110   3e-24   Prunus mume [ume]
ref|XP_008389250.1|  PREDICTED: cytochrome P450 CYP749A22-like          109   5e-24   
ref|XP_009357376.1|  PREDICTED: cytochrome P450 CYP749A22-like          109   8e-24   Pyrus x bretschneideri [bai li]
ref|XP_007225594.1|  hypothetical protein PRUPE_ppa026874mg             107   8e-24   
ref|XP_011015642.1|  PREDICTED: cytochrome P450 CYP749A22-like          108   8e-24   Populus euphratica
ref|XP_007224911.1|  hypothetical protein PRUPE_ppa021901mg             108   1e-23   
ref|XP_011462983.1|  PREDICTED: cytochrome P450 CYP749A22-like          108   1e-23   Fragaria vesca subsp. vesca
ref|XP_004297206.2|  PREDICTED: uncharacterized protein LOC101301286    110   1e-23   Fragaria vesca subsp. vesca
ref|XP_004303121.1|  PREDICTED: cytochrome P450 CYP749A22-like          108   1e-23   Fragaria vesca subsp. vesca
ref|XP_008243895.1|  PREDICTED: cytochrome P450 CYP749A22-like          110   2e-23   
gb|EYU22575.1|  hypothetical protein MIMGU_mgv1a004725mg                108   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_009356447.1|  PREDICTED: cytochrome P450 CYP749A22-like          107   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_008339617.1|  PREDICTED: cytochrome P450 CYP749A22-like          106   2e-23   
ref|XP_008350887.1|  PREDICTED: cytochrome P450 CYP749A22-like          107   2e-23   
ref|XP_008243892.1|  PREDICTED: cytochrome P450 CYP749A22-like          108   3e-23   
ref|XP_007222985.1|  hypothetical protein PRUPE_ppa004328mg             107   4e-23   Prunus persica
ref|XP_008390037.1|  PREDICTED: uncharacterized protein LOC103452311    109   4e-23   
ref|XP_008243887.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   5e-23   
ref|XP_004297211.1|  PREDICTED: cytochrome P450 CYP749A22-like          107   5e-23   Fragaria vesca subsp. vesca
ref|XP_002316008.1|  hypothetical protein POPTR_0010s14920g             106   8e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002512040.1|  cytochrome P450, putative                          106   1e-22   Ricinus communis
emb|CDP00469.1|  unnamed protein product                                105   1e-22   Coffea canephora [robusta coffee]
ref|XP_004297208.1|  PREDICTED: cytochrome P450 CYP749A22-like          105   1e-22   Fragaria vesca subsp. vesca
ref|XP_008243777.1|  PREDICTED: cytochrome P450 CYP749A22-like          107   1e-22   
ref|XP_006348652.1|  PREDICTED: cytochrome P450 734A1-like              105   1e-22   
ref|XP_009356543.1|  PREDICTED: uncharacterized protein LOC103947364    107   1e-22   
ref|XP_010091621.1|  Cytochrome P450 734A1                              105   1e-22   Morus notabilis
ref|XP_008243779.1|  PREDICTED: cytochrome P450 CYP749A22-like          105   2e-22   Prunus mume [ume]
ref|XP_007223137.1|  hypothetical protein PRUPE_ppa004329mg             105   2e-22   Prunus persica
ref|XP_007226407.1|  hypothetical protein PRUPE_ppa022752mg             105   2e-22   
ref|XP_008367031.1|  PREDICTED: cytochrome P450 CYP749A22-like          105   2e-22   Malus domestica [apple tree]
ref|XP_008243893.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    103   2e-22   Prunus mume [ume]
ref|XP_008219236.1|  PREDICTED: cytochrome P450 CYP749A22-like          105   2e-22   Prunus mume [ume]
ref|XP_008361867.1|  PREDICTED: uncharacterized protein LOC103425555    107   2e-22   
gb|KCW44245.1|  hypothetical protein EUGRSUZ_L02323                     103   3e-22   Eucalyptus grandis [rose gum]
ref|XP_007034363.1|  Cytochrome P450                                    105   4e-22   
gb|KCW82723.1|  hypothetical protein EUGRSUZ_C04098                     103   4e-22   Eucalyptus grandis [rose gum]
ref|XP_008229697.1|  PREDICTED: cytochrome P450 CYP749A22-like          103   5e-22   
ref|XP_007224470.1|  hypothetical protein PRUPE_ppa022621mg             103   6e-22   
ref|XP_011462984.1|  PREDICTED: cytochrome P450 CYP749A22-like is...    103   6e-22   Fragaria vesca subsp. vesca
ref|XP_007226762.1|  hypothetical protein PRUPE_ppa018724mg             103   6e-22   Prunus persica
ref|XP_007201527.1|  hypothetical protein PRUPE_ppa016887mg             103   8e-22   Prunus persica
ref|XP_007045779.1|  Cytochrome P450, putative                          103   8e-22   
ref|XP_007034362.1|  Cytochrome P450                                    104   8e-22   
gb|KDP35170.1|  hypothetical protein JCGZ_10704                         103   9e-22   Jatropha curcas
gb|KCW82722.1|  hypothetical protein EUGRSUZ_C04098                     103   9e-22   Eucalyptus grandis [rose gum]
ref|XP_010320842.1|  PREDICTED: cytochrome P450 CYP749A22               103   1e-21   Solanum lycopersicum
ref|XP_012075435.1|  PREDICTED: cytochrome P450 CYP749A22-like          103   1e-21   Jatropha curcas
ref|XP_010049898.1|  PREDICTED: cytochrome P450 CYP749A22-like          103   1e-21   Eucalyptus grandis [rose gum]
gb|KCW82725.1|  hypothetical protein EUGRSUZ_C04102                     103   1e-21   Eucalyptus grandis [rose gum]
ref|XP_004297212.1|  PREDICTED: cytochrome P450 CYP749A22-like is...    102   2e-21   Fragaria vesca subsp. vesca
sp|H2DH17.1|C7A22_PANGI  RecName: Full=Cytochrome P450 CYP749A22;...    102   2e-21   Panax ginseng [Asiatic ginseng]
gb|KCW86460.1|  hypothetical protein EUGRSUZ_B03128                     102   2e-21   Eucalyptus grandis [rose gum]
ref|XP_008243806.1|  PREDICTED: cytochrome P450 CYP749A22-like          102   2e-21   Prunus mume [ume]
ref|XP_007222124.1|  hypothetical protein PRUPE_ppa004646mg             102   3e-21   
ref|XP_004298351.1|  PREDICTED: cytochrome P450 CYP749A22-like          102   3e-21   Fragaria vesca subsp. vesca
ref|XP_007226531.1|  hypothetical protein PRUPE_ppa025196mg             101   4e-21   Prunus persica
ref|XP_010046256.1|  PREDICTED: cytochrome P450 CYP749A22-like          100   4e-21   Eucalyptus grandis [rose gum]
ref|XP_006437869.1|  hypothetical protein CICLE_v10033485mg             100   4e-21   
gb|KJB78243.1|  hypothetical protein B456_012G185300                    101   6e-21   Gossypium raimondii
ref|XP_008340298.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   6e-21   
ref|XP_007221838.1|  hypothetical protein PRUPE_ppa023692mg             101   6e-21   
ref|XP_002512037.1|  cytochrome P450, putative                          100   7e-21   
gb|KCW85138.1|  hypothetical protein EUGRSUZ_B01978                     100   7e-21   Eucalyptus grandis [rose gum]
ref|XP_007226180.1|  hypothetical protein PRUPE_ppa015588mg             100   7e-21   Prunus persica
ref|XP_007045775.1|  Cytochrome P450                                    100   7e-21   Theobroma cacao [chocolate]
ref|XP_008243778.1|  PREDICTED: cytochrome P450 CYP749A22-like          100   8e-21   Prunus mume [ume]
ref|XP_002316006.2|  hypothetical protein POPTR_0010s14900g             100   1e-20   
ref|XP_010041584.1|  PREDICTED: cytochrome P450 CYP749A22-like          101   1e-20   
ref|XP_006484251.1|  PREDICTED: cytochrome P450 734A1-like              100   1e-20   Citrus sinensis [apfelsine]
gb|KDO70287.1|  hypothetical protein CISIN_1g039293mg                   100   1e-20   Citrus sinensis [apfelsine]
ref|XP_007045776.1|  Cytochrome P450                                    100   2e-20   
ref|XP_008243803.1|  PREDICTED: cytochrome P450 CYP749A22-like        99.8    2e-20   Prunus mume [ume]
ref|XP_010046611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    101   2e-20   
ref|XP_007223262.1|  hypothetical protein PRUPE_ppa004463mg           99.8    2e-20   Prunus persica
ref|XP_006484252.1|  PREDICTED: cytochrome P450 734A1-like            99.0    4e-20   Citrus sinensis [apfelsine]
ref|XP_006437870.1|  hypothetical protein CICLE_v10031156mg           98.6    5e-20   Citrus clementina [clementine]
gb|KCW85137.1|  hypothetical protein EUGRSUZ_B01976                   98.2    5e-20   Eucalyptus grandis [rose gum]
gb|KDO36840.1|  hypothetical protein CISIN_1g012962mg                 97.8    6e-20   Citrus sinensis [apfelsine]
gb|KDP35171.1|  hypothetical protein JCGZ_10705                       98.2    6e-20   Jatropha curcas
gb|KHG26927.1|  Cytochrome P450 protein                               98.2    6e-20   Gossypium arboreum [tree cotton]
gb|KDP35176.1|  hypothetical protein JCGZ_10710                       97.8    6e-20   Jatropha curcas
ref|XP_002316010.2|  hypothetical protein POPTR_0010s14950g           98.2    6e-20   Populus trichocarpa [western balsam poplar]
gb|KCW85143.1|  hypothetical protein EUGRSUZ_B01987                   98.2    7e-20   Eucalyptus grandis [rose gum]
gb|KDP41353.1|  hypothetical protein JCGZ_15760                       97.8    7e-20   Jatropha curcas
gb|KDP41351.1|  hypothetical protein JCGZ_15758                       97.8    8e-20   Jatropha curcas
ref|XP_011009712.1|  PREDICTED: cytochrome P450 CYP749A22-like        98.2    8e-20   Populus euphratica
ref|XP_011102246.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.8    8e-20   Sesamum indicum [beniseed]
ref|XP_008360080.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.8    8e-20   
ref|XP_012075437.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.8    9e-20   Jatropha curcas
ref|XP_012075440.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.8    9e-20   
gb|KHG08441.1|  Cytochrome P450 protein                               97.4    1e-19   Gossypium arboreum [tree cotton]
gb|AJD25261.1|  cytochrome P450 CYP749A39                             97.8    1e-19   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011101783.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.4    1e-19   Sesamum indicum [beniseed]
ref|XP_012067827.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.4    1e-19   Jatropha curcas
gb|KDP41345.1|  hypothetical protein JCGZ_15752                       96.7    1e-19   Jatropha curcas
ref|XP_009356448.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.4    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_007045778.1|  Cytochrome P450                                  97.4    1e-19   
ref|XP_004295657.2|  PREDICTED: cytochrome P450 CYP749A22-like        97.4    2e-19   Fragaria vesca subsp. vesca
ref|XP_012067825.1|  PREDICTED: cytochrome P450 CYP749A22-like        97.1    2e-19   
gb|KCW85140.1|  hypothetical protein EUGRSUZ_B01983                   97.1    2e-19   Eucalyptus grandis [rose gum]
ref|XP_006484250.1|  PREDICTED: cytochrome P450 734A1-like            97.1    2e-19   Citrus sinensis [apfelsine]
ref|XP_006437867.1|  hypothetical protein CICLE_v10033321mg           97.1    2e-19   Citrus clementina [clementine]
ref|XP_011009723.1|  PREDICTED: cytochrome P450 CYP749A22-like        96.7    2e-19   Populus euphratica
ref|XP_004297193.1|  PREDICTED: cytochrome P450 CYP749A22-like        96.3    3e-19   Fragaria vesca subsp. vesca
gb|KCW44878.1|  hypothetical protein EUGRSUZ_L01541                   94.7    3e-19   Eucalyptus grandis [rose gum]
ref|XP_006437871.1|  hypothetical protein CICLE_v10031156mg           96.3    3e-19   Citrus clementina [clementine]
ref|XP_010046258.1|  PREDICTED: cytochrome P450 CYP749A22-like        94.7    4e-19   
gb|KJB80516.1|  hypothetical protein B456_013G101100                  95.5    5e-19   Gossypium raimondii
ref|XP_002512042.1|  cytochrome P450, putative                        94.7    6e-19   
ref|XP_008352941.1|  PREDICTED: cytochrome P450 CYP749A22-like        95.5    7e-19   
ref|XP_008339765.1|  PREDICTED: cytochrome P450 CYP749A22-like        95.5    7e-19   
ref|XP_002316009.1|  hypothetical protein POPTR_0010s14940g           95.5    7e-19   
gb|KDO70288.1|  hypothetical protein CISIN_1g009043mg                 95.1    8e-19   Citrus sinensis [apfelsine]
ref|XP_011101779.1|  PREDICTED: cytochrome P450 CYP749A22-like        95.1    9e-19   Sesamum indicum [beniseed]
gb|KCW44686.1|  hypothetical protein EUGRSUZ_L01780                   94.0    9e-19   Eucalyptus grandis [rose gum]
ref|XP_011102247.1|  PREDICTED: cytochrome P450 CYP749A22-like        94.7    9e-19   Sesamum indicum [beniseed]
ref|XP_007045772.1|  Secologanin synthase, putative                   95.9    1e-18   
ref|XP_002325505.1|  hypothetical protein POPTR_0019s09980g           94.7    1e-18   
ref|XP_009346501.1|  PREDICTED: cytochrome P450 CYP749A22-like        94.4    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_010040838.1|  PREDICTED: cytochrome P450 CYP749A22-like        94.4    2e-18   Eucalyptus grandis [rose gum]
ref|XP_011015632.1|  PREDICTED: cytochrome P450 CYP749A22-like        94.0    2e-18   Populus euphratica
ref|XP_008389384.1|  PREDICTED: cytochrome P450 CYP749A22-like        94.0    2e-18   
gb|KDO70290.1|  hypothetical protein CISIN_1g009043mg                 93.2    2e-18   Citrus sinensis [apfelsine]
emb|CDP00472.1|  unnamed protein product                              94.7    3e-18   Coffea canephora [robusta coffee]
ref|XP_008346697.1|  PREDICTED: cytochrome P450 CYP749A22-like        93.2    4e-18   
ref|XP_011008174.1|  PREDICTED: cytochrome P450 CYP749A22-like        93.2    4e-18   Populus euphratica
ref|XP_010046249.1|  PREDICTED: cytochrome P450 CYP749A22-like        92.8    5e-18   
ref|XP_004298350.1|  PREDICTED: cytochrome P450 CYP749A22-like        92.8    5e-18   Fragaria vesca subsp. vesca
gb|KDO70289.1|  hypothetical protein CISIN_1g009043mg                 92.8    5e-18   Citrus sinensis [apfelsine]
ref|XP_009607163.1|  PREDICTED: cytochrome P450 CYP749A22-like        92.4    6e-18   Nicotiana tomentosiformis
ref|XP_012068355.1|  PREDICTED: cytochrome P450 CYP749A22-like        92.4    6e-18   Jatropha curcas
ref|XP_010041049.1|  PREDICTED: cytochrome P450 734A1-like            93.6    6e-18   
gb|KHG09430.1|  Secologanin synthase                                  90.5    8e-18   Gossypium arboreum [tree cotton]
gb|KJB28189.1|  hypothetical protein B456_005G033300                  92.0    8e-18   Gossypium raimondii
gb|KHG09815.1|  Cytochrome P450 protein                               92.0    1e-17   Gossypium arboreum [tree cotton]
gb|KHG16086.1|  Secologanin synthase                                  90.1    1e-17   Gossypium arboreum [tree cotton]
gb|KJB28188.1|  hypothetical protein B456_005G033200                  91.7    1e-17   Gossypium raimondii
gb|KHG16087.1|  Secologanin synthase                                  90.1    1e-17   Gossypium arboreum [tree cotton]
gb|EYU22576.1|  hypothetical protein MIMGU_mgv1a004757mg              91.7    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_010091618.1|  Cytochrome P450 734A1                            91.3    2e-17   
ref|XP_010044379.1|  PREDICTED: cytochrome P450 CYP749A22-like        91.3    2e-17   Eucalyptus grandis [rose gum]
ref|XP_008374265.1|  PREDICTED: cytochrome P450 CYP749A22-like        91.3    2e-17   
ref|XP_008364583.1|  PREDICTED: cytochrome P450 CYP749A22-like        91.3    2e-17   
ref|XP_009346500.1|  PREDICTED: cytochrome P450 CYP749A22-like        91.3    2e-17   Pyrus x bretschneideri [bai li]
gb|KJB80431.1|  hypothetical protein B456_013G097000                  91.3    2e-17   Gossypium raimondii
gb|KHG14937.1|  Cytochrome P450 protein                               90.9    2e-17   Gossypium arboreum [tree cotton]
gb|KJB28185.1|  hypothetical protein B456_005G032800                  90.9    3e-17   Gossypium raimondii
ref|XP_012068356.1|  PREDICTED: cytochrome P450 CYP749A22-like        90.5    3e-17   
gb|KDP41344.1|  hypothetical protein JCGZ_15751                       89.7    4e-17   Jatropha curcas
emb|CDP00470.1|  unnamed protein product                              90.1    5e-17   Coffea canephora [robusta coffee]
gb|KHG20729.1|  hypothetical protein F383_28301                       90.9    5e-17   Gossypium arboreum [tree cotton]
ref|XP_004298349.1|  PREDICTED: cytochrome P450 CYP749A22-like        89.7    5e-17   Fragaria vesca subsp. vesca
gb|KHG06141.1|  Cytochrome P450 protein                               90.1    5e-17   Gossypium arboreum [tree cotton]
ref|XP_009356544.1|  PREDICTED: uncharacterized protein LOC103947365  90.9    5e-17   
gb|AJD25260.1|  cytochrome P450 CYP749A38                             89.4    8e-17   Salvia miltiorrhiza [Chinese salvia]
gb|KCW86463.1|  hypothetical protein EUGRSUZ_B03131                   89.4    8e-17   Eucalyptus grandis [rose gum]
ref|XP_010044378.1|  PREDICTED: cytochrome P450 CYP749A22-like is...  89.4    8e-17   Eucalyptus grandis [rose gum]
gb|KJB10709.1|  hypothetical protein B456_001G217300                  89.4    9e-17   Gossypium raimondii
gb|KHG18356.1|  Cytochrome P450 protein                               89.0    1e-16   Gossypium arboreum [tree cotton]
ref|XP_010046255.1|  PREDICTED: cytochrome P450 CYP749A22-like        87.4    2e-16   Eucalyptus grandis [rose gum]
gb|KCW44812.1|  hypothetical protein EUGRSUZ_L01624                   88.2    2e-16   Eucalyptus grandis [rose gum]
ref|XP_009762791.1|  PREDICTED: cytochrome P450 CYP749A22-like        88.2    2e-16   Nicotiana sylvestris
ref|XP_002325324.2|  hypothetical protein POPTR_0019s03160g           88.2    2e-16   Populus trichocarpa [western balsam poplar]
gb|KHG16899.1|  Secologanin synthase                                  87.8    2e-16   Gossypium arboreum [tree cotton]
ref|XP_006388777.1|  hypothetical protein POPTR_0102s00210g           87.8    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002512039.1|  cytochrome P450, putative                        87.4    3e-16   
ref|XP_004298348.1|  PREDICTED: cytochrome P450 CYP749A22-like        87.4    3e-16   Fragaria vesca subsp. vesca
ref|XP_006348799.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    86.7    4e-16   
ref|XP_006437868.1|  hypothetical protein CICLE_v10033709mg           87.0    4e-16   
gb|AJD25259.1|  cytochrome P450 CYP749A37                             87.0    4e-16   Salvia miltiorrhiza [Chinese salvia]
gb|KHG08051.1|  Cytochrome P450 protein                               87.0    4e-16   Gossypium arboreum [tree cotton]
gb|KHG26580.1|  Cytochrome P450 protein                               86.7    6e-16   Gossypium arboreum [tree cotton]
gb|KJB28183.1|  hypothetical protein B456_005G032600                  86.7    7e-16   Gossypium raimondii
gb|KHG14912.1|  Cytochrome P450 protein                               86.3    8e-16   Gossypium arboreum [tree cotton]
gb|KJB72083.1|  hypothetical protein B456_011G158000                  85.9    1e-15   Gossypium raimondii
emb|CDP12576.1|  unnamed protein product                              85.5    1e-15   Coffea canephora [robusta coffee]
ref|XP_010044377.1|  PREDICTED: cytochrome P450 CYP749A22-like is...  85.9    1e-15   Eucalyptus grandis [rose gum]
gb|KJB28192.1|  hypothetical protein B456_005G033600                  85.5    2e-15   Gossypium raimondii
gb|KHG07569.1|  Cytochrome P450 protein                               85.5    2e-15   Gossypium arboreum [tree cotton]
ref|XP_007045774.1|  Cytochrome P450                                  85.5    2e-15   
gb|EYU22581.1|  hypothetical protein MIMGU_mgv1a004745mg              85.1    2e-15   Erythranthe guttata [common monkey flower]
gb|KHG11625.1|  Cytochrome P450 protein                               85.1    2e-15   Gossypium arboreum [tree cotton]
gb|KCW86467.1|  hypothetical protein EUGRSUZ_B03135                   84.7    2e-15   Eucalyptus grandis [rose gum]
ref|XP_008356573.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  84.7    3e-15   
ref|XP_007210003.1|  hypothetical protein PRUPE_ppa016601mg           84.7    3e-15   
gb|KHG09429.1|  Cytochrome P450 protein                               84.7    3e-15   Gossypium arboreum [tree cotton]
ref|XP_009607162.1|  PREDICTED: cytochrome P450 CYP749A22-like        84.7    3e-15   Nicotiana tomentosiformis
ref|XP_010044380.1|  PREDICTED: cytochrome P450 CYP749A22-like        84.7    3e-15   Eucalyptus grandis [rose gum]
gb|KGN51993.1|  hypothetical protein Csa_5G606830                     83.2    4e-15   Cucumis sativus [cucumbers]
gb|KHG20842.1|  Secologanin synthase                                  84.0    4e-15   Gossypium arboreum [tree cotton]
gb|KHG20728.1|  hypothetical protein F383_28301                       85.1    4e-15   Gossypium arboreum [tree cotton]
gb|EYU22578.1|  hypothetical protein MIMGU_mgv1a004881mg              84.0    5e-15   Erythranthe guttata [common monkey flower]
ref|XP_011070908.1|  PREDICTED: cytochrome P450 CYP749A22-like        83.2    9e-15   Sesamum indicum [beniseed]
gb|KHG27490.1|  Cytochrome P450 protein                               82.8    1e-14   Gossypium arboreum [tree cotton]
gb|KCW44246.1|  hypothetical protein EUGRSUZ_L02324                   82.8    1e-14   Eucalyptus grandis [rose gum]
gb|KCW73209.1|  hypothetical protein EUGRSUZ_E016722                  81.3    2e-14   Eucalyptus grandis [rose gum]
gb|KDP25920.1|  hypothetical protein JCGZ_23044                       79.3    2e-14   Jatropha curcas
ref|XP_010044376.1|  PREDICTED: cytochrome P450 CYP749A22-like        82.4    2e-14   Eucalyptus grandis [rose gum]
ref|XP_004135430.2|  PREDICTED: cytochrome P450 CYP749A22-like        82.0    2e-14   Cucumis sativus [cucumbers]
ref|XP_012086314.1|  PREDICTED: cytochrome P450 CYP749A22-like        80.9    2e-14   Jatropha curcas
ref|XP_010058553.1|  PREDICTED: cytochrome P450 CYP749A22-like        81.6    2e-14   Eucalyptus grandis [rose gum]
gb|KHG14401.1|  Cytochrome P450 protein                               82.4    2e-14   Gossypium arboreum [tree cotton]
ref|XP_010046246.1|  PREDICTED: cytochrome P450 CYP749A22-like        81.6    3e-14   
gb|KHG03731.1|  Secologanin synthase                                  81.6    3e-14   Gossypium arboreum [tree cotton]
ref|XP_011070904.1|  PREDICTED: cytochrome P450 CYP749A22-like        81.6    3e-14   Sesamum indicum [beniseed]
gb|KHG17439.1|  Secologanin synthase                                  81.3    4e-14   Gossypium arboreum [tree cotton]
ref|XP_004239025.1|  PREDICTED: cytochrome P450 CYP749A22-like        81.3    4e-14   Solanum lycopersicum
gb|KHG24669.1|  Secologanin synthase                                  81.3    4e-14   Gossypium arboreum [tree cotton]
gb|KGN51994.1|  hypothetical protein Csa_5G606840                     80.1    5e-14   Cucumis sativus [cucumbers]
gb|KCW85139.1|  hypothetical protein EUGRSUZ_B01979                   79.0    5e-14   Eucalyptus grandis [rose gum]
gb|KJB28173.1|  hypothetical protein B456_005G0331001                 80.5    5e-14   Gossypium raimondii
gb|KJB28186.1|  hypothetical protein B456_005G032900                  80.9    5e-14   Gossypium raimondii
ref|XP_008446466.1|  PREDICTED: cytochrome P450 CYP749A22-like        80.9    6e-14   Cucumis melo [Oriental melon]
ref|XP_010046253.1|  PREDICTED: cytochrome P450 CYP749A22-like        79.3    6e-14   Eucalyptus grandis [rose gum]
ref|XP_010054392.1|  PREDICTED: cytochrome P450 CYP749A22-like        80.5    7e-14   
gb|KCW76385.1|  hypothetical protein EUGRSUZ_D00767                   80.1    7e-14   Eucalyptus grandis [rose gum]
ref|XP_002316007.2|  hypothetical protein POPTR_0010s14910g           80.1    9e-14   Populus trichocarpa [western balsam poplar]
gb|AEM42984.1|  cytochrome P450                                       80.1    1e-13   Siraitia grosvenorii [arhat fruit]
ref|XP_010044348.1|  PREDICTED: cytochrome P450 CYP749A22-like        80.1    1e-13   Eucalyptus grandis [rose gum]
ref|XP_008243890.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.4    1e-13   Prunus mume [ume]
ref|XP_010049897.1|  PREDICTED: cytochrome P450 CYP749A22-like        79.7    1e-13   Eucalyptus grandis [rose gum]
ref|XP_011009686.1|  PREDICTED: cytochrome P450 CYP749A22-like        79.0    2e-13   Populus euphratica
ref|XP_004135429.2|  PREDICTED: cytochrome P450 CYP749A22-like        79.0    2e-13   Cucumis sativus [cucumbers]
ref|XP_010049895.1|  PREDICTED: cytochrome P450 CYP749A22-like        79.0    2e-13   Eucalyptus grandis [rose gum]
ref|XP_011460709.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.4    3e-13   Fragaria vesca subsp. vesca
ref|XP_008243891.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.8    4e-13   
gb|KDP41343.1|  hypothetical protein JCGZ_15750                       77.8    4e-13   Jatropha curcas
ref|XP_010056458.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.8    6e-13   Eucalyptus grandis [rose gum]
gb|KCW73229.1|  hypothetical protein EUGRSUZ_E01694                   77.4    8e-13   Eucalyptus grandis [rose gum]
ref|XP_006856330.2|  PREDICTED: cytochrome P450 CYP749A22             77.0    1e-12   
ref|XP_010056464.1|  PREDICTED: cytochrome P450 CYP749A22-like        77.0    1e-12   Eucalyptus grandis [rose gum]
gb|KCW86459.1|  hypothetical protein EUGRSUZ_B03127                   77.0    1e-12   Eucalyptus grandis [rose gum]
ref|XP_009784592.1|  PREDICTED: cytochrome P450 CYP749A22-like        74.7    1e-12   Nicotiana sylvestris
gb|KHG27367.1|  Cytochrome P450 protein                               76.6    1e-12   Gossypium arboreum [tree cotton]
gb|KHG26170.1|  Secologanin synthase                                  76.3    2e-12   Gossypium arboreum [tree cotton]
gb|ERN17799.1|  hypothetical protein AMTR_s00047p00162060             71.2    2e-12   Amborella trichopoda
gb|KHG29404.1|  Cytochrome P450 protein                               75.5    2e-12   Gossypium arboreum [tree cotton]
ref|XP_011457333.1|  PREDICTED: cytochrome P450 CYP749A22-like        75.9    2e-12   Fragaria vesca subsp. vesca
ref|XP_010046608.1|  PREDICTED: cytochrome P450 CYP749A22-like        73.9    3e-12   
gb|KJB79907.1|  hypothetical protein B456_013G071400                  75.5    3e-12   Gossypium raimondii
gb|KJB79281.1|  hypothetical protein B456_013G041900                  74.7    6e-12   Gossypium raimondii
gb|KDP35189.1|  hypothetical protein JCGZ_10723                       71.2    8e-12   Jatropha curcas
gb|KHG08575.1|  Cytochrome P450 protein                               73.2    2e-11   Gossypium arboreum [tree cotton]
gb|KCW85135.1|  hypothetical protein EUGRSUZ_B019753                  71.2    2e-11   Eucalyptus grandis [rose gum]
ref|XP_006348800.1|  PREDICTED: cytochrome P450 734A1-like            70.5    2e-11   Solanum tuberosum [potatoes]
gb|KHG09370.1|  hypothetical protein F383_13386                       72.0    2e-11   Gossypium arboreum [tree cotton]
gb|AJD25262.1|  cytochrome P450 CYP749A40                             72.8    2e-11   Salvia miltiorrhiza [Chinese salvia]
gb|KHG09369.1|  hypothetical protein F383_13386                       72.4    2e-11   Gossypium arboreum [tree cotton]
gb|KJB28191.1|  hypothetical protein B456_005G033500                  72.4    3e-11   Gossypium raimondii
gb|KHG16163.1|  Cytochrome P450 protein                               71.2    7e-11   Gossypium arboreum [tree cotton]
ref|XP_004511069.1|  PREDICTED: secologanin synthase-like isoform X2  71.2    7e-11   
gb|KCW86465.1|  hypothetical protein EUGRSUZ_B03133                   71.2    8e-11   Eucalyptus grandis [rose gum]
gb|KCW82720.1|  hypothetical protein EUGRSUZ_C04097                   71.2    8e-11   Eucalyptus grandis [rose gum]
gb|KDP35175.1|  hypothetical protein JCGZ_10709                       70.1    9e-11   Jatropha curcas
gb|EYU22577.1|  hypothetical protein MIMGU_mgv1a004830mg              70.1    2e-10   Erythranthe guttata [common monkey flower]
gb|KJB79277.1|  hypothetical protein B456_013G041300                  70.1    2e-10   Gossypium raimondii
ref|XP_008446467.1|  PREDICTED: cytochrome P450 CYP749A22-like        69.7    3e-10   Cucumis melo [Oriental melon]
ref|XP_003628063.1|  Cytochrome P450 monooxygenase CYP72A65           69.3    4e-10   
gb|ERN17806.1|  hypothetical protein AMTR_s00047p00168890             65.1    4e-10   Amborella trichopoda
gb|KJB28195.1|  hypothetical protein B456_005G033700                  68.9    5e-10   Gossypium raimondii
gb|KCW62989.1|  hypothetical protein EUGRSUZ_G00589                   68.6    5e-10   Eucalyptus grandis [rose gum]
gb|ERN17795.1|  hypothetical protein AMTR_s00047p00155480             67.0    5e-10   Amborella trichopoda
ref|XP_004511068.1|  PREDICTED: secologanin synthase-like isoform X1  68.9    5e-10   Cicer arietinum [garbanzo]
gb|KHG30791.1|  Cytochrome P450 protein                               68.6    6e-10   Gossypium arboreum [tree cotton]
gb|AET02537.2|  cytochrome P450 family 72 protein                     67.8    8e-10   Medicago truncatula
gb|ERN17809.1|  hypothetical protein AMTR_s00047p00170540             63.9    9e-10   Amborella trichopoda
ref|XP_003628061.1|  Cytochrome P450 monooxygenase CYP72A65           67.8    9e-10   
ref|XP_004295655.2|  PREDICTED: cytochrome P450 CYP749A22-like is...  67.8    1e-09   
emb|CDP15980.1|  unnamed protein product                              67.8    1e-09   
ref|XP_003628060.1|  Cytochrome P450 monooxygenase CYP72A65           67.8    1e-09   
gb|ABC59079.1|  cytochrome P450 monooxygenase CYP72A65                67.8    1e-09   
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like        67.4    1e-09   
gb|ERN17798.1|  hypothetical protein AMTR_s00047p00159000             63.2    2e-09   
gb|ERN17812.1|  hypothetical protein AMTR_s00047p00171830             63.2    2e-09   
dbj|BAL45202.1|  cytochrome P450 monooxygenase                        67.0    2e-09   
sp|H1A981.1|C7263_MEDTR  RecName: Full=11-oxo-beta-amyrin 30-oxid...  67.0    2e-09   
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g           67.0    2e-09   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g           67.0    2e-09   
ref|XP_009358604.1|  PREDICTED: cytochrome P450 CYP749A22-like        65.1    2e-09   
dbj|BAL45201.1|  cytochrome P450 monooxygenase                        66.6    3e-09   
ref|XP_004243784.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.5    3e-09   
ref|XP_006856328.2|  PREDICTED: cytochrome P450 CYP749A22             66.2    3e-09   
ref|XP_003527236.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  66.2    4e-09   
gb|KHN18291.1|  Secologanin synthase                                  66.2    4e-09   
gb|KHN14193.1|  Secologanin synthase                                  66.2    4e-09   
ref|XP_011654018.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X3  65.9    4e-09   
ref|XP_006477950.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  65.9    4e-09   
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  65.9    4e-09   
gb|ABC59106.1|  cytochrome P450 monooxygenase CYP72A62                65.9    4e-09   
ref|XP_011470797.1|  PREDICTED: cytochrome P450 CYP749A22-like        64.3    5e-09   
ref|XP_003628068.1|  Cytochrome P450 monooxygenase CYP72A65           65.9    5e-09   
ref|XP_011069514.1|  PREDICTED: cytochrome P450 CYP749A22-like        61.6    5e-09   
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  65.9    5e-09   
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  65.9    5e-09   
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like             65.9    5e-09   
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like             65.9    5e-09   
ref|XP_003628067.1|  Cytochrome P450 monooxygenase CYP72A65           65.9    5e-09   
gb|KEH38472.1|  cytochrome P450 family protein                        65.5    5e-09   
ref|XP_006387919.1|  hypothetical protein POPTR_0480s002101g          62.4    6e-09   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                  65.5    6e-09   
gb|AJD25168.1|  cytochrome P450 CYP72A327                             65.5    6e-09   
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.5    6e-09   
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...  65.5    6e-09   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...  65.5    6e-09   
gb|KHG21314.1|  Secologanin synthase                                  65.5    6e-09   
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like            65.5    6e-09   
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like        65.5    7e-09   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like            65.1    7e-09   
gb|KHG30566.1|  Cytochrome P450 protein                               64.3    7e-09   
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg           65.1    8e-09   
ref|XP_011627833.1|  PREDICTED: cytochrome P450 CYP749A22             63.5    8e-09   
gb|KEH38478.1|  cytochrome P450 family 72 protein                     65.1    8e-09   
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...  65.1    9e-09   
gb|KJB50134.1|  hypothetical protein B456_008G154900                  64.7    1e-08   
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    64.7    1e-08   
gb|KHN28058.1|  Secologanin synthase                                  64.3    1e-08   
gb|KJB50133.1|  hypothetical protein B456_008G154900                  64.7    1e-08   
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg              64.7    1e-08   
ref|XP_010042221.1|  PREDICTED: cytochrome P450 72A15-like            64.3    1e-08   
gb|KHN44057.1|  Secologanin synthase                                  64.7    1e-08   
gb|KHN36820.1|  Secologanin synthase                                  64.7    1e-08   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  64.7    1e-08   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                   64.7    1e-08   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like            64.3    1e-08   
gb|KCW67647.1|  hypothetical protein EUGRSUZ_F01394                   64.3    1e-08   
gb|KCW84981.1|  hypothetical protein EUGRSUZ_B01805                   64.3    1e-08   
ref|XP_002512038.1|  cytochrome P450, putative                        64.3    1e-08   
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like        64.3    1e-08   
ref|XP_010042230.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  64.3    2e-08   
ref|XP_010046252.1|  PREDICTED: cytochrome P450 CYP749A22-like        63.9    2e-08   
ref|XP_010042238.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  64.3    2e-08   
ref|XP_010064521.1|  PREDICTED: cytochrome P450 72A14-like            63.9    2e-08   
ref|XP_006598136.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  63.9    2e-08   
ref|XP_011102241.1|  PREDICTED: cytochrome P450 CYP749A22-like        63.5    2e-08   
gb|AFK37510.1|  unknown                                               62.0    2e-08   
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.9    2e-08   
ref|XP_010068173.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    2e-08   
dbj|BAF98466.1|  cytochrome P450                                      63.9    2e-08   
ref|XP_010092744.1|  Secologanin synthase                             63.9    2e-08   
gb|KCW84980.1|  hypothetical protein EUGRSUZ_B01804                   63.9    2e-08   
gb|KEH37984.1|  cytochrome P450 family 72 protein                     63.9    2e-08   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like             63.9    2e-08   
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59           63.9    2e-08   
gb|KEH28455.1|  cytochrome P450 family 72 protein                     63.5    2e-08   
gb|ERN17803.1|  hypothetical protein AMTR_s00047p00167060             60.1    2e-08   
emb|CBI22129.3|  unnamed protein product                              63.5    2e-08   
gb|KCW67651.1|  hypothetical protein EUGRSUZ_F01398                   63.5    2e-08   
ref|XP_010091620.1|  Cytochrome P450 734A1                            63.5    2e-08   
ref|XP_010041835.1|  PREDICTED: cytochrome P450 72A15-like            63.5    2e-08   
gb|AFB70987.1|  secologanin synthase 1                                62.0    3e-08   
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    3e-08   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    3e-08   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                   63.5    3e-08   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                        63.5    3e-08   
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    3e-08   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like            63.5    3e-08   
emb|CBI39938.3|  unnamed protein product                              63.5    3e-08   
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like             63.5    3e-08   
ref|XP_004146005.2|  PREDICTED: cytochrome P450 CYP72A219 isoform X1  63.5    3e-08   
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    3e-08   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like        63.5    3e-08   
emb|CBI39916.3|  unnamed protein product                              63.5    3e-08   
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219             63.2    3e-08   
ref|XP_011654017.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2  63.5    3e-08   
gb|KJB28190.1|  hypothetical protein B456_005G033400                  63.2    3e-08   
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like             63.2    3e-08   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    63.2    4e-08   
gb|KEH38477.1|  cytochrome P450 family 72 protein                     62.8    4e-08   
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g           63.2    4e-08   
ref|XP_006598138.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  63.2    4e-08   
gb|KHN44056.1|  Secologanin synthase                                  63.2    4e-08   
gb|KEH38476.1|  cytochrome P450 family 72 protein                     62.8    4e-08   
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  62.8    4e-08   
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    4e-08   
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    4e-08   
emb|CBI22133.3|  unnamed protein product                              63.2    4e-08   
gb|KEH36886.1|  cytochrome P450 family monooxygenase                  62.8    4e-08   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                62.8    5e-08   
ref|XP_007133275.1|  hypothetical protein PHAVU_011G166000g           62.4    5e-08   
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                62.8    5e-08   
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    5e-08   
gb|ABC69392.1|  CYP72A55v1                                            62.8    5e-08   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like            62.8    5e-08   
dbj|BAL45198.1|  cytochrome P450 monooxygenase                        62.8    5e-08   
ref|XP_006377672.1|  hypothetical protein POPTR_0011s101202g          62.8    5e-08   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    5e-08   
gb|ABC69393.1|  CYP72A55v2                                            62.8    5e-08   
emb|CDP19609.1|  unnamed protein product                              62.8    5e-08   
gb|KEH38475.1|  cytochrome P450 family 72 protein                     62.8    5e-08   
ref|XP_010065489.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    62.4    6e-08   
ref|XP_008777429.1|  PREDICTED: cytochrome P450 72A15-like            62.4    6e-08   
gb|EMT11454.1|  Secologanin synthase                                  62.8    6e-08   
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.8    6e-08   
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein        62.8    6e-08   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like            62.8    6e-08   
emb|CBI39940.3|  unnamed protein product                              62.4    6e-08   
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein        62.4    6e-08   
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like             62.4    6e-08   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.4    6e-08   
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like            62.4    6e-08   
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein        62.4    6e-08   
emb|CDP15983.1|  unnamed protein product                              62.4    6e-08   
ref|XP_004294189.1|  PREDICTED: cytochrome P450 72A15-like            62.4    6e-08   
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219             62.4    6e-08   
ref|XP_006377686.1|  hypothetical protein POPTR_0011s102201g          62.0    7e-08   
emb|CDP16565.1|  unnamed protein product                              62.4    7e-08   
emb|CAN71061.1|  hypothetical protein VITISV_032613                   61.6    7e-08   
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like             62.4    7e-08   
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...  62.4    7e-08   
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.4    7e-08   
gb|KEH37983.1|  cytochrome P450 family 72 protein                     62.4    7e-08   
ref|XP_010091619.1|  Cytochrome P450 734A1                            62.4    7e-08   
gb|EMS52653.1|  Secologanin synthase                                  62.4    7e-08   
emb|CDP20014.1|  unnamed protein product                              62.0    7e-08   
gb|AFS28689.1|  putative secologanin synthase                         61.6    7e-08   
emb|CAN67740.1|  hypothetical protein VITISV_015554                   62.4    8e-08   
gb|AHH02367.1|  putative secologanin synthase                         59.3    8e-08   
ref|XP_002526971.1|  cytochrome P450, putative                        62.0    8e-08   
gb|KGN66157.1|  hypothetical protein Csa_1G574250                     58.5    8e-08   
gb|AFS28688.1|  putative secologanin synthase                         61.6    8e-08   
ref|XP_006377690.1|  cytochrome P450 family protein                   62.0    8e-08   
emb|CDP15975.1|  unnamed protein product                              62.0    8e-08   
ref|XP_008351040.1|  PREDICTED: cytochrome P450 CYP749A22-like        61.6    8e-08   
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    62.0    8e-08   
emb|CDP15982.1|  unnamed protein product                              62.0    9e-08   
ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  62.0    9e-08   
emb|CDP14360.1|  unnamed protein product                              62.0    9e-08   
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like        62.0    9e-08   
ref|XP_006377681.1|  cytochrome P450 family protein                   61.6    1e-07   
emb|CDP11335.1|  unnamed protein product                              62.0    1e-07   
ref|XP_007043676.1|  Cytochrome P450, putative                        62.0    1e-07   
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like             62.0    1e-07   
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...  62.0    1e-07   
ref|XP_011654406.1|  PREDICTED: cytochrome P450 CYP72A219-like        61.6    1e-07   
gb|KCW62995.1|  hypothetical protein EUGRSUZ_G00595                   61.6    1e-07   
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                   61.6    1e-07   
ref|XP_011654016.1|  PREDICTED: cytochrome P450 CYP72A219-like        61.6    1e-07   
dbj|BAO73906.1|  cytochrome P450                                      61.2    1e-07   
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like        61.6    1e-07   
ref|XP_006644395.1|  PREDICTED: secologanin synthase-like             61.6    1e-07   
gb|KHN44049.1|  Secologanin synthase                                  60.1    1e-07   
ref|XP_007133221.1|  hypothetical protein PHAVU_011G161600g           59.3    1e-07   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g           61.6    1e-07   
ref|XP_010065487.1|  PREDICTED: cytochrome P450 CYP72A219-like        61.6    1e-07   
gb|KCW62987.1|  hypothetical protein EUGRSUZ_G00587                   61.2    1e-07   
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase           61.6    1e-07   
ref|XP_003601306.1|  Cytochrome P450 monooxygenase CYP72A16           57.8    1e-07   
dbj|BAL45204.1|  cytochrome P450 monooxygenase                        61.6    1e-07   
gb|EAY74846.1|  hypothetical protein OsI_02738                        59.7    1e-07   
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein        61.2    1e-07   
gb|KHN47459.1|  Secologanin synthase                                  61.2    1e-07   
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase         61.2    1e-07   
gb|EPS68529.1|  hypothetical protein M569_06239                       61.2    1e-07   
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein        61.2    1e-07   
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                61.2    2e-07   
ref|XP_002885051.1|  hypothetical protein ARALYDRAFT_897732           57.4    2e-07   
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219             61.2    2e-07   
ref|XP_008805359.1|  PREDICTED: cytochrome P450 734A6-like            61.2    2e-07   
ref|XP_009362707.1|  PREDICTED: cytochrome P450 CYP72A219-like        61.2    2e-07   
ref|XP_004511114.1|  PREDICTED: secologanin synthase-like             61.2    2e-07   
emb|CDP15978.1|  unnamed protein product                              61.2    2e-07   
emb|CBI22134.3|  unnamed protein product                              61.2    2e-07   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like            61.2    2e-07   
ref|XP_010092742.1|  Secologanin synthase                             61.2    2e-07   
ref|NP_001136998.1|  putative cytochrome P450 superfamily protein     61.2    2e-07   
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...  61.2    2e-07   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...  61.2    2e-07   
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like    61.2    2e-07   
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like             60.8    2e-07   
gb|KHN44046.1|  Secologanin synthase                                  60.8    2e-07   
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g           60.8    2e-07   
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
gb|ABC59099.1|  cytochrome P450 monooxygenase CYP72A66                60.8    2e-07   
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like             60.8    2e-07   
emb|CBI39929.3|  unnamed protein product                              60.8    2e-07   
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein        60.8    2e-07   
gb|ABC69419.1|  CYP72A56                                              60.8    2e-07   
dbj|BAL45203.1|  cytochrome P450 monooxygenase                        60.8    2e-07   
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
ref|XP_011620352.1|  PREDICTED: cytochrome P450 CYP72A219             60.8    2e-07   
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like        60.8    2e-07   



>ref|XP_011070909.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=510

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/274 (31%), Positives = 127/274 (46%), Gaps = 75/274 (27%)
 Frame = +3

Query  54   MNSTAPNSGMDRMEGFAKAF--GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTSQTT  227
            +N+   N     +EG+AK      +S      WA  ++L+NS V                
Sbjct  121  LNNKDENYPKIDLEGYAKKLLGDGLSSSKGQKWARMRKLANS-VFHA-------------  166

Query  228  DLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLG  407
                       +SL  M   MI S E ++E W +Y+ K++EVF+ F ++ SE+IS+ +LG
Sbjct  167  -----------ESLKNMIPAMITSVETMLEKWKEYEDKEIEVFEEFRILTSEIISRTALG  215

Query  408  SNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL-------------  491
            S+ +E KNIF                   PG    ++   +++SEKL             
Sbjct  216  SSYMEGKNIFDMLMKLTLIVSRNAHKIKFPGISLFLRSKDEIESEKLGQGIRDCVVQIIT  275

Query  492  ----------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKL  623
                            L ANQ++    +IS+E++ DECK F + G   +TS L W +  L
Sbjct  276  KRETGETFRTDFLGKLLEANQDTDERKRISVEDITDECKTFYFAGHETSTSSLAWTILLL  335

Query  624  SRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            S  +  Q++AR EVI++FG   PNPDGIARLKI+
Sbjct  336  SVHQEWQDKARNEVIELFGQSKPNPDGIARLKIL  369



>ref|XP_008358468.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
 ref|XP_008358469.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=378

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 103/205 (50%), Gaps = 54/205 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MFT M+ S E I+E W  Y+GK++EVF+ F L  SE+ISK + GS+ +E +NIF 
Sbjct  167  ESLKSMFTEMVASAETILERWKSYEGKEIEVFEEFKLFTSEVISKTAFGSSYIEGQNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG     K + ++++EK                         
Sbjct  227  MLTKLTLLFFKSVYIIRLPGISKFFKSSDEIEAEKLEKGIHASIAEIFKKREKKSLTKGR  286

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+ ++ ++ +IS++++ DECK+F   G+  T +LL W +  L+   +
Sbjct  287  DSFGSDFLGLLLEAHHDANDNQRISVDDMVDECKSFYIAGQETTNTLLAWTIFLLAHHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIAR  713
             QE ARKEV+ +FG + PNPDGI R
Sbjct  347  WQEEARKEVMDLFGKQTPNPDGIVR  371



>ref|XP_007222983.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
 gb|EMJ24182.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
Length=516

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 105/207 (51%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   MI S E ++E W+ ++GK++EV++ F L  SE+IS+ + G++ L+ KNIF 
Sbjct  167  ESLKGMIPEMITSSETMLERWVNHEGKEIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P      K + ++ SEKL                        
Sbjct  227  MLGQLTFLIFKNNFSLRLPIISRFYKTSDEIKSEKLEKGIRNTIAGIVRKRESMAMTGEA  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++  + +IS++++ DECK F + G+  T SLL W +  L+ D +
Sbjct  287  DGFGRDFLGVLLKAHHDTNENQRISVDDIVDECKTFYFAGQETTNSLLAWTIFLLALDTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG ENPNPDG+ +LK
Sbjct  347  WQEEARKEVLQLFGKENPNPDGLNKLK  373



>ref|XP_008367032.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 104/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MFT M+ S E I+E W  Y+GK++EVF+ F L  SE+IS  + GS+ +E +NIF 
Sbjct  167  ESLKSMFTEMVASAETILERWKSYEGKEIEVFEEFKLFTSEVISXTAFGSSYIEGQNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG     K + ++++EK                         
Sbjct  227  MLTKLTLLFFKSVYTIRLPGISKFFKSSDEIEAEKLEKGIHASIAEIFKKREKKSLTKGR  286

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+ ++ ++ +IS++++ DECK+F   G+  T +LL W +  L+   +
Sbjct  287  DSFGSDFLGLLLKAHHDANDNQRISVDDMVDECKSFYIAGQETTNTLLAWTIFLLAHHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+ +FG + PNPDGIA LK
Sbjct  347  WQEEARKEVMDLFGKQTPNPDGIANLK  373



>ref|XP_007224155.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
 gb|EMJ25354.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
Length=493

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 105/207 (51%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   MI S E ++E W+ ++GK++EV++ F L  SE+IS+ + G++ L+ KNIF 
Sbjct  144  ESLKSMIPEMITSSETMLERWVNHEGKEIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFE  203

Query  441  GTG------------------------------------------GIVKKN------GDM  476
              G                                          GIV+K       GD 
Sbjct  204  MLGQLTFLIFKNNFSLRLPIISRFYKTSDEIKSEKLEKGIRDIIAGIVRKRESMAKTGDA  263

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            D         LL A+ ++  + +IS++++ DECK F + G+  T SLL W +  L+ D +
Sbjct  264  DGFGHDFLGVLLKAHHDTNENQRISVDDIVDECKTFYFAGQETTNSLLAWTIFLLALDTD  323

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG ENPNPDG+ +LK
Sbjct  324  WQEEARKEVLQLFGKENPNPDGLNKLK  350



>ref|XP_009356202.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 103/205 (50%), Gaps = 54/205 (26%)
 Frame = +3

Query  267  LNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF---  437
            L GM   +I S E ++E W ++DG++++VF+ F L  SE+ISK + GS+ LE KNIF   
Sbjct  168  LKGMAPTVIASAETMLETWKEHDGQEIDVFEEFRLYTSEVISKTAFGSSYLEGKNIFEIL  227

Query  438  ----------------PGTGGIVKKNGDMDSEKL--------------------------  491
                            PG    +K N +++S KL                          
Sbjct  228  DKLGHLSFKNAFKLRFPGISMFIKSNDEIESAKLEKSIRDSIMEMIKNRENKAMAGEEDS  287

Query  492  ---------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                     L A+Q++    +ISI+E+ DECK F + G+  T S L W V  L+   + Q
Sbjct  288  FGNDFLGVLLKAHQDTDERKRISIDEIVDECKTFYFAGQETTNSALAWTVFLLAIHTDWQ  347

Query  645  ERARKEVIQMFGSENPNPDGIARLK  719
            E ARKEVIQ+FG +NPN DGIA+LK
Sbjct  348  EDARKEVIQIFGKQNPNLDGIAKLK  372



>ref|XP_007224838.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
 gb|EMJ26037.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
Length=501

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 106/207 (51%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   MI S E ++E W+ ++GK++EV++ F L  SE+IS+ + G++ L+ KNIF 
Sbjct  152  ESLKSMIPEMITSSETMLERWVNHEGKEIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFE  211

Query  441  GTG------------------------------------------GIVKKN------GDM  476
              G                                          GIV+K       GD 
Sbjct  212  MLGQLTFLIFKNNFSLRLPIISRLYKPRDEIEMEKLEKGVRDTIAGIVRKRESKAMTGDA  271

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            D         LL A+ ++  + +IS++E+ DECK F + G+  T SLL W +  L+++ +
Sbjct  272  DGFGRDFLGVLLKAHHDTDENQRISMDEIVDECKTFYFAGQETTNSLLAWTIFLLAQNTD  331

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG ENPNPDG+ +LK
Sbjct  332  WQEEARKEVLQLFGKENPNPDGLNKLK  358



>ref|XP_008351041.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=1032

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 108/210 (51%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MFT M+ S E ++E W  Y+GK++EVF+ F L  SE+IS+ + GS+ +E +NIF 
Sbjct  683  ESLKSMFTEMVASAETMLEXWKSYEGKEIEVFEEFRLFTSEVISRTAFGSSYIEGQNIFG  742

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG     K + ++++EK                         
Sbjct  743  MLTKLTPLVFKSFYTIRLPGISQFFKSSDEIEAEKLEKGIHASITZIIKKREKKSMGEGR  802

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+ ++ ++ +IS++++ DECK F + G+  T + L W +  L+   +
Sbjct  803  DXFGCDFLGLLLNAHHDANDNQRISVDDLVDECKTFYFAGQETTNTSLAWTIFLLAHHTD  862

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE ARKEV+++FG + PNPDGIA+LK ++
Sbjct  863  WQEEARKEVMELFGKQTPNPDGIAKLKKIN  892


 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 102/206 (50%), Gaps = 53/206 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL  M   MI S EMI+E W  ++GK++EV++ F L  SE+IS+ + GS+ +E KN   
Sbjct  167  ESLKSMIPAMIASAEMILEEWKNHEGKEIEVYEQFRLFTSEVISRTAFGSSYIEGKNFFD  226

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   I K   +++SEK                         
Sbjct  227  NLMKLSSLLVKNSLTVRFPGISKIFKTGDEIESEKLDKAMRDSITEIIKKREKKAMAGEK  286

Query  489  ---------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                     L+ A+ ++ +S KIS++++ +ECK F + G+  T  +L W V  L+   + 
Sbjct  287  NFGSDYLGLLVKAHLDTNDSQKISVDDLVNECKTFYFAGQETTNGVLAWIVFLLALHTDW  346

Query  642  QERARKEVIQMFGSENPNPDGIARLK  719
            Q +ARKEV+Q+FG +NP  D IA+LK
Sbjct  347  QVKARKEVLQLFGKQNPTXDDIAKLK  372



>ref|XP_009356542.1| PREDICTED: uncharacterized protein LOC103947363 [Pyrus x bretschneideri]
Length=1066

 Score =   114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 108/210 (51%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MFT M+ S E ++E W  Y+GK++EVF+ F L  SE+IS+ + GS+ +E +NIF 
Sbjct  167  ESLKSMFTEMVASAETMLERWKSYEGKEIEVFEEFRLFTSEVISRTAFGSSYVEGQNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++++EKL                        
Sbjct  227  MLTKLTLLIFKSFYTIRLPGISQFFKSSDEIEAEKLEKGIHASITEIIKKREKKSMSEGQ  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++ ++ +IS++++ DECK F + G+  T + L W +  L+   +
Sbjct  287  DSFGCDFLGLLLKAHHDANDNQRISVDDLVDECKTFYFAGQETTNTSLAWTIFLLAHHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE ARKEV+++FG + PNPDGIA+LK ++
Sbjct  347  WQEEARKEVMELFGKQTPNPDGIAKLKKIN  376


 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 107/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MFT M+ S + ++E W  Y+GK++EVF+ F L  SE+IS+ + GS+ +E +NIF 
Sbjct  717  ESLKSMFTEMVVSAQTMLERWKSYEGKEIEVFEEFRLFTSEVISRTAFGSSYIEGQNIFE  776

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++++EKL                        
Sbjct  777  MLTKLTLLFFKSYYTIRLPGISKFFKSSDEIEAEKLEKGIHASITEILKKREKKSMTKGR  836

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++ ++ +IS++++  ECK+F + G+  T +LL W +  L+   N
Sbjct  837  DSFGSDFLGLLLKAHHDANDNQRISVDDMVYECKSFYFAGQETTNTLLAWTIFLLAHHTN  896

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE ARKEV+ +FG + PNPDGIA LK++
Sbjct  897  WQEEARKEVMDLFGKQTPNPDGIANLKMM  925



>ref|XP_008243804.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 104/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E ++E W+ ++GK++EV++ F L  SE+IS+ + G++ L+ KNIF 
Sbjct  167  ESLKSMIPDMITSSETMLERWVNHEGKEIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P      K + ++ SEKL                        
Sbjct  227  MLGQLTFLIFKNNFSLRLPIISRFYKTSDEIKSEKLEKGIRDTIAGIVRTRESMAMTGEA  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++  + +IS++++ DECK F + G+  T SLL W +  L+ + +
Sbjct  287  DGFGRDFLGVLLKAHHDTNENQRISVDDIVDECKTFYFAGQETTNSLLAWTIFLLALNTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG ENPNPDG+ +LK
Sbjct  347  WQEEARKEVLQLFGKENPNPDGLNKLK  373



>ref|XP_007226460.1| hypothetical protein PRUPE_ppa024660mg [Prunus persica]
 gb|EMJ27659.1| hypothetical protein PRUPE_ppa024660mg [Prunus persica]
Length=518

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++EVF+ F    SE+IS+ + GS+ +E ++IF 
Sbjct  169  ESLKSMIPAMVASAETMLERWKNYEGKEIEVFEEFRFFTSEVISRTAFGSSYIEGQHIFE  228

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K   +++SEKL                        
Sbjct  229  MLMKLGFLLTKNSFTIRVPGISKLFKTGDEIESEKLEKDVRASILEIVRKREEKVMTGGE  288

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A+ ++ +S +IS++++ D+CK F   G+  T SLL W V  L+   +
Sbjct  289  DSFGSDFLGLLVKAHHDANDSQRISVDDLIDDCKTFYVAGQETTNSLLAWTVFLLAHHTD  348

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE  RKEVIQMFG + PNPDGIA+LK
Sbjct  349  WQEETRKEVIQMFGKQTPNPDGIAKLK  375



>ref|XP_008243805.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 104/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E ++E W+ ++GK++EV++ F L  SE+IS+ + G++ L+ KNIF 
Sbjct  167  ESLKSMIPEMITSSETMLERWVNHEGKEIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P      K + ++ SEKL                        
Sbjct  227  MLGQLTFLIFKNNFSLRLPIISRFYKTSDEIKSEKLEKGIRDIIAGIVRKRESMAKTGEA  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++  + +IS++++ DECK F + G+  T SLL W +  L+ + +
Sbjct  287  DGFGHDFLGVLLKAHHDTNENQRISVDDIVDECKTFYFAGQETTNSLLAWTIFLLALNTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG ENPNPDG+ +LK
Sbjct  347  WQEEARKEVLQLFGKENPNPDGLNKLK  373



>ref|XP_008389250.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 101/205 (49%), Gaps = 54/205 (26%)
 Frame = +3

Query  267  LNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF---  437
            L GM   +I S E ++E W ++DG++++VF+ F L  SE+ISK + GS+ LE K IF   
Sbjct  168  LKGMAPTVIASAETMLETWKEHDGQEIDVFEEFRLYTSEVISKTAFGSSYLEGKXIFDIL  227

Query  438  ----------------PGTGGIVKKNGDMDSEKL--------------------------  491
                            PG    +K N +++S KL                          
Sbjct  228  EKLGYLSFKNAFKLRFPGISKFIKSNDEIESAKLEKSIRDSIMEMIKNRENKAMAGEEDS  287

Query  492  ---------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                     L A+ ++    +ISI+E+ DECK F + G+  T S L W V  L+   + Q
Sbjct  288  FGNDFLGVLLKAHHDTDEKKRISIDEIVDECKTFYFAGQETTNSALAWTVFLLAIHTDWQ  347

Query  645  ERARKEVIQMFGSENPNPDGIARLK  719
            E ARKEVIQ+FG +NPN DGIA+LK
Sbjct  348  EEARKEVIQIFGKQNPNLDGIAKLK  372



>ref|XP_009357376.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 104/208 (50%), Gaps = 54/208 (26%)
 Frame = +3

Query  267  LNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF---  437
            L GM   MI S E ++E W ++DGK+++VF+ F L  SE+IS+ + GS+ LE KNIF   
Sbjct  168  LKGMAPTMIASAETMLENWKEHDGKEIDVFKEFRLYTSEVISRTAFGSSYLEGKNIFENL  227

Query  438  ----------------PGTGGIVKKNGDMDSEKL--------------------------  491
                            P     +K   +++SEKL                          
Sbjct  228  EKLAYLSFKNAFNLRFPAFSRFIKSKDEIESEKLEKSIRDSIMEMIRKREDKAMVGEEGS  287

Query  492  ---------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                     + A+ ++  + + SI+E+ DECK F   G+  T+S L W V  L+   + Q
Sbjct  288  FGDDFLGVLIKAHHDADENQRTSIDEIVDECKTFYLGGQETTSSGLAWTVFLLAIHTDWQ  347

Query  645  ERARKEVIQMFGSENPNPDGIARLKIVD  728
            E ARKEVIQ+FG +NPN DGIA+LKI++
Sbjct  348  EEARKEVIQIFGKQNPNLDGIAKLKIMN  375



>ref|XP_007225594.1| hypothetical protein PRUPE_ppa026874mg, partial [Prunus persica]
 gb|EMJ26793.1| hypothetical protein PRUPE_ppa026874mg, partial [Prunus persica]
Length=338

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 97/176 (55%), Gaps = 31/176 (18%)
 Frame = +3

Query  285  GMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF---------  437
             M+ S E ++E W  Y+GK++EVF+ F    SE+IS+ +  S  +E ++IF         
Sbjct  41   AMVASAETMLERWKNYEGKEIEVFEEFRFFTSEVISRTAFSSFYIEGQHIFEMLMKLGFL  100

Query  438  ----------PGTGGIVKKNGDM-----------DSEKLLV-ANQesknsskisieeVAD  551
                      PG  GIV+K  +            D   LLV A+ ++ +S +IS++++ D
Sbjct  101  LTKNSLTIRVPGIRGIVRKREEKVMTGGEDSFGSDFLGLLVKAHHDANDSQRISVDDLID  160

Query  552  ECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            +CK F   G+  T SLL W V  L+   + QE ARKEV+Q+FG + PNPDGIA+LK
Sbjct  161  DCKTFYVAGQETTNSLLAWTVFLLAHHTDWQEEARKEVLQIFGKQTPNPDGIAKLK  216



>ref|XP_011015642.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=420

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 107/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI S E++++ W ++DGK+++VFQ F L+ SE+IS+ + GS+ LE +++F 
Sbjct  71   ECLKSMIPAMIASVEVMLKRWRQHDGKEIDVFQEFKLLTSEIISRTAFGSSYLEGQHVFD  130

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG G  VK   D++S+K                         
Sbjct  131  MLTRMGDIIVRNHYKITIPGIGKFVKTRDDIESDKLEQEIKNCFINMIKNREKAAMEGKR  190

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL+A+ E+  + +IS+E++ DECK F + G   T + L W V  L+   +
Sbjct  191  GDFGSDFLGILLLAHHEADKAKRISVEDIIDECKTFYFAGHETTRTSLTWTVLLLAFHTD  250

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EV+++FG +NPNP+GI +L  V
Sbjct  251  WQDKARREVLELFGLQNPNPEGITKLNTV  279



>ref|XP_007224911.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
 gb|EMJ26110.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
Length=451

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 109/210 (52%), Gaps = 55/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGE-MIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF  437
            +SL  M   M+ S E M++E W   +GK++EVF+ F +  SE+IS+ + GS+ LE +N+F
Sbjct  103  ESLKSMVPEMVASAETMLLEGWKNNEGKEIEVFEPFRMFTSEVISRTAFGSSYLEGQNLF  162

Query  438  -------------------PGTGGIVKKNGDMDSEKL-----------------------  491
                               PG     K + +++SEKL                       
Sbjct  163  ENLMKLSFLIFKNALTVRFPGISKFFKTSDEIESEKLQKGMHNSIIGIVEKREKKAMDGE  222

Query  492  ------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                        L A+ ++ +S +IS++++ DECK F + G+  T S+L W V  L+ + 
Sbjct  223  EDSFGSDFLGLLLKAHHDTNDSQRISVDDLVDECKTFYFAGQETTNSMLAWTVFLLALNT  282

Query  636  NLQERARKEVIQMFGSENPNPDGIARLKIV  725
            + QE ARKEV+Q+FG +NPNPDG+++LK++
Sbjct  283  DWQEEARKEVLQLFGRQNPNPDGLSKLKLM  312



>ref|XP_011462983.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 104/209 (50%), Gaps = 56/209 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MF  M  S E ++E W  ++GK+ +VF+ F L+ SE+I++ + GS+ LE +NIF 
Sbjct  164  ESLKAMFPDMTASAEAMIERWKNHEGKETDVFEEFRLLTSEVIARTAFGSSYLEGQNIFE  223

Query  438  --------------------PGTGGIVKKNGDMDSEKL----------------------  491
                                PG   + + +G+++++KL                      
Sbjct  224  MLKNLSIIVFKNLYKYKTRFPGISKVYRTSGEIEADKLEKEIQDSVMEIVKKREQKASSG  283

Query  492  -------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRD  632
                         L ++ +  +  K SI+ V +ECKA  +VG+  T++LL W V  L++ 
Sbjct  284  EGESFGSDFLGLLLKSHHDINDDQKFSIDNVVEECKALYFVGQETTSTLLSWTVFLLAQH  343

Query  633  KNLQERARKEVIQMFGSENPNPDGIARLK  719
               QE ARKEV+Q+FG E PN DGI++LK
Sbjct  344  PEWQEEARKEVLQLFGKETPNSDGISKLK  372



>ref|XP_004297206.2| PREDICTED: uncharacterized protein LOC101301286 [Fragaria vesca 
subsp. vesca]
Length=1032

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 103/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S E ++E W  ++GK++EVF+ F L  SE+IS+ + GS+ +E K IF 
Sbjct  162  ENLKTMIPAMITSAETMLERWTNHNGKEIEVFEEFRLFTSEVISRTAFGSSYIEGKQIFE  221

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K + +++S+KL                        
Sbjct  222  MLIKMGFLTFKNAFNLRFPGISKIYKTSDEIESDKLEKGIRDSIIEIVKKREDKAMSGQE  281

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ +S    +IS++++ DECKAF + G+  +TSLL W V  L+   +
Sbjct  282  DYFGSDFLGLLLKAHHDSNEKQRISMDDLVDECKAFYFAGQETSTSLLAWTVFLLALHTD  341

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE AR EV+Q+FG + PNPDG ++LK
Sbjct  342  WQEEARNEVLQLFGKQTPNPDGFSKLK  368


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/213 (28%), Positives = 101/213 (47%), Gaps = 57/213 (27%)
 Frame = +3

Query  258  EDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE-----  422
            E SL       I S   +++ W  ++GK++EV++ F L+ +E+IS+ + GS+ LE     
Sbjct  676  ESSLKNKIPATIDSAGTMLQRWKNHEGKEIEVYEEFRLLTAEVISRTAFGSSYLEGQHIF  735

Query  423  ----------AKNIFP-----GTGGIVKKNGDMDSEKL----------------------  491
                      +KN+F          + K   + ++EKL                      
Sbjct  736  DMLMKFYFLISKNLFTIRLPTFISKVYKTKDETEAEKLDQGIRDSILKIIKEREAKAMKT  795

Query  492  --------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSR  629
                          L A+ ++  + +I++EE+ DECK   + G+ +T SLL W +  L+ 
Sbjct  796  GEEGNFGQDFLGMLLKAHHDADVNQRITVEELIDECKTLYFAGQDSTASLLAWTILLLAL  855

Query  630  DKNLQERARKEVIQMFGSEN-PNPDGIARLKIV  725
              + Q+ A+KEV+Q+FG +N PN DGIA+LK +
Sbjct  856  HTDWQDEAQKEVLQVFGKQNQPNHDGIAKLKTL  888



>ref|XP_004303121.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 104/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI   E+++E W  Y+GK++EVF+ F L  S++IS+ + GS+ LE ++IF 
Sbjct  164  ESLKTMIPDMIAGTEIMLERWRNYEGKEIEVFEEFRLFTSDVISRTAFGSSYLEGQHIFE  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG       + +++SEKL                        
Sbjct  224  MLMKLTLLLFKNSLKIKVPGISKFFDTSDEIESEKLEKEIRDSIIELVKKREHKATSGEE  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++  + +IS++++ D+CK F + G+  T +L+ W V  L+   +
Sbjct  284  NSFGSDFLGSLLKAHHDANQNQRISVDDLVDDCKTFYFAGQETTNTLIAWTVFLLAHHTD  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG ENP+PDGI++LK
Sbjct  344  WQEEARKEVLQLFGKENPHPDGISKLK  370



>ref|XP_008243895.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1009

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 104/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++E+F+ F    SE+IS+ + GS+ +E ++IF 
Sbjct  170  ESLKSMIPAMVASAETMLERWKNYEGKEIEMFEEFRFFTSEVISRTAFGSSYIEGQHIFE  229

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K   +++SEKL                        
Sbjct  230  MLMKLGFLLSKNALTIRVPGISKLFKTGDEIESEKLEKDVRASILEIVRKREEKVMTGGE  289

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A+ ++ +S +IS++++ D+CK F   G+ +T SLL W V  L+   +
Sbjct  290  DSFGSDFLGLLVKAHHDANDSQRISVDDLIDDCKTFYVAGQESTNSLLAWTVLLLAHHTD  349

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVIQMFG + PNPDGIA+LK
Sbjct  350  WQEEARKEVIQMFGKQTPNPDGIAKLK  376


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 92/184 (50%), Gaps = 31/184 (17%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++EV++ F L  SE+IS+ + GS+ +E ++IF 
Sbjct  683  ESLKSMIPEMVASAESMLERWTVYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQDIFE  742

Query  438  ------------------PGTGGIVKKNGDMDSEKLL--VANQesknsskisieeVADEC  557
                              PG     K + +++SEKL   +     +   K   + +A E 
Sbjct  743  ILMKLGFLIFKNFLKVRVPGISKFFKTSDEIESEKLEKGIHASIIEMVKKREKKTMAGEK  802

Query  558  KAF----------CYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGI  707
             +F             G+  T +LL W V  L+   + QE ARKEV+Q+FG + PN DGI
Sbjct  803  DSFGSDFLGLLLKANAGQETTNTLLAWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGI  862

Query  708  ARLK  719
             +LK
Sbjct  863  GKLK  866



>gb|EYU22575.1| hypothetical protein MIMGU_mgv1a004725mg [Erythranthe guttata]
Length=513

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 108/206 (52%), Gaps = 50/206 (24%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   MI S E ++E W +Y+GK++EVF+ F L+ SE+ISK + GS+ LE K+IF 
Sbjct  168  DSLKNMIPEMITSVETMLEKWKEYEGKEIEVFEEFRLLTSEIISKTAFGSSYLEGKSIFD  227

Query  438  ------------------PGTGGIVKKNGDMDSEKL----------LVANQesknssk--  527
                              P     +    D +SEKL          ++A +E++ +S+  
Sbjct  228  MLMKLAFIVSRNAHTIKLPFISRFLPSKDDYESEKLEQGIRDCIVRIIAKRETEETSRND  287

Query  528  ------------------isieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
                              +S+E++ DECK F + G   TTSLL W V  L+ ++  Q++A
Sbjct  288  FLGKLLETNNNNQNKNTKMSVEDIVDECKTFYFAGHETTTSLLAWTVLLLAINQEWQDKA  347

Query  654  RKEVIQMFG-SENPNPDGIARLKIVD  728
            R E I+ FG + NPNPD I+RLKI++
Sbjct  348  RNETIESFGQTTNPNPDNISRLKIMN  373



>ref|XP_009356447.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 106/210 (50%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   M+ S E ++E W  ++GK++EV++ F L  SE+IS+ + GS+ +E KNIF 
Sbjct  167  ETLKSMIPEMVASAEAMLERWKFFEGKEIEVYEEFRLFTSEVISRTAFGSSYIEGKNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++S+KL                        
Sbjct  227  MLMKLSSLLFKNAFKVRVPGISKFFKTSDEIESDKLEKEVHATIIEIVKKRENKAGTEEK  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A   + ++ +IS++E+ DECK F + G+  T +LLGW V  L+ + +
Sbjct  287  DSFGSDFLGLLLKARHSANDNQRISVDELIDECKTFYFAGQETTNTLLGWTVFLLALNTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE ARKEVIQ+FG + PN DGIA+++ ++
Sbjct  347  WQEEARKEVIQLFGKQTPNHDGIAKMRTMN  376



>ref|XP_008339617.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=399

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 102/205 (50%), Gaps = 54/205 (26%)
 Frame = +3

Query  267  LNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI----  434
            L GM   MI S E ++E W ++DGK+++VF+ F L  SE+IS+ + GS+ LE KNI    
Sbjct  168  LKGMAPTMITSAETLLENWKEHDGKEIDVFKEFRLYTSEVISRTAFGSSYLEGKNIFENL  227

Query  435  ---------------FPGTGGIVKKNGDMDSEK---------------------------  488
                           FPG    +K   +++SEK                           
Sbjct  228  EKLAYLSFKNAFNLRFPGISKFIKSKDEIESEKLEKSIRGSIMEMIKKREDKAMVGEEGS  287

Query  489  --------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                    L  A+ ++  + +ISI+E+ DECK F   G+  T+S L W V  L+   + Q
Sbjct  288  FGNDFLGVLTKAHHDADENQRISIDEIVDECKTFYLGGQETTSSGLAWTVFLLAIHTDWQ  347

Query  645  ERARKEVIQMFGSENPNPDGIARLK  719
            E ARKEVIQ+FG++NPN DGIA+ K
Sbjct  348  EEARKEVIQIFGNQNPNLDGIAKTK  372



>ref|XP_008350887.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=518

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MF+ M+ S E ++E W  YDGK++EVF    L +SE+IS+ + GS+ +E KNIF 
Sbjct  169  ESLKSMFSEMVASAETMLERWKDYDGKEIEVFGELKLFSSEVISRTAFGSSYIEGKNIFE  228

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG    +K   ++++EK                         
Sbjct  229  MLNNIGFLIFKNALTIRIPGISKFLKTRDEIEAEKLEKAVHASIVEIVRKREEKAMTGGE  288

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A  +S +  +IS++++ DECK F + G+    +LL W V  L+   +
Sbjct  289  DSFGSDFLGLLLKAYHDSNDDQRISVDDLVDECKTFYFAGQETANTLLAWTVFLLALHTD  348

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVI++FG + PN DGIA++K
Sbjct  349  WQEEARKEVIRLFGKQTPNHDGIAKMK  375



>ref|XP_008243892.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=557

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 103/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI SGE ++E    ++GK++EV+  F    SE+IS+ + GS+ LE KNIF 
Sbjct  208  ESLKSMIPAMIASGETMLERLKNHEGKEIEVYDEFRFFTSEVISRTAFGSSYLEGKNIFE  267

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++S +L                        
Sbjct  268  MLMKLSFLTFKNALKLRFPGISKIFKTRDEIESAELEKGIRDSVMEVIKKREKKAMGGEE  327

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++    +IS++++ DECK F + G+  T SLL W V  L+  ++
Sbjct  328  DGFGSDFLGLLLKAHHDTNEKQRISVDDLVDECKTFYFAGQETTNSLLAWTVFLLALHRD  387

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE ARKEV+Q+FG +NP+P+GI++LK +
Sbjct  388  WQEEARKEVLQLFGKQNPHPEGISKLKTM  416



>ref|XP_007222985.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
 gb|EMJ24184.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
Length=516

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++EV++ F L  SE+IS+ + GS+ +E ++IF 
Sbjct  167  ESLKSMIPEMVASAESMLERWTVYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQDIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++SEKL                        
Sbjct  227  ILMKLGFLIFKNFLKVRVPGISKFFKTSDEIESEKLEKGIHASIIEMVKKREKKTMGGEK  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  + +IS++E+ DECK F + G+  T +LL W V  L+   +
Sbjct  287  DSFGSDFLGLLLKANHEANENQRISVQEIIDECKTFYFAGQETTNTLLAWTVFLLALHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + PN DGI +LK
Sbjct  347  WQEEARKEVLQLFGKQTPNLDGIGKLK  373



>ref|XP_008390037.1| PREDICTED: uncharacterized protein LOC103452311 [Malus domestica]
Length=1032

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 107/210 (51%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   M+ S E ++E W  ++GK++EV++ F L  SE+IS+ + GS+ +E KNIF 
Sbjct  167  ETLKSMIPEMVASAEAMLERWKFFEGKEIEVYEEFRLFTSEVISRTAFGSSYIEGKNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++S+KL                        
Sbjct  227  MLMKLGSILFKNAFKVRVPGISKFFKTSDEIESDKLEKEVHATIIEIVKKRENKAGTKEK  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A Q + ++ +IS++E+ DECK F + G+  T +LLGW V  L+ + +
Sbjct  287  DNFGSDFLGLLLKAXQSADDNQRISVDELIDECKTFYFAGQETTNTLLGWTVFLLALNTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE ARKEVIQ+FG + PN DGIA+++ ++
Sbjct  347  WQEEARKEVIQLFGKQTPNHDGIAKMRTMN  376


 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  MF+ M+ S E ++E W  YDGK++EVF    L +SE+IS+ + GS+ +E KNIF 
Sbjct  683  ESLKSMFSEMVASAETMLERWKDYDGKEIEVFGELKLFSSEVISRTAFGSSYIEGKNIFE  742

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG    +K   ++++EK                         
Sbjct  743  MLNNIGFLIFKNALTIRIPGISKFLKTRDEIEAEKLEKAVHASIVEIVXKREEKAMTGGE  802

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A  +S +  +IS++++ DECK F + G+    +LL W V  L+   +
Sbjct  803  DSFGSDFLGLLLKAYHDSNDDQRISVDDLVDECKTFYFAGQETANTLLAWTVFLLALHTD  862

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVI +FG + PN DGIA++K
Sbjct  863  WQEEARKEVIXLFGXQTPNHDGIAKMK  889



>ref|XP_008243887.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103342098 
[Prunus mume]
Length=1035

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 105/206 (51%), Gaps = 53/206 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W   +GK++EVF+ F +  SE+IS+ + GS+ LE +N F 
Sbjct  167  ESLKSMVPEMVASAETMLEGWKNSEGKEIEVFEPFRMFTSEVISRTAFGSSYLEGQNFFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++SEKL                        
Sbjct  227  NLMKLSFLIFKNALTVRFPGISKFFKTSDEIESEKLEKGMHDSIIEIVEKREQKAMDGED  286

Query  492  ----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                      L A+ ++ +S +IS++++ DECK F + G+  T S+L W V  L+ + + 
Sbjct  287  SFGSDFLGLLLKAHHDTNDSQRISVDDLVDECKTFYFAGQETTNSMLAWTVFLLALNTDW  346

Query  642  QERARKEVIQMFGSENPNPDGIARLK  719
            QE ARKEV+Q+FG +NPNPDG+++LK
Sbjct  347  QEEARKEVLQLFGRQNPNPDGLSKLK  372


 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   MI S E +++ W  ++GK++EVF+ F L+ SE+IS+++ GS+ LE K IF 
Sbjct  686  ESLKGMVPDMITSTETMLQRWKNHEGKEIEVFEEFRLLTSEVISRSAFGSSYLEGKRIFD  745

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++ ++KL                        
Sbjct  746  MLMELTSVIFQNALKPRFPGISMFYKTSAEIRADKLEKGIRDTIAEIVKKRENKAMNGEA  805

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++  + +IS +++ DECK F + G+  T +LL W V  L+   +
Sbjct  806  DEFGSDFLGVLLKAHHDTNENQRISFDDIVDECKTFYFAGQETTNALLAWTVFLLALHPD  865

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + P  DGI++LK
Sbjct  866  WQEEARKEVLQLFGQQTPTLDGISKLK  892



>ref|XP_004297211.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=520

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   MI S E ++E W K++ K++EV++HF    SE+IS+ + GS+ LE K+IF 
Sbjct  171  DSLKNMIPDMIASAETMLEGWKKHEEKEIEVYEHFRRFTSEVISRTAFGSSYLEGKDIFD  230

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + + +SEKL                        
Sbjct  231  MLMKLGSLIFRNAHKFRVPGISKFYKTSDEKESEKLEKGIRDTIVEIVKKREREAVTGEE  290

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+  + +  +IS+ E+ +ECK F + G+  T SLL W V  L+   +
Sbjct  291  GSFGTDFLGLLLKAHHGANDKQRISVNELVEECKTFYFAGQDTTNSLLVWTVFLLALHPD  350

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + P+PDG+A+LK
Sbjct  351  WQEEARKEVLQIFGKQPPSPDGLAKLK  377



>ref|XP_002316008.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
 gb|EEF02179.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
Length=513

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 107/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI S E++++ W ++DGK+++VFQ F L+ SE+IS+ + GS+ LE +++F 
Sbjct  164  ECLKSMIPAMIASVEVMLKRWRQHDGKEIDVFQEFKLLTSEIISRTAFGSSYLEGQHVFD  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG    VK   D++S+KL                        
Sbjct  224  MLTRMGDIIVRNHYKITIPGIRKFVKMRDDIESDKLEQEIRNCFINMIKNREKAAMEGKW  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L+A+ E+  + +IS+E++ DECK F + G   T + L W V  L+   +
Sbjct  284  GDFGSDFLGILLLAHHETDKAKRISVEDIIDECKTFYFAGHETTRTSLTWIVLLLAFHTD  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EV+++FG +NPNP+GI +LK V
Sbjct  344  WQDKARREVLELFGMQNPNPEGITKLKTV  372



>ref|XP_002512040.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50709.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 106/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL G+   MI S E+++E W  +DGK+VEVFQ F  + SE+IS+ + GS+  E K+IF 
Sbjct  165  ESLKGLIPVMIASVEIMLERWKYHDGKEVEVFQEFEHLTSEVISRTAFGSSYWEGKHIFD  224

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   +VK   D++S+K                         
Sbjct  225  MLTRLIIILSKNKYNIRIPGIRNLVKTGDDIESDKLEKNIHDSFINMIKRREEEATMGQA  284

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+ ++  + KIS++++ DECK F   GR  TTSL+ W +   +   +
Sbjct  285  DGFGSGFLGLLLKAHHDNNMAKKISVDDLIDECKTFYVAGRETTTSLITWILFLPAIHPD  344

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q +AR+EVI++FGS++P  DG+ RLKIV
Sbjct  345  WQHKAREEVIEIFGSQHPRLDGLTRLKIV  373



>emb|CDP00469.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 104/208 (50%), Gaps = 55/208 (26%)
 Frame = +3

Query  264  SLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI---  434
            SL  M   MI S E+++E W + +GK+VEVF+ F L+ SE+ISK + GS+ LE KNI   
Sbjct  97   SLKDMLPAMITSTEIMLERWKENEGKEVEVFEEFRLLTSEVISKTAFGSSYLEGKNIFEM  156

Query  435  ----------------FPGTGGIVKKNGDMDS----------------------------  482
                            FPG   + K + +++S                            
Sbjct  157  LMKLTLIVSRNARNIRFPGISHLFKSSDEIESEKLEQGMKNCIEHIIKKRELENCKENES  216

Query  483  ------EKLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                  EKLL AN+   +S  IS++++ DECK   + G+  TTSLL W++  L+  K  Q
Sbjct  217  SKGDFLEKLLEANE--GSSKWISVDDMVDECKTLYFAGQETTTSLLTWSILLLAVHKEWQ  274

Query  645  ERARKEVIQMFGSENPNPDGIARLKIVD  728
            E AR+EVI++FG   PN D I RLK ++
Sbjct  275  ETAREEVIEIFGQMKPNADAIPRLKTMN  302



>ref|XP_004297208.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 103/208 (50%), Gaps = 55/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++  W  ++GK++EV+Q F L+ SE+IS+ + GS+ LE K IF 
Sbjct  162  ESLKNMIPDIIASAENMLHRWKNHEGKEIEVYQEFRLLTSEVISRTAFGSSYLEGKTIFD  221

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   + K   +++++K                         
Sbjct  222  MLTKLSSLLFRNSYKIRLPGISKLFKSRDEIEADKVEKDIRSSILKIVKKREKEAAVSGK  281

Query  489  -----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                       LL A+ ++   SKIS++++ D+C+AF + G+  T  LL W V  L+   
Sbjct  282  GDWFGSDFLGLLLKAHHDADERSKISVDDIIDQCRAFYFAGQETTNGLLAWTVFLLALHP  341

Query  636  NLQERARKEVIQMFGSENPNPDGIARLK  719
            + QE+ARKEV Q+FG +NPNPDGIA+ K
Sbjct  342  DWQEKARKEVTQIFGKQNPNPDGIAKQK  369



>ref|XP_008243777.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1030

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 103/210 (49%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   M+ S E ++E W  Y+GK++EV++ F L  SE+IS+ + GS+  E ++IF 
Sbjct  167  DSLKSMIPEMVASAENMLERWKVYEGKEIEVYEEFRLFTSEVISRTAFGSSYTEGQDIFG  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K + +++SE+L                        
Sbjct  227  MLMKLGSLVFKNIFKVRVPGISELFKTSDEIESEQLEKGIHASITEMVKKRETKTMTGEN  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  + +IS++E+ DECK F + G+  T +LL W V  L+   +
Sbjct  287  DSFGSDFLGLLLKANHETNENQRISVQEIIDECKTFYFAGQETTNTLLAWTVFLLALHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE ARKEV+Q+FG E PN DGI +L I+ 
Sbjct  347  WQEEARKEVLQLFGKETPNLDGIGKLTIMS  376


 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++EVF+ F L  SE+IS+ + GS+ +E ++IF 
Sbjct  681  ESLKSMIPEMVASAETMLERWTVYEGKEIEVFEEFRLFTSEVISRTAFGSSYVEGQDIFE  740

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++S+KL                        
Sbjct  741  MLMKLGFLIFKNILKVRIPGISKFFKTSDEIESDKLEKGIHASIIELVRKREKKTMAVEK  800

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  + +IS++E+ DECK F + G+  T +LL W V  L+   +
Sbjct  801  NSFGSDFLGLLLKANHEANKNQRISVDELIDECKTFYFAGQETTNTLLSWTVFLLALHTD  860

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + PN DGI +LK
Sbjct  861  WQEEARKEVLQLFGKQTPNLDGIGKLK  887



>ref|XP_006348652.1| PREDICTED: cytochrome P450 734A1-like [Solanum tuberosum]
Length=505

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 105/205 (51%), Gaps = 49/205 (24%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E ++E W  Y+ K++EVF+ F L+ SE+IS+ + GS+  E KNIF 
Sbjct  161  ESLKSMIPMMIMSCETMLERWKIYEDKEIEVFEEFRLLTSEIISRTAFGSSYSEGKNIFQ  220

Query  438  ------------------PGTGGIVKKNGDMDSEKL----------LVANQeskns----  521
                              P    I K   +++SEKL          ++  +E +      
Sbjct  221  MLMKLASLVSGNANKVRFPRISQIWKSYDEIESEKLEQGIHDCITRIIKKREEEKIGEDH  280

Query  522  ----------------skisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
                            ++ISI+++ DECK F + G   TT LLGW +  L+ +K  QERA
Sbjct  281  NFGSDFLGKLLEAYQDNRISIDDIIDECKTFYFAGHKTTTILLGWTIFLLATNKKWQERA  340

Query  654  RKEVIQMFGSENPNPDGIARLKIVD  728
            RKEV++ FG + PN DG++RLKI++
Sbjct  341  RKEVVESFGHKVPNADGLSRLKIMN  365



>ref|XP_009356543.1| PREDICTED: uncharacterized protein LOC103947364 [Pyrus x bretschneideri]
Length=1045

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 104/209 (50%), Gaps = 56/209 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L GM   M+ S E ++E W  Y+GK++EVF+ F L+ SE+ISK + GS+ LE K IF 
Sbjct  690  ENLKGMLPAMVASAESMLERWKNYEGKEIEVFEEFKLMTSEVISKTAFGSSYLEGKLIFE  749

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG     K + + ++EK                         
Sbjct  750  LLMKLCFFAFKNFYTVRFPGMSKFYKTSDEREAEKIEKALHNSVMEIIKKREEKAILRNG  809

Query  489  ------------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRD  632
                        LL A+ ++ +  +IS+E++ +ECKAF + G+  TT LL W V  L+  
Sbjct  810  EEDRFGSDYLGLLLKAHHDADDKQRISVEDLINECKAFYFAGQETTTVLLAWTVLLLAIH  869

Query  633  KNLQERARKEVIQMFGSENPNPDGIARLK  719
             + QE+ARKEV+Q+FG   PN DGI++LK
Sbjct  870  ADWQEKARKEVLQIFGERTPNADGISKLK  898


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M + M+ S E ++E W  YDGK++EVF  F L +SE+IS+ + GS+ +E KNIF 
Sbjct  179  ESLKSMLSEMVASAETMLERWKDYDGKEIEVFGEFKLFSSEVISRTAFGSSYIEGKNIFE  238

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG    +K   ++++EK                         
Sbjct  239  MLNNIGFLIFKNALTIRIPGISKFLKTRDEIEAEKLEKAVHASIVEIVKKREEKAMTRGE  298

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A  +S +  +IS++++ DECK F + G+    + L W V  L+   +
Sbjct  299  DSFGSDFLGLLVKAYHDSNDDQRISVDDLVDECKTFYFAGQETVNTSLTWTVFLLALHTD  358

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVIQ+FG +NPN DGIA++K
Sbjct  359  WQEEARKEVIQLFGKQNPNHDGIAKMK  385



>ref|XP_010091621.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44887.1| Cytochrome P450 734A1 [Morus notabilis]
Length=516

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL GM   MI S E ++E W  Y+GK+VEVF+ F L+ SE+IS+ + GS+ LE K I  
Sbjct  167  ESLRGMNPAMISSVETMLERWKNYEGKEVEVFEEFRLLTSEVISRTAFGSSYLEGKKIFD  226

Query  435  -----------------FPGTGGIVKKNGDMDSEKL------------------------  491
                             F G     K   ++ SE L                        
Sbjct  227  MLQKLNLLAFRNLYKVSFSGFSKFFKTKDEVKSEMLEKEMCDCVIELIKKREEKVMNGEE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A+ ++    +IS++++ DECK F   G+  T  LLGW V  L+   +
Sbjct  287  DSFGSDFFGVLIRAHHDADEKQRISVDDMVDECKTFYVAGQETTNILLGWTVLLLAVHSD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE ARKEV+ +FG E PNPDGI++LKI+
Sbjct  347  WQEEARKEVLNLFGREKPNPDGISKLKIM  375



>ref|XP_008243779.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI S E ++E W  Y+GK++EV++ F L  SE+IS+ + GS+ +E +NIF 
Sbjct  167  EGLKSMIPEMIASAETMLERWTFYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++S+KL                        
Sbjct  227  MLMKLGFLIAKNFLKVRVPGISKFFKTSDEIESDKLEKGIHASIIEMAKKREKKTMAGEM  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  +  IS++E+ DECK F + G+  T +LL W V  L+   +
Sbjct  287  DSFGSDFLGLLLKANHETNENQGISVDELTDECKTFYFAGQETTNTLLSWTVFLLALHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + PN DGI +LK
Sbjct  347  WQEEARKEVLQLFGKQTPNLDGIGKLK  373



>ref|XP_007223137.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
 gb|EMJ24336.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
Length=516

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            D L  M   M+ S E ++E W  Y+GK++EV++ F L  SE+IS+ + GS+ +E +NIF 
Sbjct  167  DGLKSMIPEMVASAETMLERWTFYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++S+KL                        
Sbjct  227  MLMKLGFLIANNFLKVRVPGISKFFKTSDEIESDKLEKGIHASIIEMAKKREKKTMAGEM  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  +  IS++E+ DECK F + G+  T +LL W V  L+   +
Sbjct  287  DSFGSDFLGLLLKANNEANENQGISVDELIDECKTFYFAGQETTNTLLSWTVFLLALHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + PN DGI +LK
Sbjct  347  WQEEARKEVLQLFGKQTPNLDGIGKLK  373



>ref|XP_007226407.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
 gb|EMJ27606.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
Length=500

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 98/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI SGE ++E    + G+++EV+  F    SE+IS+ + GS+ LE +NIF 
Sbjct  151  ERLKSMIPAMIASGETMLERLKNHQGREIEVYDEFRFFTSEVISRTAFGSSYLEGENIFE  210

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++S +L                        
Sbjct  211  MLMKLAFLTFKNTHKIRFPGISKIFKTRDEIESAELEKGIRNSVMELIKKREKKAMAGEE  270

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  ++    +IS++ + DECK F   G+  TTSLL W V  L+  ++
Sbjct  271  DGFGSDFLGLLLEARHDTNEKQRISVDNLVDECKTFYLAGQETTTSLLAWTVFLLALHRD  330

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE ARKEV+Q+FG + PNPDGIA+LK +
Sbjct  331  WQEEARKEVLQLFGKQTPNPDGIAKLKTM  359



>ref|XP_008367031.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=515

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 103/209 (49%), Gaps = 56/209 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L GM   M+ S E ++E W  Y+GK++EVF+ F L+ SE+ISK + GS+ LE K IF 
Sbjct  160  ENLKGMLPAMVASAESMLERWKNYEGKEIEVFEEFKLMTSEVISKTAFGSSYLEGKLIFE  219

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG     K + ++++EK                         
Sbjct  220  LLMKLSFFAFKNFYTVRFPGISKFYKTSDEIEAEKIEKALHNSVMEIIKKRKEKAILRNG  279

Query  489  ------------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRD  632
                        LL  + ++ +  +IS+E++  ECKAF + G+  TT LL W V  L+  
Sbjct  280  EEDRFGSDYLGLLLKDHDDADDKQRISVEDLISECKAFYFAGQETTTVLLAWTVLLLAIH  339

Query  633  KNLQERARKEVIQMFGSENPNPDGIARLK  719
             + QE+ARKEV+Q+FG   PN DGI++LK
Sbjct  340  ADWQEKARKEVLQIFGERTPNADGISKLK  368



>ref|XP_008243893.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Prunus mume]
Length=388

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 103/208 (50%), Gaps = 55/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   M  S E ++  W K++GK++EVF+ F L+ SE++S+ + GS+ LE KN+F 
Sbjct  40   DSLKSMIPTMTASVETMLVRWKKHEGKEIEVFEEFRLLTSEVVSRTAFGSSYLEGKNVFE  99

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   ++K   +++S+KL                        
Sbjct  100  MLMRLYFLIFKNLFKFSFPGISKLIKTKDEVESKKLEKGIREGIIEIVKKREEKAIMIGE  159

Query  492  ------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                        L A+ +SK   +IS++++ D+CK F + G+  T +LL W V  L    
Sbjct  160  TDSFGSDFLGLLLKAHHDSKEKQRISVDDLVDKCKTFYFAGQETTNTLLAWTVFLLVLHT  219

Query  636  NLQERARKEVIQMFGSENPNPDGIARLK  719
            + QE ARKE++Q+FG + PN DG+A+LK
Sbjct  220  DWQEEARKEILQIFGKQAPNSDGLAKLK  247



>ref|XP_008219236.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=518

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 99/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI SGE ++E    + G+++EV+  F    SE+IS+ + GS+ LE +NIF 
Sbjct  169  ERLKSMIPAMIASGETMLERLKNHQGREIEVYDEFRFFTSEVISRTAFGSSYLEGENIFE  228

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++S +L                        
Sbjct  229  MLMKLAFLTFKNTHKIRFPGISKIFKTKDEIESAELEKGIRNSAMELIKKREKKAMAGEE  288

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++    +IS++++ DECK F   G+  TTSLL W V  L+  ++
Sbjct  289  EGFGSDFLGLLLEAHHDTNEKQRISVDDLVDECKTFYLAGQETTTSLLAWTVFILALHRD  348

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + PNPDGIA+LK
Sbjct  349  WQEEARKEVLQLFGKQTPNPDGIAKLK  375



>ref|XP_008361867.1| PREDICTED: uncharacterized protein LOC103425555 [Malus domestica]
Length=1316

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261   DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
             + L  M   MI+S E +V+ W  Y+GK++EV + F    SE+IS+ + GS+ LE KNIF 
Sbjct  967   EXLKNMIPEMIKSSETMVQRWKTYEGKEIEVNEEFRFFTSEVISRTAFGSSFLEGKNIFX  1026

Query  438   ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                               PG     K + ++ SEKL                        
Sbjct  1027  MLRELTSLIFRNTFKLRFPGISMFYKTSDEIKSEKLEKGIRDIITEIVRKREKTARTGEA  1086

Query  492   -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                        L A+ ++    +IS++++ DECK F + G+  T SLL W V  L+   +
Sbjct  1087  GGFGRDYLGILLKAHHDANEKQRISVDDLVDECKTFYFAGQETTNSLLAWTVFLLALHTD  1146

Query  639   LQERARKEVIQMFGSENPNPDGIARLKIV  725
              QE ARKEV+++FG ENPN DG+ +LK +
Sbjct  1147  WQEEARKEVLELFGKENPNTDGLNKLKTM  1175



>gb|KCW44245.1| hypothetical protein EUGRSUZ_L02323 [Eucalyptus grandis]
Length=350

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            DSL GM   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NI  
Sbjct  136  DSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRTAFGSSYVEGRNIFE  195

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + K N +++SEK                         
Sbjct  196  MLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  255

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G   + ++L W V  L+    
Sbjct  256  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGYDTSNTMLTWTVFLLAIHPE  315

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q+ ARKEV+ +FG+++P PDGIA+LK V
Sbjct  316  WQDEARKEVLNVFGNQDPYPDGIAKLKTV  344



>ref|XP_007034363.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY05289.1| Cytochrome P450 [Theobroma cacao]
Length=559

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 106/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +GK++EVFQ F L+ SE+IS+ + GS+ LE K IF 
Sbjct  206  ESLKNMTPAVIASVERMLEQWKGQEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGKKIFD  265

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + D++SEKL                        
Sbjct  266  MLMELSIIVSRSLFKARIPGISKFWKTDDDIESEKLAKGIHDSVMEIVKKREDKVVSGEA  325

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + +  +  + +++S+E++ DECK F + G+  T SLL W V  L+  ++
Sbjct  326  DSFGSDFLGLLIASYHDLDDKNRLSVEDLVDECKTFYFAGQETTNSLLAWTVFLLAVHRD  385

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++NP+ +G+A+LK +
Sbjct  386  WQEKARREVIEIFGNQNPHSEGLAKLKTI  414



>gb|KCW82723.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=393

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            DSL GM   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NI  
Sbjct  159  DSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRTAFGSSYVEGRNIFE  218

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + K N +++SEK                         
Sbjct  219  MLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  278

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G   + ++L W V  L+    
Sbjct  279  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGYDTSNTMLTWTVFLLAIHPE  338

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEV+ +FG+++P+PDGIA+LK
Sbjct  339  WQDEARKEVLNVFGNQDPDPDGIAKLK  365



>ref|XP_008229697.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Prunus mume]
Length=491

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 98/207 (47%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL      MI S E ++E W  ++GK++EVF  F L+ SE+IS+ + GS+ LE KNI  
Sbjct  168  ESLKSQIHAMIASVETMLERWENHEGKEIEVFGEFRLVTSEVISRTAFGSSYLEGKNIFE  227

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG    VK N +++ EK                         
Sbjct  228  MLLKISSLTFKTALKPKFPGLSRFVKTNDEIEMEKLEKRIRETIIEIVKKRERKVMPGEE  287

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A  ++ ++ +IS++++ DECK F   G   T + L W V  L+   +
Sbjct  288  ESLGSDFLGLLLKAYHDTNDNQRISLDDLVDECKTFYLAGHETTATFLAWTVFLLALHTD  347

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + PNP GI +LK
Sbjct  348  WQEEARKEVLQVFGKQTPNPKGIEKLK  374



>ref|XP_007224470.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
 gb|EMJ25669.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
Length=510

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   MI S E +++ W  ++GK++EVF+ F L+ SE+IS+++ GS+ LE K IF 
Sbjct  161  ESLKGMVPDMITSTETMLQRWKNHEGKEIEVFEEFRLLTSEVISRSAFGSSYLEGKRIFD  220

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++ ++KL                        
Sbjct  221  MLMELTSVIFQNALRPRFPGISMFYKTSAEIRADKLEKGIRDTIAEIVKKRENKAMKGEA  280

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++  + +IS +++ DECK F + G+  T +LL W V  L+   +
Sbjct  281  DEFGSDFLGVLLKAHHDTNENQRISFDDIVDECKTFYFAGQETTNALLAWTVFLLALHPD  340

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG + P  DGI++LK
Sbjct  341  WQEEARKEVLQLFGQQTPTLDGISKLK  367



>ref|XP_011462984.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 105/207 (51%), Gaps = 52/207 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYD-GKDVEVFQHFTLIASELISKASLGSNCLEAKNIF  437
            +SL  M   MI S E +++ W  ++ GK++EV++ F L+ SE+IS+ + GS+  E KNIF
Sbjct  79   ESLKNMIPDMIASAETMLDRWKGHEEGKEMEVYEEFRLLTSEVISRTAFGSSYAEGKNIF  138

Query  438  ----------------PGTGGIVKKNGDMDSEKL--------------------------  491
                                 + K N D++SEKL                          
Sbjct  139  VMLTKFSLLLKNDFKLKFISKLFKTNDDIESEKLEKGIRDSIMGIVKKREEKAMSEEQKS  198

Query  492  ---------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                     L A+ +S +   IS++++ DECK+F +VG+  + +LL W V  L+   + Q
Sbjct  199  FGSDFLGLLLKAHHDSNDIHWISVDDLVDECKSFYFVGQETSNTLLSWTVFLLALHTDWQ  258

Query  645  ERARKEVIQMFGSENPNPDGIARLKIV  725
            E ARKEV+Q+FG + PNPDG+A+LK +
Sbjct  259  EEARKEVLQLFGKQTPNPDGLAKLKTM  285



>ref|XP_007226762.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
 gb|EMJ27961.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
Length=516

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 100/206 (49%), Gaps = 54/206 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E +VE W  Y+GK++EVF+ F L  SE+IS+ + GS+  E ++IF 
Sbjct  167  ESLKSMIPEMVASAEKMVERWKVYEGKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K + +++SEKL                        
Sbjct  227  MLRKLSFLIFKNILKVRVPGISKLFKTSDEIESEKLEKGIHASIIEMVKKREKKTMTGEN  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  + +IS++E+ DECK F + G+    +LL W V  L+   +
Sbjct  287  GSFGSDFLGLLLKANHEANENQRISVQEIIDECKTFYFAGQETANTLLCWTVFLLALHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARL  716
             QE ARKEV+Q+FG + PN DGI +L
Sbjct  347  WQEEARKEVLQLFGKQTPNLDGIGKL  372



>ref|XP_007201527.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
 gb|EMJ02726.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
Length=516

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 104/209 (50%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++  W  Y+GK+++V Q F L+ SE+IS+ + GS+ +E K+IF 
Sbjct  167  ESLKSMIPAMVASTETMLGRWKNYEGKEIDVLQEFRLLTSEVISRTAFGSSYIEGKHIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P      K + +++SEKL                        
Sbjct  227  MLTKLGFIIYKNYLAIRVPVISKFFKTSDEIESEKLEKGIRDSIIEIIKKREEKAMTGVE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  ++ +S +IS++EV D+CK F   G+  TT+LL W V  L+   +
Sbjct  287  DRFGSDYLGLLVKAQHDANDSQRISVDEVVDDCKTFYMSGQETTTTLLSWTVLLLAIHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+ARKEVIQ+FG E P+PDGI++LK +
Sbjct  347  WQEKARKEVIQLFGKETPHPDGISKLKTI  375



>ref|XP_007045779.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY01611.1| Cytochrome P450, putative [Theobroma cacao]
Length=517

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E ++E W  ++GK +EVF  F L+ SE+IS+ + GS+ LE KNIF 
Sbjct  166  ESLKNMIPEMIVSVEKMLETWKHHEGKGIEVFDEFRLLTSEVISRTAFGSSYLEGKNIFD  225

Query  438  ------------------PGTGGIVK-----------------------------KNGDM  476
                              PG   I K                             KNGD+
Sbjct  226  MLINYSVISRRNAFKVRFPGISKIWKTADQIEADKLLRVMHNSVMEIIKRREEKIKNGDV  285

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        LL A  +   + ++ +E++ DECK F   G+  + SLL W V  L+   +
Sbjct  286  DSFGTDFLGLLLNAYHDVNENKRLHVEDLIDECKTFYIAGQETSNSLLSWTVLLLAIHTD  345

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR EVI++FG +NP+PDG+++LK +
Sbjct  346  WQQKARAEVIELFGDQNPHPDGLSKLKTI  374



>ref|XP_007034362.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY05288.1| Cytochrome P450 [Theobroma cacao]
Length=596

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 106/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +GK++EVFQ F L+ SE+IS+ + GS+ LE K IF 
Sbjct  243  ESLKNMTPAVIASVERMLEQWKGQEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGKKIFD  302

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + D++SEKL                        
Sbjct  303  MLMELSIIVSRSLFKARIPGISKFWKTDDDIESEKLAKGIHDSVMEIVKKREDKVVSGEA  362

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + +  +  + +++S+E++ DECK F + G+  T SLL W V  L+  ++
Sbjct  363  DSFGSDFLGLLIASYHDLDDKNRLSVEDLVDECKTFYFAGQETTNSLLAWTVLLLAVHRD  422

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++NP+ +G+A+LK +
Sbjct  423  WQEKARREVIEIFGNQNPHSEGLAKLKTI  451



>gb|KDP35170.1| hypothetical protein JCGZ_10704 [Jatropha curcas]
Length=522

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 106/212 (50%), Gaps = 57/212 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  MF  MI S EM++E W  ++GK+ EVFQ F L++SE+IS+ + GS+ LE + IF 
Sbjct  168  ECLKNMFPAMITSVEMMIERWKHHEGKEHEVFQEFILLSSEIISRTAFGSSYLEGQRIFD  227

Query  438  ------------------PGTGGIVKKNGDMDSEKLLVA---------------------  500
                              PG   +VK   D++S+K+ +                      
Sbjct  228  MLTQLIFIIDRNKYRIRIPGIRYLVKNRDDIESDKIDIGIHNAILNMIKKREEEAMMSQS  287

Query  501  -----------------NQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSR  629
                             N +S  +++IS+EE+ D+CK F   G+    + L W ++ LS 
Sbjct  288  NGFGSDFLGILLKAHHDNNDSDETNRISVEEIIDDCKIFYAAGQGTVATSLTWTLYLLSI  347

Query  630  DKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
              + QE+ARKEV ++FG +NP+PD +++LKIV
Sbjct  348  HTDWQEKARKEVFELFGQKNPSPDSLSKLKIV  379



>gb|KCW82722.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=491

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            DSL GM   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NI  
Sbjct  142  DSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRTAFGSSYVEGRNIFE  201

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + K N +++SEK                         
Sbjct  202  MLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  261

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G   + ++L W V  L+    
Sbjct  262  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGYDTSNTMLTWTVFLLAIHPE  321

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEV+ +FG+++P+PDGIA+LK
Sbjct  322  WQDEARKEVLNVFGNQDPDPDGIAKLK  348



>ref|XP_010320842.1| PREDICTED: cytochrome P450 CYP749A22 [Solanum lycopersicum]
Length=501

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 98/206 (48%), Gaps = 55/206 (27%)
 Frame = +3

Query  264  SLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF--  437
            SL  M   MI S E ++E W  Y+ K +EVF+ F L+ SE+IS+ + GS+  E KNIF  
Sbjct  160  SLRSMIPMMIMSCETMLERWKNYEDKKIEVFEEFRLLTSEIISRTAFGSSYSEGKNIFQM  219

Query  438  -----------------PGTGGIVKKNGDMDSEKL-------------------------  491
                             PG   I K   +++SEKL                         
Sbjct  220  LMKLASLVSGNANKVRFPGISQIWKSCDEIESEKLEKGIHDCITRIIKKREEEEEDHNFG  279

Query  492  -------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQER  650
                   L A Q+++ S +     + DECK F + G   TT LLGW +  L+ +K  QE+
Sbjct  280  SDFLGKLLEAYQDNRISIED----IVDECKTFYFAGHETTTILLGWTMFLLATNKKWQEK  335

Query  651  ARKEVIQMFGSENPNPDGIARLKIVD  728
            ARKEV++ FG   PN DG++RLK ++
Sbjct  336  ARKEVVESFGHNVPNADGLSRLKTMN  361



>ref|XP_012075435.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=528

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 106/212 (50%), Gaps = 57/212 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  MF  MI S EM++E W  ++GK+ EVFQ F L++SE+IS+ + GS+ LE + IF 
Sbjct  174  ECLKNMFPAMITSVEMMIERWKHHEGKEHEVFQEFILLSSEIISRTAFGSSYLEGQRIFD  233

Query  438  ------------------PGTGGIVKKNGDMDSEKLLVA---------------------  500
                              PG   +VK   D++S+K+ +                      
Sbjct  234  MLTQLIFIIDRNKYRIRIPGIRYLVKNRDDIESDKIDIGIHNAILNMIKKREEEAMMSQS  293

Query  501  -----------------NQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSR  629
                             N +S  +++IS+EE+ D+CK F   G+    + L W ++ LS 
Sbjct  294  NGFGSDFLGILLKAHHDNNDSDETNRISVEEIIDDCKIFYAAGQGTVATSLTWTLYLLSI  353

Query  630  DKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
              + QE+ARKEV ++FG +NP+PD +++LKIV
Sbjct  354  HTDWQEKARKEVFELFGQKNPSPDSLSKLKIV  385



>ref|XP_010049898.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82721.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=508

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            DSL GM   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NI  
Sbjct  159  DSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRTAFGSSYVEGRNIFE  218

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + K N +++SEK                         
Sbjct  219  MLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  278

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G   + ++L W V  L+    
Sbjct  279  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGYDTSNTMLTWTVFLLAIHPE  338

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEV+ +FG+++P+PDGIA+LK
Sbjct  339  WQDEARKEVLNVFGNQDPDPDGIAKLK  365



>gb|KCW82725.1| hypothetical protein EUGRSUZ_C04102 [Eucalyptus grandis]
Length=508

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 99/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL GM   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NIF 
Sbjct  159  DSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRTAFGSSYVEGRNIFE  218

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   + K N +++SEK                         
Sbjct  219  MLRKLTLIASRNAFKIRLPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  278

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G   + ++L W V  L+    
Sbjct  279  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGHETSNTMLTWTVFLLAIHPE  338

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEV+ +FG+++P PDGIA+LK
Sbjct  339  WQDEARKEVLNVFGNQDPYPDGIAKLK  365



>ref|XP_004297212.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=516

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 104/205 (51%), Gaps = 52/205 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYD-GKDVEVFQHFTLIASELISKASLGSNCLEAKNIF  437
            +SL  M   MI S E +++ W  ++ GK++EV++ F L+ SE+IS+ + GS+  E KNIF
Sbjct  165  ESLKNMIPDMIASAETMLDRWKGHEEGKEMEVYEEFRLLTSEVISRTAFGSSYAEGKNIF  224

Query  438  ----------------PGTGGIVKKNGDMDSEKL--------------------------  491
                                 + K N D++SEKL                          
Sbjct  225  VMLTKFSLLLKNDFKLKFISKLFKTNDDIESEKLEKGIRDSIMGIVKKREEKAMSEEQKS  284

Query  492  ---------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                     L A+ +S +   IS++++ DECK+F +VG+  + +LL W V  L+   + Q
Sbjct  285  FGSDFLGLLLKAHHDSNDIHWISVDDLVDECKSFYFVGQETSNTLLSWTVFLLALHTDWQ  344

Query  645  ERARKEVIQMFGSENPNPDGIARLK  719
            E ARKEV+Q+FG + PNPDG+A+LK
Sbjct  345  EEARKEVLQLFGKQTPNPDGLAKLK  369



>sp|H2DH17.1|C7A22_PANGI RecName: Full=Cytochrome P450 CYP749A22; AltName: Full=Cytochrome 
P450 CYP749A20 [Panax ginseng]
 gb|AEY75214.1| cytochrome P450 CYP749A20 [Panax ginseng]
Length=524

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 105/211 (50%), Gaps = 55/211 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S EM+++ W +++G++++VFQ F ++ SE+IS+ + GS+ L+ K+IF 
Sbjct  174  ESLKSMTPAMIASVEMMLKRWKQHEGREIDVFQEFKILTSEVISRTAFGSSYLDGKDIFD  233

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K N ++++EKL                        
Sbjct  234  RLTQLGIIITRNSYKVKLPGISLFYKSNDEIEAEKLDQGLYDSILRIMEKREKESTMSGE  293

Query  492  ------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                        + A  ++   ++I+ ++V DECK F   G+  TT+LL W +  L    
Sbjct  294  VGSFGTDFLGLLMKAMNDADEKNRITAQDVVDECKTFYVAGQETTTTLLAWVIFLLGIHT  353

Query  636  NLQERARKEVIQMFGSENPNPDGIARLKIVD  728
            + QE+AR+EV+ +FG E PN DG+A+LK V+
Sbjct  354  DWQEKARQEVLNLFGQEIPNSDGLAKLKTVN  384



>gb|KCW86460.1| hypothetical protein EUGRSUZ_B03128 [Eucalyptus grandis]
Length=485

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            DSL  M   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NI  
Sbjct  136  DSLKSMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTMLTSEIISRTAFGSSYVEGRNIFE  195

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + K N +++SEK                         
Sbjct  196  MLRKLASIASRNAFKIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  255

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G+  + ++L W V  L+   +
Sbjct  256  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGQDTSNTMLTWTVFLLAIHPD  315

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEV+ +FG+++P+PDGIA+LK
Sbjct  316  WQDEARKEVLNVFGNQDPDPDGIAKLK  342



>ref|XP_008243806.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M    I S E+++E W   DGK++E+F+ F L+ SE+IS+ + GS+ LE + IF 
Sbjct  167  ESLKSMTPATIASAEIMLERWKNQDGKEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K   +++SE L                        
Sbjct  227  MLMKLSFLSFKNFLKLRIPGISKFYKTCDEIESENLEKGVYNSIMEIVKKREKKAMAGEE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++ ++  IS++++ DECK F + G+  ++SLL W V  L+   +
Sbjct  287  DGFGSDFLGLLLKAHHDANDNQSISVDDLVDECKTFYFGGQETSSSLLAWTVFLLAIHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+++FG +NPN DGIARLK
Sbjct  347  WQEEARKEVLEIFGKQNPNTDGIARLK  373



>ref|XP_007222124.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
 gb|EMJ23323.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
Length=498

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 98/188 (52%), Gaps = 36/188 (19%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S + +VE W  Y+GK++EVF+ F L  SE+IS+ + GS+  E ++IF 
Sbjct  167  ESLKSMIPDMVASAQKMVERWKVYEGKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL----------LVANQesknss---  524
                              P    + K + +++SEKL          +V  +E K  +   
Sbjct  227  MLRKLGFLIFKNILKVRVPVISKLFKTSDEIESEKLEKGIHASIIEMVKKREKKKMTGEN  286

Query  525  ----kisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENP  692
                K  ++E+ DECK F + G+  T +LL W V  L+   + QE ARKEV+Q+FG + P
Sbjct  287  DSFGKDLVQEIIDECKTFYFAGQETTNTLLCWTVFLLALHTDWQEEARKEVLQLFGKQTP  346

Query  693  NPDGIARL  716
            N DGI +L
Sbjct  347  NLDGIGKL  354



>ref|XP_004298351.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=517

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 103/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I   E++++ W  ++GK+++V + F L  SE+IS+ + GS+ LE ++IF 
Sbjct  168  ESLKTMIPDIIACAEIMLKRWESHEGKEIDVVEEFRLFTSEVISRTAFGSSYLEGQHIFE  227

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K N +++SEKL                        
Sbjct  228  MLKKLALILFRNSLQIKVPGVSKLFKTNDEIESEKLEKGIQDSIIELVKKREHKVTSGEQ  287

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+     + +IS++++ D+CK F   G+  T++LL W V  L+ + +
Sbjct  288  DNFGSDFLGLLLKAHHNDNLNQRISVDDIVDDCKTFYLAGQDTTSTLLTWTVFLLALNTD  347

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+Q+FG +NPNPD I++LK
Sbjct  348  WQEEARKEVLQLFGKQNPNPDDISKLK  374



>ref|XP_007226531.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
 gb|EMJ27730.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
Length=516

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M    I S E+++E W   DGK++E+F+ F L+ SE+IS+ + GS+ LE + IF 
Sbjct  167  ESLKSMTPATIASAEIMLERWKNQDGKEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K   +++SE L                        
Sbjct  227  MLMKLSFLSFKNILKLRIPGISKFYKTCDEIESENLEKGIYNSIIEIVKKRGKKAMAGEE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++ ++ +IS++++ DECK F   G+  ++SLL W V  L+   +
Sbjct  287  DGFGSDFLGLLLKAHHDANDNQRISVDDLVDECKTFYLAGQETSSSLLAWTVFLLAIHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+++FG +NPN DGIARLK
Sbjct  347  WQEEARKEVLEIFGKQNPNTDGIARLK  373



>ref|XP_010046256.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=382

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 103/209 (49%), Gaps = 53/209 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   M+ S   +++ W K + K+VE+F+ F  I S++IS+ + GS+ +E + IF 
Sbjct  113  ESLKGMIPAMVDSVHALLDRWQKLEAKEVEIFEEFATITSDVISRTAFGSSYMEGREIFQ  172

Query  438  ------------------PGTG-----------------------GIVKKN-----GDMD  479
                              PG                         GI+KK      G+MD
Sbjct  173  MLSELTIVVSRNFFKLRLPGIRKIWKTSDEIKSERLEKAICDALLGIIKKREEKAKGEMD  232

Query  480  SE------KLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                     LL A  +   S +I+++++ DECK F + G+  TTS+L W +  L+  K+ 
Sbjct  233  DYGNDYLGSLLKAYHDPDKSKRITMDDLRDECKTFHFAGQETTTSILTWTLFLLAIHKDW  292

Query  642  QERARKEVIQMFGSENPNPDGIARLKIVD  728
            QE ARKEV  +FG+E+PN +GI +LK VD
Sbjct  293  QEEARKEVTDVFGNEDPNHEGIIKLKTVD  321



>ref|XP_006437869.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
 gb|ESR51109.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
Length=421

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 103/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S +M++E W  Y+GK+++ ++   ++ SE+IS+ + GS  LE +NIF 
Sbjct  72   ENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREIKVLTSEIISRTAFGSCYLEGENIFN  131

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG G ++K N D++S+KL                        
Sbjct  132  MLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDKLEQDIRDSIIKVVKKRESNVLTGEA  191

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A   +  + KIS++++ DECK F   G   T SLL W +  L+   +
Sbjct  192  ESYGNDLLGILMRAYHSADETQKISLDDLIDECKTFYVAGTDTTASLLSWTIFLLAIHSD  251

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++ARKEV+++ G +NP+ D I+RLKIV
Sbjct  252  WQDKARKEVLELLGQQNPSADNISRLKIV  280



>gb|KJB78243.1| hypothetical protein B456_012G185300 [Gossypium raimondii]
Length=513

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 102/210 (49%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +G+++EVF  F L+ SE+IS+ + GSN LE K IF 
Sbjct  164  ESLKNMNPAVIASVETMLEKWKGREGEEIEVFNEFRLLTSEVISRTAFGSNYLEGKKIFD  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++SEKL                        
Sbjct  224  MLTKLAILVSRNYFKTPIPGISKIWKTADEIESEKLANGIHDCVMEMVKRREKKVETGEA  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A ++    ++ SIE++ DECK F + G+  T SLLGW +  L+    
Sbjct  284  DGFGNDFLGLLINAYRDFDEKNRFSIEDLVDECKTFYFAGQETTNSLLGWTILVLAIHTK  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE+ R+EV ++FG +NPN +GIA+LKI++
Sbjct  344  WQEKTRQEVFEVFGDQNPNSEGIAKLKIMN  373



>ref|XP_008340298.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103403255 
[Malus domestica]
Length=1026

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 100/208 (48%), Gaps = 55/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   M+ S E ++  W  Y GK++EVF+ F L  SE+IS+ + GS+ +E KNIF 
Sbjct  176  ENLKSMIPEMVASAETMLXRWEDYVGKEIEVFEEFRLFTSEVISRTAFGSSYIEGKNIFE  235

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K N +++S+KL                        
Sbjct  236  MLIKLAFLVFKNSLTVRVPGISKLFKTNDEVESDKLEKEVHGSITEIVKKREKKAMMTGQ  295

Query  492  ------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                        L A+ ++  + ++S++E+ DECK F + G+  T +LL W V  L+   
Sbjct  296  KESFGSDFLGLLLKAHHDANENQRVSVDELVDECKTFXFAGQETTNTLLAWTVFLLALHT  355

Query  636  NLQERARKEVIQMFGSENPNPDGIARLK  719
            + QE ARKEV+ +FG + PNPD  ++LK
Sbjct  356  DWQEEARKEVMDVFGKQTPNPDDFSKLK  383


 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 47/202 (23%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   M  S E ++E W  ++G+++EV++ F L  SE+IS+ + GS+ +E KNIF 
Sbjct  676  ETLXSMIPKMXASAETMLEXWKDFEGQEIEVYEEFRLFTSEVISRTAFGSSYIEGKNIFX  735

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++S+KL                        
Sbjct  736  MLIKIGSLIXKNSLKVRVPGISKFFKTSDEIESDKLEIESVKKREKKARPEEKDSFGSDF  795

Query  492  ----LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARK  659
                L A   + ++ +IS++E+ DECK F + G+  T + L W V  L+   + QE ARK
Sbjct  796  LGLLLKARHNANDNHRISVDELIDECKTFYFAGQETTNTSLAWTVLLLALHTDWQEEARK  855

Query  660  EVIQMFGSENPNPDGIARLKIV  725
            EVI +FG + PN DGI++++ V
Sbjct  856  EVIXLFGKQTPNHDGISKMRTV  877



>ref|XP_007221838.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
 gb|EMJ23037.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
Length=516

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M    I S E+++E W   DGK++E+F+ F L+ SE+IS+ + GS+ LE + IF 
Sbjct  167  ESLKSMTPATIASAEIMLERWKNQDGKEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K   +++SE L                        
Sbjct  227  MLMKLSFLSFKNILKLRIPGISKFYKTCDEIESENLEKGVYNSIIEIVKKREKKAMAGEE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  ++ ++ +IS++++ DECK F + G+  + SLL W V  L+   +
Sbjct  287  DGFGSDFLGLLLKAYHDANDNQRISVDDLVDECKTFYFGGQETSNSLLAWTVFLLAIHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+++FG +NPN DGIARLK
Sbjct  347  WQEEARKEVLEIFGKQNPNTDGIARLK  373



>ref|XP_002512037.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50706.1| cytochrome P450, putative [Ricinus communis]
Length=513

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 103/210 (49%), Gaps = 55/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMK-YDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF  437
            +SL GM   M+ S E +++ W +  +GK++EV+Q F ++ +E+ISK + GSN LE KN F
Sbjct  163  ESLKGMVPAMVASVETMLQRWRQNQEGKEIEVYQEFKVLTAEIISKTAFGSNYLEGKNTF  222

Query  438  -------------------PGTGGIVKKNGDMDSEKL-----------------------  491
                               PG    +K   D  SEKL                       
Sbjct  223  DMLARMANIVARNNYRVGIPGIKKFLKTRDDTASEKLEQGMRDSIMKIIKKREEEMLMGK  282

Query  492  ------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                        L A+ ++  + KIS+ ++ DECK+F   G   T+S L W V  L+   
Sbjct  283  NDAYGNDFLGLLLKAHHDNDKAKKISVNDLIDECKSFYVAGHETTSSSLTWTVLLLAIHP  342

Query  636  NLQERARKEVIQMFGSENPNPDGIARLKIV  725
              QE+AR+EV+++FG +NP+PDGI RLKI+
Sbjct  343  IWQEKAREEVLELFGKQNPSPDGIRRLKIM  372



>gb|KCW85138.1| hypothetical protein EUGRSUZ_B01978 [Eucalyptus grandis]
Length=424

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 101/180 (56%), Gaps = 25/180 (14%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   M+ S  M+++ W   + ++VE+F+ FT I S++IS+ + GS+ +E +NIF 
Sbjct  88   ESLKCMIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGRNIFR  147

Query  441  GTG---GIVKKN----------------GDMDSE------KLLVANQesknsskisieeV  545
              G    IV +N                G+M++        LL A  +   S +I+I++V
Sbjct  148  MLGELTTIVSRNLFKLRLPGVREEKVNTGEMNNYGNDFLGSLLKAYHDPDESKRITIDDV  207

Query  546  ADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
             DECK F + G+  T S+L W +  L+  K+ Q+ ARKEV  +FG+E+PN DG+ +LK V
Sbjct  208  IDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEARKEVTNVFGNEDPNHDGMMKLKTV  267



>ref|XP_007226180.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
 gb|EMJ27379.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
Length=516

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 99/206 (48%), Gaps = 54/206 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++EV++ F L  SE+IS+ + GS+  E ++IF 
Sbjct  167  ESLKSMIPEMVASAENMLERWKVYEGKEIEVYEEFRLFTSEVISRTAFGSSYTEGQDIFG  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K + ++ SE+L                        
Sbjct  227  MLMKLGSLVFKNIFKVRVPGISKLFKTSDEIKSEQLEKGIHASITEMVKKRETKTMTGEN  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  + +IS++E+ DECK F + G+  T +LL W V  L+   +
Sbjct  287  DSFGSDFLGLLLKANHETNENQRISVQEIIDECKTFYFAGQETTNTLLAWTVFLLALHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARL  716
             QE ARKEV+Q+FG   PN DGI +L
Sbjct  347  WQEEARKEVLQLFGKGTPNLDGIGKL  372



>ref|XP_007045775.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01607.1| Cytochrome P450 [Theobroma cacao]
Length=519

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 104/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E +++ W   +GK++EVFQ F L+ SE+IS+ + GS+ LE + IF 
Sbjct  166  ESLKNMTPAVIASVETMLQKWKGQEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFE  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K   +++SEKL                        
Sbjct  226  TLMKLSVIASRNLYKARIPGISYVWKHADEIESEKLAKEIHDSVMKIVKQREEKVVAGEA  285

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +    +++S+E++ DECK F + G+  T SLL W V  L+   +
Sbjct  286  ESFGSDFLGLLLNAYHDLDEKNRLSVEDLVDECKTFYFAGQETTNSLLAWTVLLLAIHTD  345

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR+EVI++FG+++P+P+GIA+LK
Sbjct  346  WQEKARREVIEVFGNQDPHPEGIAKLK  372



>ref|XP_008243778.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 99/206 (48%), Gaps = 54/206 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E +VE W  Y+GK++EVF+ F L  SE+IS+ + GS+  E ++IF 
Sbjct  167  ESLKSMIPDMVASAEKMVERWKVYEGKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    + K + +++SEKL                        
Sbjct  227  MLRKLGFLIFKNILKVRVPVISKLFKTSDEIESEKLEKGIHASIIEMVKKREKKTMTGEN  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L AN E+  + +IS++E+ DECK F + G+    +LL W V  L+   +
Sbjct  287  DSFGSDFLGLLLKANHEANENQRISVQEIIDECKTFYFAGQETANTLLCWTVFLLALHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARL  716
             QE ARKEV+Q+FG + PN DGI +L
Sbjct  347  WQEEARKEVLQLFGKQTPNLDGIGKL  372



>ref|XP_002316006.2| hypothetical protein POPTR_0010s14900g [Populus trichocarpa]
 gb|EEF02177.2| hypothetical protein POPTR_0010s14900g [Populus trichocarpa]
Length=517

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 104/208 (50%), Gaps = 54/208 (26%)
 Frame = +3

Query  264  SLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF--  437
            SL  M   MI S E+I++ W  Y+ K+++VF+ F ++ SE+IS+ + GS+ LE ++IF  
Sbjct  164  SLKNMIPAMIASSEIILQRWRHYESKEIDVFREFKVLTSEIISRTAFGSSYLEGQHIFDM  223

Query  438  -----------------PGTGGIVKKNGDMDSEK--------------------------  488
                             PG G   K + D++SE                           
Sbjct  224  LTRMAHIISGNNYRIRIPGIGKFFKTSDDIESENLEATIRSSFMNMMKKREQEAMLGNID  283

Query  489  ---------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                     LL A  +S  + KIS++++ DECK F   G+  T+SLL W+V  L+   + 
Sbjct  284  GYGHDFFGLLLEAYHDSDKTKKISVDDLIDECKTFYVGGQETTSSLLTWSVLLLAIHTDW  343

Query  642  QERARKEVIQMFGSENPNPDGIARLKIV  725
            Q++AR EV+++FG +NP  D IA+LKI+
Sbjct  344  QDKARNEVLELFGQQNPGQDSIAKLKIM  371



>ref|XP_010041584.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Eucalyptus 
grandis]
Length=919

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 99/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            DSL GM   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NI  
Sbjct  675  DSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRTAFGSSYVEGRNIFE  734

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + K N +++SEK                         
Sbjct  735  MLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  794

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G   + ++L W V  L+    
Sbjct  795  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGYDTSNTMLTWTVFLLAIHPE  854

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEV+ +FG+++P PDGIA+LK
Sbjct  855  WQDEARKEVLNVFGNQDPYPDGIAKLK  881


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/283 (25%), Positives = 118/283 (42%), Gaps = 85/283 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N   T P +G    + FAK     G VS V    WA  ++L+N                
Sbjct  117  LNREKTYPKTGT---KDFAKKLLGDGLVSTVDGKKWANQRKLANHA--------------  159

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++  W   +GK++EVF  F L+ SE+IS+ 
Sbjct  160  ----FHG-------ESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFKLLTSEVISRT  208

Query  399  SLGSNCLEAKNI-------------------FPGTGGIVKKNGDMDSEK-----------  488
            + GS+ +E +NI                   FPG   + K   ++++EK           
Sbjct  209  AFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRFPGIRKLWKTADEVEAEKLEKGIRNSILQ  268

Query  489  ------------------------LLVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                    L+ A  ++  S K +++ + DECK F   G+    S
Sbjct  269  MIKRREKKVMAGEEDGFGDDFLGQLVKALHDTDKSKKFTVDNLVDECKTFYIAGQETVNS  328

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            ++ W +  L+ +   QE AR+EV+ +FG+++P+ DG+ +LK +
Sbjct  329  MMTWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKI  371



>ref|XP_006484251.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=512

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 103/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S +M++E W  Y+GK+++ ++   ++ SE+IS+ + GS  LE +NIF 
Sbjct  163  ENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREIKVLTSEIISRTAFGSCYLEGENIFN  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG G ++K N D++S+KL                        
Sbjct  223  MLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDKLEQDIRDSIIKVVKKRESNVLTGEA  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A   +  + KIS++++ DECK F   G   T SLL W +  L+   +
Sbjct  283  ESYGNDLLGILMRAYHSADETQKISLDDLIDECKTFYVAGTDTTASLLSWTIFLLAIHSD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++ARKEV+++ G +NP+ D I+RLKIV
Sbjct  343  WQDKARKEVLELLGQQNPSADNISRLKIV  371



>gb|KDO70287.1| hypothetical protein CISIN_1g039293mg [Citrus sinensis]
Length=512

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 103/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S +M++E W  Y+GK+++ ++   ++ SE+IS+ + GS  LE +NIF 
Sbjct  163  ENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREIKVLTSEIISRTAFGSCYLEGENIFN  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG G ++K N D++S+KL                        
Sbjct  223  MLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDKLEQDIRDSIIKVVKKRESNVLTGEA  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A   +  + KIS++++ DECK F   G   T SLL W +  L+   +
Sbjct  283  ESYGNDLLGILMRAYHSADETQKISLDDLIDECKTFYVAGTDTTASLLSWTIFLLAIHSD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++ARKEV+++ G +NP+ D I+RLKIV
Sbjct  343  WQDKARKEVLELLGQQNPSADNISRLKIV  371



>ref|XP_007045776.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01608.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 104/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E +++ W   +GK++EVFQ F L+ SE+IS+ + GS+ LE + IF 
Sbjct  166  ESLKNMTPAVIASVETMLQKWKGREGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFE  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K   +++SEKL                        
Sbjct  226  TLMKLSVIAIRNLYKARIPGISYVWKHADEIESEKLAKEIHDSVLKIVKKREEKVVAGEA  285

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ +    +++S+E++ DECK F + G+  T SLL W V  L+   +
Sbjct  286  ESFGSDFLGLLLNAHHDLDEKNRLSVEDLVDECKTFYFTGQETTNSLLAWTVLLLAIHTD  345

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR+E+I+ FG+++P+P+GIA+LK
Sbjct  346  WQEKARREMIEEFGNQDPHPEGIAKLK  372



>ref|XP_008243803.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=508

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 95/199 (48%), Gaps = 46/199 (23%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E +++ W  ++GK++EV++ F L  SE+IS+ +  S+ LE K+ F 
Sbjct  167  ESLKSMIPAMIASAETMLDGWKNHEGKEIEVYEQFRLFTSEVISRTAFSSSYLEGKSFFD  226

Query  438  ------------------PGTGGIVKKNGDMDSEKLLVANQesknsskisieeVA-----  548
                              PG   I K + D++SEKL  A ++S  +     E+ A     
Sbjct  227  NLMKLSFLLVKNSFNVRFPGISKIFKSSDDIESEKLDKAMRDSIIAIVKKREKAATTGEE  286

Query  549  ----------------------DECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKE  662
                                  DECK F + G+  +  LL W +  L+   + QE ARKE
Sbjct  287  NKFGNDYLGLLLKAHLDTNDLVDECKTFYFAGQETSNGLLAWIIFLLALHTDWQEEARKE  346

Query  663  VIQMFGSENPNPDGIARLK  719
            V+Q+FG +NP  D I++LK
Sbjct  347  VLQLFGKQNPTHDDISKLK  365



>ref|XP_010046611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104435586 
[Eucalyptus grandis]
Length=1036

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            DSL  M   M+ S  M+++ W    G ++EV+Q FT++ SE+IS+ + GS+ +E +NI  
Sbjct  153  DSLKSMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTMLTSEIISRTAFGSSYVEGRNIFE  212

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + K N +++SEK                         
Sbjct  213  MLRKLASIASRNAFKIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGEL  272

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A+     S +I+I ++ DECK F   G+  + ++L W V  L+   +
Sbjct  273  DDLGNDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGQDTSNTMLTWTVFLLAIHPD  332

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEV+ +FG+++P+PDGIA+LK
Sbjct  333  WQDEARKEVLNVFGNQDPDPDGIAKLK  359


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/281 (23%), Positives = 114/281 (41%), Gaps = 67/281 (24%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAFGAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTSQTT  227
            +N + T P +G           G  S      WA  ++L+N       L ++G+   +  
Sbjct  628  LNRDKTYPKTGNKDFSKKLLGDGLASTPGGEKWAKKRKLANRAFHGKSLKVVGLDGKR--  685

Query  228  DLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLG  407
                       +    M   M+ S   ++  W   +GK++EVF  F ++ SE+IS+ + G
Sbjct  686  -----------ELCENMAPAMVASVHTMLGKWKNREGKEIEVFGEFKVLTSEVISRTAFG  734

Query  408  SNCLE---------------AKNIF----PGTGGIVKKNGDMDSEKL-------------  491
            S+ +E               ++N F    PG   + K   ++++EKL             
Sbjct  735  SSFVEGRNIFQMLTGLSLLTSRNAFTIRLPGLSKLWKTVDEVEAEKLEKGIRNSIEQMIK  794

Query  492  ----------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLG  605
                                  + A  +   S KI++  + DECK F   G+    SL+ 
Sbjct  795  RREKKVMAGEVNGFGDDFLGQLVKALHDVDKSKKITVNNLVDECKTFYVAGQETANSLMA  854

Query  606  WAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIVD  728
            W +  L+     QE AR EV+ +FG+++P+ DG+ +LK ++
Sbjct  855  WMLFLLAIYPEWQEEARMEVLNVFGNKDPDFDGLGKLKKIN  895



>ref|XP_007223262.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
 gb|EMJ24461.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
Length=508

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 94/199 (47%), Gaps = 46/199 (23%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E +++ W  ++GK++EV++ F L  SE+IS+ +  S+ LE K+ F 
Sbjct  167  ESLKSMIPAMIASAETMLDGWKNHEGKEIEVYEQFRLFTSEVISRTAFSSSYLEGKSFFD  226

Query  438  ------------------PGTGGIVKKNGDMDSEKLLVANQesknsskisieeVA-----  548
                              PG   I K + D++SEKL  A ++   +     E+ A     
Sbjct  227  NLMKLSFLLVKNSFKVRFPGISKIFKSSDDIESEKLDKAMRDFIIAIVKKREKAATTGEE  286

Query  549  ----------------------DECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKE  662
                                  DECK F + G+  +  LL W +  L+   + QE ARKE
Sbjct  287  NKFGNDYLGLLLKAHLDTNDLVDECKTFYFAGQETSNGLLAWIIFLLALHTDWQEEARKE  346

Query  663  VIQMFGSENPNPDGIARLK  719
            V+Q+FG +NP  D I++LK
Sbjct  347  VLQLFGKQNPTHDDISKLK  365



>ref|XP_006484252.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=520

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 103/214 (48%), Gaps = 54/214 (25%)
 Frame = +3

Query  240  SSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCL  419
            ++L    +SL  M   M+ S E++++ W   +GK++EV Q FTL+ SE+IS+ + GS+ L
Sbjct  158  ATLAFYAESLRDMIPAMVASVEIMLKRWRHNEGKEIEVSQDFTLLTSEIISRTAFGSSYL  217

Query  420  EAKNIF-------------------PGTGGIVKKNGDMDSEKL-----------------  491
            E ++IF                   P  G  VK + D++++KL                 
Sbjct  218  EGESIFNKLTNMSFIASRNAYKIKIPLIGDFVKTSDDVEADKLEQGIRDSIIKMMKTREE  277

Query  492  ------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVH  617
                              L A  +   + +IS++ + DECK F   G   TT LL W + 
Sbjct  278  KAMKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTIL  337

Query  618  KLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
             L+   + QE+ R+EV+++FG +NP PDGI +LK
Sbjct  338  LLATHTDWQEKLREEVLELFGQQNPTPDGIGKLK  371



>ref|XP_006437870.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51110.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=520

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 103/214 (48%), Gaps = 54/214 (25%)
 Frame = +3

Query  240  SSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCL  419
            ++L    +SL  M   M+ S E++++ W   +GK++EV Q FTL+ SE+IS+ + GS+ L
Sbjct  158  ATLAFYAESLRDMIPAMVASVEIMLKRWRHNEGKEIEVSQDFTLLTSEIISRTAFGSSYL  217

Query  420  EAKNIF-------------------PGTGGIVKKNGDMDSEKL-----------------  491
            E ++IF                   P  G  VK + D++++KL                 
Sbjct  218  EGESIFNKLTNMSFIASRNAYKIKIPLIGDFVKTSDDVEADKLEQGIRDSIIKMMKTREE  277

Query  492  ------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVH  617
                              L A  +   + +IS++ + DECK F   G   TT LL W + 
Sbjct  278  KAMKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTIL  337

Query  618  KLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
             L+   + QE+ R+EV+++FG +NP PDGI +LK
Sbjct  338  LLATHTDWQEKLREEVLELFGQQNPTPDGIGKLK  371



>gb|KCW85137.1| hypothetical protein EUGRSUZ_B01976 [Eucalyptus grandis]
Length=484

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 97/198 (49%), Gaps = 42/198 (21%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   M+ S  M+++ W   + K+VE+F+ FT I SE+IS+ + GS+ +E ++IF 
Sbjct  166  ESLKGMIPAMVDSVHMLLKRWQNLEAKEVELFEEFTAILSEVISRTAFGSSYIEGRDIFQ  225

Query  438  ------------------PGTGGIVKKNGDMDSEKLLVANQesknsskisiee-------  542
                              PG   I K + ++ S++L  A +++        E+       
Sbjct  226  MLGELTIIASRNLFKLRLPGISKIWKTSDEIKSDRLEKAIRDAVLGIIDKREKKLNAGEI  285

Query  543  ----------------VADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQM  674
                            + DECK F   G+  T S+L W +  L+  KN QE ARKEV  +
Sbjct  286  DDYGNDFLGKRITINDLVDECKTFYLAGQETTNSILTWTLFLLAIHKNWQEEARKEVADV  345

Query  675  FGSENPNPDGIARLKIVD  728
            FG E+PN +GI +LK V+
Sbjct  346  FGDEDPNHEGIMKLKTVE  363



>gb|KDO36840.1| hypothetical protein CISIN_1g012962mg [Citrus sinensis]
Length=452

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S EM+++ W   +G++++V+Q F ++  E IS+ + GS+ LE +NIF 
Sbjct  103  ETLKSMIPDMIASAEMMLDRWRDNEGQEIDVYQEFKILTLEAISRTAFGSSYLEGENIFN  162

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              P  G +VK + D++S+K                         
Sbjct  163  MLTKLTFFISKNEYRVRIPVIGKLVKTHDDIESDKTEEDIRDSIIKIIKKRESNVMTGEV  222

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A      + KIS++++ DECK F   G   T SLL W V  L+   +
Sbjct  223  ESDGNDLLGVLMQAYHNVDETLKISLDDLIDECKTFYIAGHETTASLLTWTVLLLAIHND  282

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR EV+Q+FG ++PN D I+RLKI+
Sbjct  283  WQDKARNEVLQLFGQQSPNADNISRLKIM  311



>gb|KDP35171.1| hypothetical protein JCGZ_10705 [Jatropha curcas]
Length=478

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 106/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M + M+ S EM++E W  ++G +++VF+ F ++ SE+I +++ GS+  E +  F 
Sbjct  129  ESLKSMISAMVTSVEMMLERWGHHEGNEIDVFKEFLVLGSEIICRSAFGSSYSEGQRTFD  188

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   ++K   D++S+                          
Sbjct  189  KIIQLILIIDRNKYRIKIPGIRYLMKTRDDVESDNIQNGIRNSIMNMIKKREEAAMFSQS  248

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+ +S  + ++++EE+ DECK+F + G+  T +LL W V  L+   +
Sbjct  249  NDYGSDFLGLLLKAHHDSDMTKRLAVEEIIDECKSFYHAGQGTTATLLSWIVFLLAVHTD  308

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q +ARKEVI++FG +NP+PD ++R+KIV
Sbjct  309  WQAKARKEVIELFGQKNPSPDSLSRMKIV  337



>gb|KHG26927.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 103/210 (49%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +G+++EVF  F L+ SE+IS+ + GSN LE K+IF 
Sbjct  141  ESLKNMNPAVIASVETMLEKWKGREGEEIEVFNEFRLLTSEVISRTAFGSNYLEGKHIFD  200

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++SEKL                        
Sbjct  201  MLTKLAILFSRNYFKTPIPGISKIWKTAVEIESEKLANGIHDCVMEMVKRREKKVETGEA  260

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A ++S   ++ SIE++ DECK F + G+  T SLL W +  L+    
Sbjct  261  DGFGNDFLGLLINAYRDSDEKNRFSIEDLVDECKTFYFAGQETTNSLLAWTILVLAIHTK  320

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE+ R+EV ++FG +NPN +GIA+LKI++
Sbjct  321  WQEKTRQEVSEVFGDQNPNSEGIAKLKIMN  350



>gb|KDP35176.1| hypothetical protein JCGZ_10710 [Jatropha curcas]
Length=448

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 104/212 (49%), Gaps = 57/212 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI S EM++E W   +GK++EVFQ F ++ASE+IS+ + GS+ LE + IF 
Sbjct  96   ECLKSMIPAMITSVEMMLEKWRHNEGKEIEVFQEFKVLASEIISRTAFGSSYLEGQRIFD  155

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   +VK   D++SEK                         
Sbjct  156  MINQLTLIIGRNRYRIRIPGIRNLVKTWDDIESEKIDQEIRDSIMNMIKKREEAAMMSQS  215

Query  489  ----------LLVA---NQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSR  629
                      LL A   N +   + ++S+EE+ DECK F  VG   T +   W V  L+ 
Sbjct  216  NGFGTDFLGLLLKAHHDNNDPDQTKRLSVEEMIDECKTFYVVGHETTATSFTWTVFLLAI  275

Query  630  DKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
              + Q++ARKEV+++FG ++P+ DG++++K+V
Sbjct  276  HTDWQDKARKEVLELFGQQSPSSDGLSKMKLV  307



>ref|XP_002316010.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
 gb|EEF02181.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
Length=515

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L GM   MI S EM++E W + +G+++EV+Q   L+ SE+IS+ + GS+ +E K+IF 
Sbjct  166  ENLKGMIPEMIASVEMLLERWKQNEGREIEVYQELRLLTSEIISRTAFGSSYVEGKSIFD  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     +   +++SEKL                        
Sbjct  226  MLTKLSLIIHRNIYKLRLPGISKFWRTQDEIESEKLVKGIHNSVMEIIKKREEKVKTGEA  285

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L +  ++    +ISIE++ DECK F   G+ +T SLL W +  L    +
Sbjct  286  DGFGNDFLGVLLNSYHDADEKKRISIEDLVDECKTFYIAGQESTNSLLSWTILLLGIHTD  345

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE ARKEV  +FG + PN DGIA+LKI+
Sbjct  346  WQEEARKEVFNIFGQQKPNLDGIAKLKIL  374



>gb|KCW85143.1| hypothetical protein EUGRSUZ_B01987 [Eucalyptus grandis]
Length=495

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 100/188 (53%), Gaps = 33/188 (18%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            + L GM   M+ S   +++ W K + K+VE+F+ F +I S++IS+ + GS+ +E + IF 
Sbjct  166  ECLKGMIPAMVDSVHALLDRWQKLEAKEVELFEEFAMITSDVISRTAFGSSYIEGREIFQ  225

Query  441  ---------------------GTGGIVKKN------GDMDSE------KLLVANQeskns  521
                                    GI++K       G+MD         LL A  +   S
Sbjct  226  INIWKTSDDIKSERLEKAICDALLGIIEKREKKVNVGEMDDYGNDYLGSLLKAYHDPDKS  285

Query  522  skisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPD  701
             +I+I+++ DEC+ F + G+  TTS+L W +  L+  K+ QE ARKEV  +FG+E+PN +
Sbjct  286  KRITIDDLMDECRTFHFSGQETTTSILTWTLFLLAIHKDWQEEARKEVTDVFGNEDPNHE  345

Query  702  GIARLKIV  725
            GI +LK V
Sbjct  346  GIMKLKTV  353



>gb|KDP41353.1| hypothetical protein JCGZ_15760 [Jatropha curcas]
Length=475

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   M+ S E +++ W + + K++E+FQ F ++ SE+ISK + GS+ LE KN+F 
Sbjct  126  ESLKGMVPAMVASVETMLDRWRQNEVKEIEMFQEFKILTSEIISKTAFGSSYLEGKNLFD  185

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   I+K   D++SE+                         
Sbjct  186  MLTKMATIIARNNFQVRIPGIKKILKTPDDIESEELERGMRESILMMMKTREEGVVKGKL  245

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL     +  S+KIS++++ DECK F   G   T S L W +  L+    
Sbjct  246  ENYGSDFLGLLLKVYHANDLSNKISVQDLIDECKTFYLAGHETTVSSLTWTILLLAIHPI  305

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EVI++FG +NP  DGIARLKI+
Sbjct  306  WQDKAREEVIKLFGKQNPGSDGIARLKIM  334



>gb|KDP41351.1| hypothetical protein JCGZ_15758 [Jatropha curcas]
Length=477

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 102/212 (48%), Gaps = 56/212 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L GM   M+ S EM+VE W  +DGK++EVFQ F ++ SE+IS+ + GS+ LE + +F 
Sbjct  126  ENLKGMVPAMLASVEMMVERWRHHDGKEIEVFQEFKVLTSEIISRTAFGSSYLEGEEVFD  185

Query  438  --------------------PGTGGIVKKNGDMDSEK-----------------------  488
                                PG    +K   +++ +K                       
Sbjct  186  MLKKMIFIVARNHYKVRIPCPGIKRFLKTGDELELDKIQKEIRDTIINMIKKREKATMMG  245

Query  489  ------------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRD  632
                        L+ A  +   + +ISI+++ DECK F   G+  T S L W V  L+  
Sbjct  246  ELDGYGSDFLGLLIKAYNDPDKNKRISIDDMIDECKTFYVAGQETTASSLTWTVLLLAIH  305

Query  633  KNLQERARKEVIQMFGSENPNPDGIARLKIVD  728
             + Q+ ARKEV+++FG +NP  DG+ARLK ++
Sbjct  306  TDWQDEARKEVLELFGQQNPTADGVARLKTMN  337



>ref|XP_011009712.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=529

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 94/207 (45%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S EM++  W  + GK++EVFQ F ++ SE+IS+ + GS+ LE + IF 
Sbjct  169  ESLKDMIPEMVSSVEMMLGRWKDHRGKEIEVFQDFKVLTSEIISRTAFGSSYLEGQQIFE  228

Query  438  ------------------PGTGGIVKKNGDMDSEKL--LVANQesknsskisieeVA---  548
                              PG G +VK   D+ SEKL  ++ N   K   K     +A   
Sbjct  229  ILTRMVLIFSKNLFRMRIPGIGKLVKTQDDIQSEKLGQIIRNSVIKMIKKREEAAMAGEI  288

Query  549  ------------------------------DECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                                          DECK F   G   TTS L W V  L+   +
Sbjct  289  DGYGSDFLGQLVKVYRSADMTSRITIDDLIDECKNFYIAGHETTTSALTWIVLMLATHAD  348

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+ R E++++FG +NP  +GI+RLK
Sbjct  349  WQEKVRNEILELFGQQNPGLEGISRLK  375



>ref|XP_011102246.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=506

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL GM   MI S E ++E W  Y+GK++EV + F + +SE+IS+ + GS+ LE KNIF 
Sbjct  157  ESLKGMIPAMIASVENMLENWRMYEGKEIEVSKEFMVFSSEVISRTAFGSSYLEGKNIFD  216

Query  441  -------------------GTGGIVKKNGDMDSEK-------------------------  488
                               G   I K   D++S+K                         
Sbjct  217  MLMKLGFLIFKNADKVRPFGIEKIWKTQDDIESDKIEQSLRDSLMVILRKREEKVLTGQA  276

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL  + ++   ++IS+++V DECK F   G   T+SLL W    L+   +
Sbjct  277  DNFGSDFLGSLLRVHHDADKKNRISLDDVIDECKVFFLAGHETTSSLLSWTFLLLAIHTD  336

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q++ARKEV+++FG ENP  +G+ RLK
Sbjct  337  WQDKARKEVLELFGQENPTAEGLPRLK  363



>ref|XP_008360080.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=520

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 99/208 (48%), Gaps = 55/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI+S E +V+ W  Y+GK++EV + F    SE+IS+ + GS+ LE K+IF 
Sbjct  170  ESLKNMIPEMIKSSETMVKRWKTYEGKEIEVNEEFRFFTSEVISRTAFGSSFLEGKDIFE  229

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++ S+KL                        
Sbjct  230  MLRELTSLIFRNTFKLRLPGISMFYKTSDEIKSDKLEKGIRDSITEIVRKREKTAMTGEA  289

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++    +IS++++ DECK F + G+  T SLL W V  L+   +
Sbjct  290  DGFGSDYLGILLKAHHDAHEKQRISVDDLVDECKTFYFAGQETTNSLLAWTVFLLALHTD  349

Query  639  LQERARKEVIQMFGS-ENPNPDGIARLK  719
             QE ARKEV+++FG  E PN DG+ +LK
Sbjct  350  WQEEARKEVLELFGKDETPNSDGLNKLK  377



>ref|XP_012075437.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=522

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 106/209 (51%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M + M+ S EM++E W  ++G +++VF+ F ++ SE+I +++ GS+  E +  F 
Sbjct  173  ESLKSMISAMVTSVEMMLERWGHHEGNEIDVFKEFLVLGSEIICRSAFGSSYSEGQRTFD  232

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   ++K   D++S+                          
Sbjct  233  KIIQLILIIDRNKYRIKIPGIRYLMKTRDDVESDNIQNGIRNSIMNMIKKREEAAMFSQS  292

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+ +S  + ++++EE+ DECK+F + G+  T +LL W V  L+   +
Sbjct  293  NDYGSDFLGLLLKAHHDSDMTKRLAVEEIIDECKSFYHAGQGTTATLLSWIVFLLAVHTD  352

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q +ARKEVI++FG +NP+PD ++R+KIV
Sbjct  353  WQAKARKEVIELFGQKNPSPDSLSRMKIV  381



>ref|XP_012075440.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=519

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 104/212 (49%), Gaps = 57/212 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI S EM++E W   +GK++EVFQ F ++ASE+IS+ + GS+ LE + IF 
Sbjct  167  ECLKSMIPAMITSVEMMLEKWRHNEGKEIEVFQEFKVLASEIISRTAFGSSYLEGQRIFD  226

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   +VK   D++SEK                         
Sbjct  227  MINQLTLIIGRNRYRIRIPGIRNLVKTWDDIESEKIDQEIRDSIMNMIKKREEAAMMSQS  286

Query  489  ----------LLVA---NQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSR  629
                      LL A   N +   + ++S+EE+ DECK F  VG   T +   W V  L+ 
Sbjct  287  NGFGTDFLGLLLKAHHDNNDPDQTKRLSVEEMIDECKTFYVVGHETTATSFTWTVFLLAI  346

Query  630  DKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
              + Q++ARKEV+++FG ++P+ DG++++K+V
Sbjct  347  HTDWQDKARKEVLELFGQQSPSSDGLSKMKLV  378



>gb|KHG08441.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 102/210 (49%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +G+++EVF  F L+ SE+IS+ + GSN LE K IF 
Sbjct  141  ESLKNMNPAVIASVETMLEKWKGREGEEIEVFNEFRLLTSEVISRTAFGSNYLEGKKIFD  200

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++SEKL                        
Sbjct  201  MLTKLAILVSRNYFKTPIPGISKIWKTAVEIESEKLANGIHDCVMEMVKRREKKVETGEA  260

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A ++S   ++ SIE++ DECK F + G+  T SLL W +  L+    
Sbjct  261  DGFGNDFLGLLINAYRDSDEKNRFSIEDLVDECKTFYFAGQETTNSLLAWTILVLAIHTK  320

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE+ R+EV ++FG +NPN +GIA+LKI++
Sbjct  321  WQEKTRQEVSEVFGDQNPNSEGIAKLKIMN  350



>gb|AJD25261.1| cytochrome P450 CYP749A39 [Salvia miltiorrhiza]
Length=511

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 97/210 (46%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   +    E ++E W  Y GK++EV   F  ++SE+IS+ + GSNCLE + IF 
Sbjct  162  ESLKDMVPEITACVETMLEKWRNYHGKEIEVCSEFKHLSSEVISRTAFGSNCLEGRKIFD  221

Query  441  -------------------GTGGIVKKNGDMDSEK-------------------------  488
                               G G  ++   D +++K                         
Sbjct  222  MLSKLIVLISRNMLKIRPFGLGKFIRTQDDKEADKIEQLLHDSIMEIVNKRQDEVQTGKA  281

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL ++ ++   S IS  E+ DECK F + G+  T SLL W    L+    
Sbjct  282  DSFGNDFLGSLLKSHHDTDPKSHISAAEIIDECKTFYFGGQETTFSLLSWTTFLLAIHTE  341

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             Q+RAR+EV+Q+FG +NPN DG++RLK V+
Sbjct  342  WQDRAREEVLQLFGQQNPNSDGLSRLKTVN  371



>ref|XP_011101783.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=489

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL GM   MI S E ++E W  Y+GK++EV + F + +SE+IS+ + GS+ LE KNIF 
Sbjct  157  ESLKGMIPAMIASVENMLENWRMYEGKEIEVSKEFMVFSSEVISRTAFGSSYLEGKNIFD  216

Query  441  -------------------GTGGIVKKNGDMDSEK-------------------------  488
                               G   I K   D++S+K                         
Sbjct  217  MLMKLGFLIFKNADKVRPFGIEKIWKTQDDIESDKIEQSLRDSLMVILRKREEKVLTGQA  276

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL  + ++   ++IS+++V DECK F   G   T+SLL W    L+   +
Sbjct  277  DNFGSDFLGSLLRVHHDADKKNRISLDDVIDECKVFFLAGHETTSSLLSWTFLLLAIHTD  336

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q++ARKEV+++FG ENP  +G+ RLK
Sbjct  337  WQDKARKEVLELFGQENPTAEGLPRLK  363



>ref|XP_012067827.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=512

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   M+ S E +++ W + + K++E+FQ F ++ SE+ISK + GS+ LE KN+F 
Sbjct  163  ESLKGMVPAMVASVETMLDRWRQNEVKEIEMFQEFKILTSEIISKTAFGSSYLEGKNLFD  222

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   I+K   D++SE+                         
Sbjct  223  MLTKMATIIARNNFQVRIPGIKKILKTPDDIESEELERGMRESILMMMKTREEGVVKGKL  282

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL     +  S+KIS++++ DECK F   G   T S L W +  L+    
Sbjct  283  ENYGSDFLGLLLKVYHANDLSNKISVQDLIDECKTFYLAGHETTVSSLTWTILLLAIHPI  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EVI++FG +NP  DGIARLKI+
Sbjct  343  WQDKAREEVIKLFGKQNPGSDGIARLKIM  371



>gb|KDP41345.1| hypothetical protein JCGZ_15752 [Jatropha curcas]
Length=435

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 98/212 (46%), Gaps = 57/212 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L GM   MI S EM+++ W      +++ FQ F ++ SE+IS+ + GS+ LE +NIF 
Sbjct  76   ECLKGMIPAMIASVEMMLQRWKICGCMEIDAFQEFKVLTSEIISRTAFGSSYLEGQNIFD  135

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   +VK   D++SEKL                        
Sbjct  136  KLMRLGVIISRNKYKVKVPGISNLVKTEDDIESEKLEQGIQNSIISMIKKREQATITEKS  195

Query  492  -----------LVANQesknsskisieeVAD---ECKAFCYVGRVATTSLLGWAVHKLSR  629
                       L A+ + +++ K     V D   ECK F   G   TTS L W V  L+ 
Sbjct  196  DSFGNDFLGLLLKAHHDDRDAHKTKRLSVQDIIDECKTFYVAGHETTTSSLSWIVFLLAV  255

Query  630  DKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
              + Q++AR E++Q+F  +NP+PDG++R+KIV
Sbjct  256  HTDWQDKARNEILQLFDLQNPSPDGLSRMKIV  287



>ref|XP_009356448.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 97/206 (47%), Gaps = 53/206 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++EVFQ F L +SE+IS+ + GSN +E KNIF 
Sbjct  168  ESLKSMTPAMVASTETMLEKWKSYEGKEIEVFQEFRLFSSEVISRTAFGSNYIEGKNIFE  227

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              P      K + +++++K                         
Sbjct  228  MLAKLGVLVFKNSLTIRVPVISKFFKTSDEIEADKLEKGLRVSIMEIVKRREEKATGGEG  287

Query  489  ---------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                     LL A  ++ +  +IS +E+ + CK F  V +  T +LL W V  L+   + 
Sbjct  288  SFGSDFLGLLLKAYHDTNDDQRISADELFELCKEFYLVAQETTNALLAWTVFLLALHTDW  347

Query  642  QERARKEVIQMFGSENPNPDGIARLK  719
            QE  RKEV+ +FG + PN DGIA+LK
Sbjct  348  QEEVRKEVVDLFGKQTPNADGIAKLK  373



>ref|XP_007045778.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01610.1| Cytochrome P450 [Theobroma cacao]
Length=516

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 104/210 (50%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +GK++EVF+ F L+ SE+IS+ + GS+ LE + IF 
Sbjct  167  ESLKSMTPAVIASVEAMLEKWKGREGKEIEVFEEFRLLTSEVISRTAFGSSYLEGEKIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++SEKL                        
Sbjct  227  KLMKLSIIANRNFHKARIPGISKIWKPADEIESEKLAKGIHDCVMDMVKKREEKVLTGEA  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  +    +++S+E++ DECK F + G+  T SLL W V  L+   +
Sbjct  287  DSFGTDFLGLLVKAYHDEDERNRLSVEDLVDECKTFYFAGQETTNSLLAWTVLVLAIHTD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE+AR+EVI++FG++NP+ +GIA LK ++
Sbjct  347  WQEKARREVIEVFGNKNPHSEGIANLKTMN  376



>ref|XP_004295657.2| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=521

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 103/211 (49%), Gaps = 56/211 (27%)
 Frame = +3

Query  264  SLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF--  437
            SL  M   MI + E +++ W   +GK++E++Q F L  +E+IS+ + GS+ LE KNIF  
Sbjct  171  SLKNMIPEMIATAEKMLQRWKNSEGKEIELYQEFRLFTAEVISRTAFGSSYLEGKNIFDM  230

Query  438  -----------------PGTGGIVKKNGDMDSEKL------------------LVANQes  512
                             PG     K + ++++EKL                  +V  Q+ 
Sbjct  231  LTKICLLVFKNSYKIRLPGIRKFFKTSDEIEAEKLEKDLRYTILEIVKKRENKVVVKQDE  290

Query  513  kn-------------------sskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
             N                     +++I+++ D+CKA  + G+  T  LL W V  L+  +
Sbjct  291  NNFGDDLLGLLLKAHHEDSNDRYRVTIDDIIDQCKALYFAGQETTNGLLAWTVLLLALHQ  350

Query  636  NLQERARKEVIQMFGSENPNPDGIARLKIVD  728
            + QE ARKEV+Q+FG +NP+ DGI+RLK ++
Sbjct  351  DWQEEARKEVLQLFGKQNPSSDGISRLKTMN  381



>ref|XP_012067825.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=514

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 102/212 (48%), Gaps = 56/212 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L GM   M+ S EM+VE W  +DGK++EVFQ F ++ SE+IS+ + GS+ LE + +F 
Sbjct  163  ENLKGMVPAMLASVEMMVERWRHHDGKEIEVFQEFKVLTSEIISRTAFGSSYLEGEEVFD  222

Query  438  --------------------PGTGGIVKKNGDMDSEK-----------------------  488
                                PG    +K   +++ +K                       
Sbjct  223  MLKKMIFIVARNHYKVRIPCPGIKRFLKTGDELELDKIQKEIRDTIINMIKKREKATMMG  282

Query  489  ------------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRD  632
                        L+ A  +   + +ISI+++ DECK F   G+  T S L W V  L+  
Sbjct  283  ELDGYGSDFLGLLIKAYNDPDKNKRISIDDMIDECKTFYVAGQETTASSLTWTVLLLAIH  342

Query  633  KNLQERARKEVIQMFGSENPNPDGIARLKIVD  728
             + Q+ ARKEV+++FG +NP  DG+ARLK ++
Sbjct  343  TDWQDEARKEVLELFGQQNPTADGVARLKTMN  374



>gb|KCW85140.1| hypothetical protein EUGRSUZ_B01983 [Eucalyptus grandis]
Length=514

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 102/209 (49%), Gaps = 53/209 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   M+ S   +++ W K + K+VE+F+ F  I S++IS+ + GS+ +E + IF 
Sbjct  166  ESLKGMIPAMVDSVHALLDRWQKLEAKEVEIFEEFATITSDVISRTAFGSSYMEGREIFQ  225

Query  438  ------------------PGTG-----------------------GIVKKN-----GDMD  479
                              PG                         GI+KK      G+MD
Sbjct  226  MLSELTIIVSRNFFKLRLPGIRKIWKTSDEIKSERLEKAICDALLGIIKKREEKAKGEMD  285

Query  480  SE------KLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                     LL A  +   S +I+++++ DECK F + G+  TTS+L W +  L+  K+ 
Sbjct  286  DYGNDYLGSLLKAYHDPDKSKRITMDDLRDECKTFHFAGQETTTSILTWTLFLLAIHKDW  345

Query  642  QERARKEVIQMFGSENPNPDGIARLKIVD  728
            QE ARKEV  +F +E+PN +GI +LK VD
Sbjct  346  QEEARKEVTDVFDNEDPNHEGIIKLKTVD  374



>ref|XP_006484250.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=509

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S EM+++ W   +G++++V+Q F ++  E IS+ + GS+ LE +NIF 
Sbjct  160  ETLKSMIPDMIASAEMMLDRWRDNEGQEIDVYQEFKILTLEAISRTAFGSSYLEGENIFN  219

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              P  G +VK + D++S K                         
Sbjct  220  MLTKLTFFISKNEYRVRIPVIGKLVKTHDDIESHKTEQDIRDSIIKIIKKRESNVMTGEV  279

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A      + KIS++++ DECK F   G   T SLL W V  L+   +
Sbjct  280  ESYGSDLLGVLMQAYHNVDETLKISLDDLIDECKTFYIAGHETTASLLTWTVLLLAIHND  339

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR EV+Q+FG ++PN D I+RLKI+
Sbjct  340  WQDKARNEVLQLFGQQSPNADNISRLKIM  368



>ref|XP_006437867.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
 gb|ESR51107.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
Length=509

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S EM+++ W   +G++++V+Q F ++  E IS+ + GS+ LE +NIF 
Sbjct  160  ETLKSMIPDMIASAEMMLDRWRDNEGQEIDVYQEFKILTLEAISRTAFGSSYLEGENIFN  219

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              P  G +VK + D++S K                         
Sbjct  220  MLTKLTFFISKNEYRVRIPVIGKLVKTHDDIESHKTEQDIRDSIIKIIKKRESNVMTGEV  279

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A      + KIS++++ DECK F   G   T SLL W V  L+   +
Sbjct  280  ESYGSDLLGVLMQAYHNVDETLKISLDDLIDECKTFYIAGHETTASLLTWTVLLLAIHND  339

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR EV+Q+FG ++PN D I+RLKI+
Sbjct  340  WQDKARNEVLQLFGQQSPNADNISRLKIM  368



>ref|XP_011009723.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=515

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 110/232 (47%), Gaps = 58/232 (25%)
 Frame = +3

Query  204  GVQTSQ----TTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTL  371
            GV TS+    T   + S+     ++L  M   MI S EM++E W + +G+++EV+Q   L
Sbjct  143  GVSTSEGEKWTKHRKLSTYAFNAENLKDMIPEMIASVEMLLERWKQNEGREIEVYQELRL  202

Query  372  IASELISKASLGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL-  491
            + SE+IS+ + GS+ +E K+IF                   PG     +   +++SEKL 
Sbjct  203  LTSEIISRTAFGSSYVEGKDIFDMLTKLSLIIHRNIYKLRLPGISKFWRTRDEIESEKLV  262

Query  492  ----------------------------------LVANQesknsskisieeVADECKAFC  569
                                              L +  ++    +ISIE++ DECK F 
Sbjct  263  KGIHNSVMEIIKKREEKVKTGEADGFGNDFLGVLLNSYHDADEKKRISIEDLVDECKTFY  322

Query  570  YVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
              G+ +T SLL W +  L+   + QE ARKEV  +FG + PN DGIA+LKI+
Sbjct  323  IAGQESTNSLLSWTILLLAIHTDWQEEARKEVFNIFGRQKPNLDGIAKLKIL  374



>ref|XP_004297193.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=519

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 100/209 (48%), Gaps = 56/209 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYD-GKDVEVFQHFTLIASELISKASLGSNCLEAKNIF  437
            +SL  M   MI S E +++ W+ ++ GK++EVF+ F L+ SE+IS+ + GS+ LE ++IF
Sbjct  168  ESLKTMIPSMIASTETMLKRWITFEEGKEIEVFEEFRLLTSEVISRTAFGSSYLEGQDIF  227

Query  438  -------------------PGTGGIVKKNGDMDSEKL-----------------------  491
                               PG    +K   +++SEKL                       
Sbjct  228  EMLMKLASFLVKNTYRLRIPGISRFIKNKDEIESEKLVERIHDSILEIVKKREEQAMTMS  287

Query  492  ------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                        L+       +  I++++V DECK F + G+  T +LL W +  L+   
Sbjct  288  DEEDRFGGDFIGLLLKARHDPNVNITVDDVIDECKTFYFAGQETTNTLLAWTILLLALHP  347

Query  636  NLQERARKEVIQMFGSE-NPNPDGIARLK  719
              QE AR+EV+Q+FG +  PN DGIA+LK
Sbjct  348  EWQEEARREVLQLFGKQTTPNSDGIAKLK  376



>gb|KCW44878.1| hypothetical protein EUGRSUZ_L01541, partial [Eucalyptus grandis]
Length=397

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 99/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S  M+++ W   + + VE+F+ FT I S++IS+ + GS+ +E +N+F 
Sbjct  54   ESLKCMIPAMVDSVHMLLKRWQNLEARVVELFEEFTAITSDVISRTAFGSSYIEGRNMFQ  113

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   ++DSE+L                        
Sbjct  114  MLGELTTIASRNIFKLRLPGVRNIWKTIDEIDSERLEKAIRDVVLEIIRKREEKVNTGEM  173

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +   S + +I++V DECK F + G+  T S+L W +  L+  K+
Sbjct  174  NDYGNDLLGSLLKAYHDPDESKRTTIDDVMDECKTFYFAGQETTNSVLTWTLFLLAIHKD  233

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q+ ARKEV  +FG+E+PN DGI +LK V
Sbjct  234  WQQEARKEVTDVFGNEDPNHDGIMKLKTV  262



>ref|XP_006437871.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51111.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=546

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 101/212 (48%), Gaps = 58/212 (27%)
 Frame = +3

Query  246  LTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEA  425
              P++D    M   M+ S E++++ W   +GK++EV Q FTL+ SE+IS+ + GS+ LE 
Sbjct  190  FVPMQD----MIPAMVASVEIMLKRWRHNEGKEIEVSQDFTLLTSEIISRTAFGSSYLEG  245

Query  426  KNIF-------------------PGTGGIVKKNGDMDSEKL-------------------  491
            ++IF                   P  G  VK + D++++KL                   
Sbjct  246  ESIFNKLTNMSFIASRNAYKIKIPLIGDFVKTSDDVEADKLEQGIRDSIIKMMKTREEKA  305

Query  492  ----------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKL  623
                            L A  +   + +IS++ + DECK F   G   TT LL W +  L
Sbjct  306  MKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLL  365

Query  624  SRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            +   + QE+ R+EV+++FG +NP PDGI +LK
Sbjct  366  ATHTDWQEKLREEVLELFGQQNPTPDGIGKLK  397



>ref|XP_010046258.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=383

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  267  LNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF---  437
            + GM   M+ S   +++ W K + K+VE+F+ F +I S++IS+ + GS+ +E + IF   
Sbjct  35   VRGMIPAMVDSVHALLDRWQKLEAKEVELFEEFAMITSDVISRTAFGSSYIEGREIFQML  94

Query  438  ----------------PGTGGIVKKNGDMDSEKL--------------------------  491
                            PG   I K + D+ SE+L                          
Sbjct  95   SELTIVVSRNLFKLRLPGIRNIWKTSDDIKSERLEKAICDALLGIIEKREKKVNVGEMDD  154

Query  492  ---------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                     L A  +   S +I+I+++ DEC+ F + G+  TTS+L W +  L+  K+ Q
Sbjct  155  YGNDYLGSLLKAYHDPDKSKRITIDDLMDECRTFHFSGQETTTSILTWTLFLLAIHKDWQ  214

Query  645  ERARKEVIQMFGSENPNPDGIARLKIV  725
            E ARKEV  +FG+E+PN +GI +LK V
Sbjct  215  EEARKEVTDVFGNEDPNHEGIMKLKTV  241



>gb|KJB80516.1| hypothetical protein B456_013G101100 [Gossypium raimondii]
Length=519

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 103/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E++++ W  +  K++EVF+ F L+++++IS+ + GSN LE KNIF 
Sbjct  163  ESLKKMIPEMVVSVELMLQSWKNHLEKEIEVFEEFRLLSADIISRTAFGSNYLEGKNIFD  222

Query  438  ------------------PGTGGIVKKNGDMDSEKLLV----------------------  497
                              P    I K + +++++KLL                       
Sbjct  223  MKVKYSNITRMNIFKSRFPSISKIWKTSDEIEADKLLSIIHKSVMDIIKKREEKVKLGEI  282

Query  498  -------------ANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                         A  +   + +I +E++ DECK F  VG+    SLL W V  L+   +
Sbjct  283  DNYGTDFLGLLLQAYHDVDENRRILVEDLIDECKTFYIVGQEPINSLLSWTVLLLAIHTD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG +NP+PD +++L IV
Sbjct  343  WQEKAREEVIELFGHQNPHPDDLSKLNIV  371



>ref|XP_002512042.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50711.1| cytochrome P450, putative [Ricinus communis]
Length=452

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 101/210 (48%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            ++L GM   MI S EM++E W + + K++EV+Q F L+ SE+IS+ + GS+ LE ++IF 
Sbjct  103  ENLKGMVPAMIASVEMMLERWRQNEEKEIEVYQEFKLLTSEIISRTAFGSSYLEGQHIFD  162

Query  441  GTGGIV-------------------KKNGDMDSEK-------------------------  488
              G +                    K+  D +SEK                         
Sbjct  163  MLGKLARILNKNSYQVRIRAIEKLWKRKDDTESEKLEQGIRDSVLKMINKREEDEKTGEV  222

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A QE+  S KIS++++ DECK F   G   T+S L W +  L+   +
Sbjct  223  DSCGSDFLGVLLKAYQETDESKKISVDDLIDECKTFYIAGHETTSSALTWCIFLLAIHTD  282

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE+AR+EV++ FG   P  D I RLKI++
Sbjct  283  WQEKARQEVLESFGQRIPTSDEITRLKIMN  312



>ref|XP_008352941.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 103/208 (50%), Gaps = 54/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E+++E W  ++G+++EV + F L+ SE+IS+ + GS+ LE KNIF 
Sbjct  165  ESLKSMIPEMITSTEVMLERWKNHEGEEIEVNEEFKLLTSEVISRTAFGSSYLEGKNIFE  224

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++ S+KL                        
Sbjct  225  MLTELASLLFKNTYTFRLPGISKFYKPSDEIKSDKLEKGIRDSIAGMASKREKKAMTGEG  284

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+  +  + +IS++E+ DECK F   G+   TS+L W V  L+   +
Sbjct  285  DGFGSDYLGLLLKAHHNAIGNERISMDELVDECKTFYLAGQETATSMLSWTVFLLALHTD  344

Query  639  LQERARKEVIQMFGSENPNPDGIARLKI  722
             QE ARKEV+Q+FG + PNPDGIA+LK+
Sbjct  345  WQEEARKEVLQLFGKQTPNPDGIAKLKL  372



>ref|XP_008339765.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 103/208 (50%), Gaps = 54/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E+++E W  ++G+++EV + F L+ SE+IS+ + GS+ LE KNIF 
Sbjct  165  ESLKSMIPEMITSTEVMLERWKNHEGEEIEVNEEFKLLTSEVISRTAFGSSYLEGKNIFE  224

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++ S+KL                        
Sbjct  225  MLTELASLLFKNTYTFRLPGISKFYKPSDEIKSDKLEKGIRDSIAGMASKREKKAMTGEG  284

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+  +  + +IS++E+ DECK F   G+   TS+L W V  L+   +
Sbjct  285  DGFGSDYLGLLLKAHHNAIGNERISMDELVDECKTFYLAGQETATSMLSWTVFLLALHTD  344

Query  639  LQERARKEVIQMFGSENPNPDGIARLKI  722
             QE ARKEV+Q+FG + PNPDGIA+LK+
Sbjct  345  WQEEARKEVLQLFGKQTPNPDGIAKLKL  372



>ref|XP_002316009.1| hypothetical protein POPTR_0010s14940g [Populus trichocarpa]
 gb|EEF02180.1| hypothetical protein POPTR_0010s14940g [Populus trichocarpa]
Length=555

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 106/219 (48%), Gaps = 57/219 (26%)
 Frame = +3

Query  222  TTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKAS  401
            T  L   S+  +ED    M   M+ S EM++  W  + GK++EVFQ F ++ SE+IS+ +
Sbjct  198  TWSLTSGSVGLVED----MIPEMVSSVEMMLGRWKDHRGKEIEVFQDFKVLTSEIISRTA  253

Query  402  LGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL--LVAN-----  503
             GS+ LE + IF                   PG G +VK   D+ SEKL  L+ N     
Sbjct  254  FGSSYLEGQQIFEILTRMVLIFSKNLFKMRIPGIGKLVKTQDDIQSEKLGQLIRNSVIKM  313

Query  504  ---------------------------QesknsskisieeVADECKAFCYVGRVATTSLL  602
                                       + +  +S+I+I+++ DECK F   G   TTS L
Sbjct  314  IKKREAAMAGEIDGYGSDFLGQLVKVYRSADMTSRITIDDLIDECKNFYIAGHETTTSAL  373

Query  603  GWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
             W V  L+   + QE+ R E++++FG +NP+ +GI+RLK
Sbjct  374  TWIVLMLATHADWQEKVRNEILELFGQQNPSLEGISRLK  412



>gb|KDO70288.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=520

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 54/214 (25%)
 Frame = +3

Query  240  SSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCL  419
            ++L    +SL  M   M+ S E++++ W   +GK++EV Q F L+ SE+IS+ + GS+ L
Sbjct  158  ATLAFYAESLRDMIPAMVASVEIMLKRWRHSEGKEIEVSQEFKLLTSEIISRTAFGSSYL  217

Query  420  EAKNIF-------------------PGTGGIVKKNGDMDSEKL-----------------  491
            E ++IF                   P  G  VK + D++ +KL                 
Sbjct  218  EGESIFNKLTNMSFLASRNAYKIKIPLIGDFVKTSDDVEGDKLEQGIRDSIIKMMKTREE  277

Query  492  ------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVH  617
                              L A  +   + +IS++ + DECK F   G   TT LL W + 
Sbjct  278  KALKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTIL  337

Query  618  KLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
             L+   + QE+ R+EV+++FG +NP PDGI +LK
Sbjct  338  LLATHTDWQEKLREEVLELFGQKNPAPDGIGKLK  371



>ref|XP_011101779.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M + M+ S + ++E W  ++GK++EV + F L+ S++IS+ + GS+ +E KNIF 
Sbjct  162  ESLKDMVSAMVESVDTMLERWRYHEGKEIEVSKEFKLLTSDVISRTAFGSSYVEGKNIFD  221

Query  441  -------------------GTGGIVKKNGDMDSEK-------------------------  488
                               G   I +   D++S+K                         
Sbjct  222  MMMKLGVLIAKNTFKIRLFGLKKIWRSKDDIESDKIEQSLHDSILSLVKKREDKVKAGES  281

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL  + +    S+IS++++ DECK F   G   T++LL W V  LS    
Sbjct  282  DNFGNDFLGSLLKVHHDIDPKSRISVDDIVDECKVFYIAGHETTSTLLSWTVFLLSIFTE  341

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR EV+Q+FG E P  +GIARLKI+
Sbjct  342  WQEKARDEVVQVFGQEKPTAEGIARLKIL  370



>gb|KCW44686.1| hypothetical protein EUGRSUZ_L01780, partial [Eucalyptus grandis]
Length=407

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S  M+++ W   + ++VE+F+ FT I S++IS+ + GS+ +E +NIF 
Sbjct  54   ESLKCMIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGRNIFR  113

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I K + ++DSE+L                        
Sbjct  114  MLGELTTIASQNHFKLRLPEVRKIWKTSDEIDSERLEKAIRDAVLEIIKKREEKVNTGEM  173

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +   S +I+I++V DECK F + G+  T S+L W +  L+  K+
Sbjct  174  NDYGNDFLGSLLKAYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTLFLLAIHKD  233

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q+ ARKEV  +FG+E+PN DG+ +LK V
Sbjct  234  WQQEARKEVTNVFGNEDPNHDGMMKLKTV  262



>ref|XP_011102247.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M + M+ S + ++E W  ++GK++EV + F L+ S++IS+ + GS+ +E KNIF 
Sbjct  162  ESLKDMVSAMVESVDTMLERWRYHEGKEIEVSKEFKLLTSDVISRTAFGSSYVEGKNIFD  221

Query  441  -------------------GTGGIVKKNGDMDSEK-------------------------  488
                               G   I +   D++S+K                         
Sbjct  222  MMMKLGVLIAKNTFKIRLFGLKKIWRSKDDIESDKIEQSLHDSILSLVKKREDKVKAGES  281

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL  + +    S+IS++++ DECK F   G   T++LL W V  LS    
Sbjct  282  DNFGNDFLGSLLKVHHDIDPKSRISVDDIVDECKVFYIAGHETTSTLLSWTVFLLSIFTE  341

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR EV+Q+FG E P  +GIARLKI+
Sbjct  342  WQEKARDEVVQVFGQEKPTAEGIARLKIL  370



>ref|XP_007045772.1| Secologanin synthase, putative [Theobroma cacao]
 gb|EOY01604.1| Secologanin synthase, putative [Theobroma cacao]
Length=1045

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 97/207 (47%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   +I S E ++E W +++GK++E F+ F L+ SE+IS+ + GS+ L+ K IF 
Sbjct  696  DSLKSMTPAVIASVETMLERWKQFEGKEIEAFEEFRLLTSEVISRTAFGSSYLDGKKIFD  755

Query  438  ------------------PGTGGIVKKNGDMDSEKLL--VANQesknsskisieeV----  545
                              P      K   +++S+KL+  + N   +   K   + V    
Sbjct  756  MLLKLSVLTNRNLFKTKFPVISNFCKTADEIESDKLVKGIHNSVMEVVKKREEKVVNGEA  815

Query  546  -----------------------------ADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                                          DECK F + G+  T S L W V  L+ + +
Sbjct  816  NSFGTDFLGLLVNAYHDADKKNRLSVQDLVDECKTFYFAGQETTNSALAWTVLLLAINPD  875

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR+EVI++FG++NP+ +GI RLK
Sbjct  876  WQEKARREVIEVFGNQNPHSEGIGRLK  902


 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL  M   +I S E ++E W + +GK++EVF+ F L+ SE+IS+ + GS+ L+ K I  
Sbjct  175  ESLKSMTPALIASVETMLEKWKQLEGKEIEVFEEFRLLTSEVISRTAFGSSYLDGKKIFD  234

Query  435  -----------------FPGTGGIVKKNGDMDSEKLL-----------------------  494
                             FP      K   +++S+KL+                       
Sbjct  235  MLLKLSVLTNRNMFKTKFPVISNFRKTADEIESDKLVKGIHNSVMEIVKKREEKVVNGEA  294

Query  495  ------------VANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                         A  ++   ++ S++++ DECK F + G+  T S L W V  L+ + +
Sbjct  295  NSFGTDFLGLLVSAYHDADKKNRPSVQDLVDECKTFYFAGQETTNSALAWTVLLLAINPD  354

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR+EVI++FG++NP+ +GI RLK
Sbjct  355  WQEKARREVIEVFGNQNPHSEGIGRLK  381



>ref|XP_002325505.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
 gb|EEE99886.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
Length=567

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 104/209 (50%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM   MI S E++++ W  ++GK+++ FQ F ++ SE+IS+ + GS+ LE ++IF 
Sbjct  163  ESLKGMIPDMIASVEVMLKRWRNHEGKEIDTFQEFKVLTSEVISRTAFGSSYLEGQHIFD  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P  G I K + D++SE L                        
Sbjct  223  MIMNMIDIIYRNNYRISIPFIGKIFKSSDDIESENLEKRVRESIIKMMKKREEEATSGHL  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +  NS KIS++++ DECK     G+  TTSLL W V  L+   +
Sbjct  283  DGYGNDFFGLLLKAYHDPDNSKKISVDDLIDECKTIYVAGQETTTSLLSWTVLLLAICPD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++ RKEV+++ G +NP+PD + +LKI+
Sbjct  343  WQDKVRKEVLELIGQQNPSPDRMTKLKIM  371



>ref|XP_009346501.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=517

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  MF  M+ S E ++E W  Y+ K++EVF+ F L  SE+IS+ + GS+ LE +NIF 
Sbjct  168  ECLKSMFPDMVASAETMLERWRNYEEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQNIFE  227

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K + ++++EKL                        
Sbjct  228  MLMKLAFLLSKNALTVRIPGISKIFKTSDEIEAEKLKKGVYASIMDIAKKREKTAMSGDE  287

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A   + +  +IS++++ DECK F + G+  T +LL W V  L+   N
Sbjct  288  DGFGSDFFGLLLKARHAANDGQRISVDDLVDECKTFYFAGQETTNTLLAWTVFLLALHTN  347

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVI++FG + PN DGI +LK
Sbjct  348  WQEEARKEVIELFGKQTPNLDGITKLK  374



>ref|XP_010040838.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=584

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 99/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S  M+++ W   + + VE+F+ FT I S++IS+ + GS+ +E +N+F 
Sbjct  167  ESLKCMIPAMVDSVHMLLKRWQNLEARVVELFEEFTAITSDVISRTAFGSSYIEGRNMFQ  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   ++DSE+L                        
Sbjct  227  MLGELTTIASRNIFKLRLPGVRNIWKTIDEIDSERLEKAIRDVVLEIIRKREEKVNTGEM  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +   S + +I++V DECK F + G+  T S+L W +  L+  K+
Sbjct  287  NDYGNDLLGSLLKAYHDPDESKRTTIDDVMDECKTFYFAGQETTNSVLTWTLFLLAIHKD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q+ ARKEV  +FG+E+PN DGI +LK V
Sbjct  347  WQQEARKEVTDVFGNEDPNHDGIMKLKTV  375



>ref|XP_011015632.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=517

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 54/208 (26%)
 Frame = +3

Query  264  SLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF--  437
            SL  M   MI S E++++ W  Y+ K+++VF+ F ++ SE+IS+ + GS+ LE ++IF  
Sbjct  164  SLKNMIPAMIASSEIMLQRWRHYESKEIDVFREFKVLTSEIISRTAFGSSYLEGQHIFDM  223

Query  438  -----------------PGTGGIVKKNGDMDSEKL-------------------------  491
                             PG G   K   +++SE L                         
Sbjct  224  LTRMAHIISGNNYRIRIPGIGKFFKTIDEIESENLEATIRSSFMNMMKKREQEAMLGNID  283

Query  492  ----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                      L A   ++ + KIS++++ DECK F   G+  T+S L W+V  L+   + 
Sbjct  284  GYGHDFFGLLLEAYHHTEKTKKISVDDLIDECKTFYVAGQETTSSSLTWSVLLLAIHTDW  343

Query  642  QERARKEVIQMFGSENPNPDGIARLKIV  725
            Q++ R EV+++FG +NP+ D IA+LKI+
Sbjct  344  QDKVRNEVLELFGQQNPSQDSIAKLKIM  371



>ref|XP_008389384.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 95/206 (46%), Gaps = 53/206 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S E ++E W  Y+GK++EVFQ F L +SE+IS+ + GSN +E K IF 
Sbjct  168  ESLKSMTPAMVASTETMLEKWKSYEGKEIEVFQEFRLFSSEVISRTAFGSNYIEGKXIFE  227

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              P      K + +++++K                         
Sbjct  228  TLAKLGVLVFKNSLTIRVPVFSKFFKTSDEIEADKLEKGLRVSIMEIVKRREEKATGGEG  287

Query  489  ---------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                     LL A  ++ +  +IS +E+ + CK F  V +  T +LL W V  L+   + 
Sbjct  288  SFGSDFLGLLLKAYHDTNDDQRISADELFELCKEFYLVAQETTNALLAWTVFLLALHTDW  347

Query  642  QERARKEVIQMFGSENPNPDGIARLK  719
            QE  RKEV+ +FG   PN DGIA+LK
Sbjct  348  QEEVRKEVVDLFGKHTPNADGIAKLK  373



>gb|KDO70290.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=452

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 99/212 (47%), Gaps = 58/212 (27%)
 Frame = +3

Query  246  LTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEA  425
              P++D    M   M+ S E++++ W   +GK++EV Q F L+ SE+IS+ + GS+ LE 
Sbjct  96   FAPMQD----MIPAMVASVEIMLKRWRHSEGKEIEVSQEFKLLTSEIISRTAFGSSYLEG  151

Query  426  KNIF-------------------PGTGGIVKKNGDMDSEKL-------------------  491
            ++IF                   P  G  VK + D++ +KL                   
Sbjct  152  ESIFNKLTNMSFLASRNAYKIKIPLIGDFVKTSDDVEGDKLEQGIRDSIIKMMKTREEKA  211

Query  492  ----------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKL  623
                            L A  +   + +IS++ + DECK F   G   TT LL W +  L
Sbjct  212  LKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLL  271

Query  624  SRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            +   + QE+ R+EV+++FG +NP PDGI +LK
Sbjct  272  ATHTDWQEKLREEVLELFGQKNPAPDGIGKLK  303



>emb|CDP00472.1| unnamed protein product [Coffea canephora]
Length=1133

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 94/207 (45%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   MI S E ++E W  +DGK++EV++ F  + SE+IS+ + GS+ LE KNIF 
Sbjct  784  ESLKDMVPAMIESVEAVLEKWRCHDGKEIEVYEEFRHLTSEVISRTAFGSSYLEGKNIFE  843

Query  441  ---GTGGIVKKN----------------GDMDSEK-------------------------  488
                 G  + KN                 D+ SEK                         
Sbjct  844  MLMQLGFFIFKNDAKIRFLKDWKIFRSADDIASEKIEESLRNSIMSIVNKREEGVKIGKA  903

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+  +    +I+I+++ DECK F   G    +S L W +  L+   +
Sbjct  904  DSYGNDFLGSLLQAHHAADVKYRITIDDIVDECKTFYLAGHETISSALTWTIFLLAIHTD  963

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR EV + FG E P PD IARL+
Sbjct  964  WQEKARNEVFEFFGHEKPKPDFIARLR  990


 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 100/201 (50%), Gaps = 48/201 (24%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E+++  W  Y+G +++  + F L+ +E+IS+ + GS+ LE ++IF 
Sbjct  163  ESLRHMIPAMIESVELMLGRWKNYEGMEIDASEEFRLLTAEIISRTAFGSSYLEGQDIFQ  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    + K   D++++KL                        
Sbjct  223  MLRKLVVLSCKNSHKTKLPIISSVFKDRYDLEADKLEKRVRDSVLEMVKKRQTEISFGED  282

Query  492  -----LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERAR  656
                 L A+  S  +S+I+++E+ D+CK F   G+  T+ LL W +  L+   + QE+AR
Sbjct  283  FLGLHLKAHYASDGNSRITVQEIIDQCKTFYSAGQTTTSVLLSWTILLLAIHTDWQEKAR  342

Query  657  KEVIQMFGSENPNPDGIARLK  719
            +EV ++FG + PNP+GI+R+K
Sbjct  343  EEVFELFGQQPPNPEGISRMK  363



>ref|XP_008346697.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  MF  M+ S E ++E W  Y+ K++EVF+ F L  SE+IS+ + GS+ LE + IF 
Sbjct  168  ECLKSMFPDMVASAETMLERWRNYEEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQXIFE  227

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K + ++++EKL                        
Sbjct  228  MLMKLAFLVSKNALXVRIPGISKVFKTSDEIEAEKLEKGVYASIMDIAKKREKTATSGDE  287

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  ++ +  +IS++++ DECK F + G+  T +LLGW V  L+   N
Sbjct  288  DSFGSDFLGLLLKARHDANDDQRISVDDLVDECKTFYFAGQETTNTLLGWTVFLLALHTN  347

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVI++FG + PN DGI +LK
Sbjct  348  WQEEARKEVIELFGKQTPNLDGITKLK  374



>ref|XP_011008174.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=512

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E++++ W  ++G++++ FQ F ++ SE+IS+ + GS+ LE ++IF 
Sbjct  163  ESLKAMIPDMIASVEVMLKRWRNHEGEEIDAFQEFKVLTSEVISRTAFGSSYLEGQHIFD  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P  G I K + D++SE L                        
Sbjct  223  MIMNMIDIIYRNNYRISIPFIGKIFKSSDDIESENLEKRVRESIIKMMKKREEEATSGQL  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +  NS KIS++++ DECK     G+  TTSLL W V  L+   +
Sbjct  283  DGYGNDFFGLLLKAYHDLDNSKKISVDDLIDECKTIYVAGQETTTSLLSWTVLLLAIYPD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q+R RKEV+++ G +NP PD + +LKI+
Sbjct  343  WQDRVRKEVLELIGQQNPGPDSMTKLKIM  371



>ref|XP_010046249.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=497

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 99/204 (49%), Gaps = 54/204 (26%)
 Frame = +3

Query  276  MFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF------  437
            M   M+ S  M+++ W   + ++VE+F+ FT I S++IS+ + GS+ +E +NIF      
Sbjct  84   MIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGRNIFRMLGEL  143

Query  438  -------------PGTGGIVKKNGDMDSEKL-----------------------------  491
                         PG   I K + ++DSE+L                             
Sbjct  144  TTIVSRNLFKLRLPGVRKIWKTSDEIDSERLEKAIHDAVLEIIKNREEKVNTGEMNNYGN  203

Query  492  ------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
                  L A  +   S +I+I++V DECK F + G+  T S+L W +  L+  K+ Q+ A
Sbjct  204  DFLGSLLKAYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEA  263

Query  654  RKEVIQMFGSENPNPDGIARLKIV  725
            RKEV  +FG+E+PN DG+ +LK V
Sbjct  264  RKEVTNVFGNEDPNHDGMMKLKTV  287



>ref|XP_004298350.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 98/207 (47%), Gaps = 55/207 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E +VE W K  G+++EVFQ F L+ +E+IS+ + GS+ L+ + IF 
Sbjct  168  ESLKNMIPQMIVSAETMVERW-KNLGQEIEVFQEFRLLTAEVISRTAFGSSYLQGQQIFD  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P      K + ++++EKL                        
Sbjct  227  MLMKLTSLISTFDLRLKLPIISKFFKTSDEIEAEKLQKGIRNSVMEIVKEREEKAMSGGE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  ++ +  + SI+++ DECK+F + G+    +LL W V  L+    
Sbjct  287  ESFGSDFLGSLLKAYHDTNDKQRFSIDDIVDECKSFYFAGQETVNTLLAWTVFLLAHHTE  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+++FG E PNP+ +++LK
Sbjct  347  WQEEARKEVLEIFGKETPNPNDLSKLK  373



>gb|KDO70289.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=546

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 99/212 (47%), Gaps = 58/212 (27%)
 Frame = +3

Query  246  LTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEA  425
              P++D    M   M+ S E++++ W   +GK++EV Q F L+ SE+IS+ + GS+ LE 
Sbjct  190  FAPMQD----MIPAMVASVEIMLKRWRHSEGKEIEVSQEFKLLTSEIISRTAFGSSYLEG  245

Query  426  KNIF-------------------PGTGGIVKKNGDMDSEKL-------------------  491
            ++IF                   P  G  VK + D++ +KL                   
Sbjct  246  ESIFNKLTNMSFLASRNAYKIKIPLIGDFVKTSDDVEGDKLEQGIRDSIIKMMKTREEKA  305

Query  492  ----------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKL  623
                            L A  +   + +IS++ + DECK F   G   TT LL W +  L
Sbjct  306  LKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLL  365

Query  624  SRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            +   + QE+ R+EV+++FG +NP PDGI +LK
Sbjct  366  ATHTDWQEKLREEVLELFGQKNPAPDGIGKLK  397



>ref|XP_009607163.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana tomentosiformis]
Length=507

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 99/209 (47%), Gaps = 56/209 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI S E ++E W  Y+ K++EVF+ F ++ SE+IS+ + GS+ LE KNIF 
Sbjct  162  ESLKSMVPMMIMSCETMLEKWKIYEEKEIEVFEEFRILTSEIISRTAFGSSYLEGKNIFQ  221

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++SEKL                        
Sbjct  222  MLMKLALLVSKDALKIKFPGISQIWKSRDEIESEKLEQGIRDSITRIIKKREEEKIGEEH  281

Query  492  ----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                      L A QE    S      + DECK     G   TTSLLGW +  L+ +KN 
Sbjct  282  NFGSDFLGKLLEAYQEDYRISVEE---IVDECKTIYLAGHETTTSLLGWTILLLATNKNW  338

Query  642  QERARKEVIQMFGSENPNPDGIARLKIVD  728
            QE+ARKEV++ FG + P  DG++RLKI++
Sbjct  339  QEKARKEVLESFGQKVPTADGLSRLKIMN  367



>ref|XP_012068355.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=513

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 100/208 (48%), Gaps = 52/208 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  M   MI S EM++  W + + K+++V++ F L+ SE+IS+ + GS+ LE ++IF 
Sbjct  161  EKLKDMIPAMITSVEMMLRRWRQNEHKEIDVWKEFKLLTSEVISRTAFGSSYLEGQHIFD  220

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P     +K   D+ SEKL                        
Sbjct  221  MLMELVLLLSKNGYEVRIPIIKKFIKTKDDIKSEKLEQGVRDSILKMIKKREEEASEMDS  280

Query  492  ---------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                     + ANQ+   + KISI+++ DECK F   G+  T SLL W +  L+   + Q
Sbjct  281  YGSDYLGVLIKANQDPDKTKKISIDDLVDECKTFYIAGQETTLSLLTWTIFLLAIHTDWQ  340

Query  645  ERARKEVIQMFGSENPNPDGIARLKIVD  728
            E+ARKEV+++FG  +P  D I +LKI++
Sbjct  341  EKARKEVLELFGPRSPTSDEINKLKIMN  368



>ref|XP_010041049.1| PREDICTED: cytochrome P450 734A1-like [Eucalyptus grandis]
Length=824

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S  M+++ W   + ++VE+F+ FT I S++IS+ + GS+ +E +NIF 
Sbjct  406  ESLKCMIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGRNIFR  465

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I K + ++DSE+L                        
Sbjct  466  MLGELTTIASQNHFKLRLPEVRKIWKTSDEIDSERLEKAIRDAVLEIIKKREEKVNTGEM  525

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +   S +I+I++V DECK F + G+  T S+L W +  L+  K+
Sbjct  526  NDYGNDFLGSLLKAYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTLFLLAIHKD  585

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q+ ARKEV  +FG+E+PN DG+ +LK V
Sbjct  586  WQQEARKEVTNVFGNEDPNHDGMMKLKTV  614


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 95/205 (46%), Gaps = 54/205 (26%)
 Frame = +3

Query  276  MFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF------  437
            M   M+ S  M+++ W   + K+VE+F+ FT I+SE+IS+ + GS+ +E ++IF      
Sbjct  1    MIPAMVDSVHMLLKRWQNLETKEVELFEEFTAISSEVISRTAFGSSYIEGRDIFQMLGEL  60

Query  438  -------------PGTGGIVKKNGDMDSEKL-----------------------------  491
                         PG   I K + ++ S +L                             
Sbjct  61   AIIVSRNLFKLRLPGISKIWKTSDEIKSNQLEKAIRDVVLGIIDKREKKLNAGEIDDYGN  120

Query  492  ------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
                  L A  +   S +I+I ++ DECK F   G+  T S+L W    L+  K+ QE A
Sbjct  121  DFLGSLLKAYHDPDESKRITINDLVDECKTFYLAGQETTNSILTWTFFLLAIHKDWQEEA  180

Query  654  RKEVIQMFGSENPNPDGIARLKIVD  728
            RKEV  +FG E+PN +GI +LK V+
Sbjct  181  RKEVADVFGDEDPNHEGIMKLKTVE  205



>gb|KHG09430.1| Secologanin synthase [Gossypium arboreum]
Length=363

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 98/204 (48%), Gaps = 53/204 (26%)
 Frame = +3

Query  273  GMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE----------  422
            G    +I S E ++E W   +GK++EVFQ F L+ SE+IS+ + GSN LE          
Sbjct  15   GKLKAVIASAETMLEKWKGQEGKEIEVFQEFRLLTSEVISRTAFGSNYLEGEKILSMLKE  74

Query  423  --------------------------------AKNIFPGTGGIVKKNGDM----------  476
                                            AK I      IVKK  D           
Sbjct  75   LSVIMSRNNFKTRIPLINKLWKPADMLRSEKLAKGIQDCVMKIVKKREDRVKKGEADSFG  134

Query  477  -DSEKLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
             D   LLV +  SK+++ +S+E++ DECK F + G+    SLL W V  L+   + QE+A
Sbjct  135  NDFLGLLVNSYHSKDNNSLSMEDLVDECKTFYFAGQGTINSLLAWIVLLLATHGDWQEKA  194

Query  654  RKEVIQMFGSENPNPDGIARLKIV  725
            R+EVI +FG+ NP+ +GI++LKI+
Sbjct  195  RREVINVFGNRNPDSEGISKLKII  218



>gb|KJB28189.1| hypothetical protein B456_005G033300 [Gossypium raimondii]
Length=512

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 104/209 (50%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   +I S E ++E W   +GK++EV+Q F L+ SE+IS+ + GSN +E + IF 
Sbjct  159  ESLKNMTPAIIASVETMLEKWKGQEGKEIEVYQEFRLLTSEVISRTAFGSNYMEGEKIFA  218

Query  441  ------------------------------------------GTGGIVKK------NGDM  476
                                                          IVKK      NG++
Sbjct  219  ILRKLTVIMSRNLSKTRIPLISKLWKSADLLESEKLSKEIKDRVMKIVKKREDKVVNGEV  278

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            +S +      LL A  +S   +++S+E+V  ECK F + G+    SLL W V  L+   +
Sbjct  279  NSFRSDFLGLLLNAYHDSDAKNRLSLEDVVAECKTFYFAGQETVNSLLAWIVLHLAIHGD  338

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EV+ +FG++NP+ +GIA+LKI+
Sbjct  339  WQEKARREVVDIFGNQNPHLEGIAKLKIM  367



>gb|KHG09815.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 104/209 (50%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   +I S E ++E W   +GK++EV+Q F L+ SE+IS+ + GSN +E + IF 
Sbjct  163  ESLKNMTPAIIASVETMLEKWNAQEGKEIEVYQEFRLLTSEVISRTAFGSNYMEGEKIFA  222

Query  441  GTGG------------------------------------------IVKK------NGDM  476
                                                          IVKK      NG++
Sbjct  223  MLSKLAVIMSRNFSKTRIPLISKLWKSADLLESEKLSKEIKDRVLKIVKKREDKVVNGEV  282

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            +S +      LL A  +S   +++S+E++  ECK F + G+    SLL W V  L+   +
Sbjct  283  NSFRSDFLGLLLNAYHDSDEKNRLSLEDLVAECKTFYFAGQETVNSLLAWIVLHLAIHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI +FG++NP+ +GIA+LKI+
Sbjct  343  WQEKARREVIDIFGNQNPHLEGIAKLKIM  371



>gb|KHG16086.1| Secologanin synthase [Gossypium arboreum]
Length=348

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 99/203 (49%), Gaps = 53/203 (26%)
 Frame = +3

Query  276  MFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE-----------  422
            M   +I S E ++E W   +GK++EVFQ F L+ SE+IS+ + GSN LE           
Sbjct  1    MIPAVIASAETMLEKWKGQEGKEIEVFQEFRLLTSEVISRTAFGSNYLEGEKILSMLKEL  60

Query  423  -------------------------------AKNIFPGTGGIVKKNGDM-----------  476
                                           AK I      IVKK  D            
Sbjct  61   SVIMSRNNFKTRIPLINKLWKPADMLRSEKLAKGIQDCVMKIVKKREDRVKKGEADSFGN  120

Query  477  DSEKLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERAR  656
            D   LLV +  SK+++ +S+E++ DECK F + G+    SLL W V  L+   + QE+AR
Sbjct  121  DFLGLLVNSYHSKDNNSLSMEDLVDECKTFYFAGQDTVNSLLAWMVLLLASQGDWQEKAR  180

Query  657  KEVIQMFGSENPNPDGIARLKIV  725
            +EVI++FG++ PN +G+++LKI+
Sbjct  181  REVIEIFGNQYPNSEGLSKLKIM  203



>gb|KJB28188.1| hypothetical protein B456_005G033200 [Gossypium raimondii]
Length=516

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +GK++EV+Q F L+ SE+IS+ + GSN +E + IF 
Sbjct  163  ESLKNMTPAIIASVETMLEKWKGQEGKEIEVYQEFRLLTSEVISRTAFGSNYMEGEKIFA  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    + K    ++SEKL                        
Sbjct  223  ILRKLTVIMSRNLSKTRIPLISKLWKSADLLESEKLSKEIKDRLMKIVKKREDKAVNGEV  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +S   ++IS+E+V  ECK F + G+    SLL W V  L+   +
Sbjct  283  NSFGSDFLGLLLNAYHDSDAKNRISLEDVVAECKTFYFAGQETVNSLLAWIVLHLAIHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI +FG++NP+ +GIA+LKI+
Sbjct  343  WQEKARREVIDIFGNQNPHLEGIAKLKIM  371



>gb|KHG16087.1| Secologanin synthase [Gossypium arboreum]
Length=363

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 99/204 (49%), Gaps = 53/204 (26%)
 Frame = +3

Query  273  GMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE----------  422
            G    +I S E ++E W   +GK++EVFQ F L+ SE+IS+ + GSN LE          
Sbjct  15   GKLKAVIASAETMLEKWKGQEGKEIEVFQEFRLLTSEVISRTAFGSNYLEGEKILSMLKE  74

Query  423  --------------------------------AKNIFPGTGGIVKKNGDM----------  476
                                            AK I      IVKK  D           
Sbjct  75   LSVIMSRNNFKTRIPLINKLWKPADMLRSEKLAKGIQDCVMKIVKKREDRVKKGEADSFG  134

Query  477  -DSEKLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
             D   LLV +  SK+++ +S+E++ DECK F + G+    SLL W V  L+   + QE+A
Sbjct  135  NDFLGLLVNSYHSKDNNSLSMEDLVDECKTFYFAGQDTVNSLLAWMVLLLASQGDWQEKA  194

Query  654  RKEVIQMFGSENPNPDGIARLKIV  725
            R+EVI++FG++ PN +G+++LKI+
Sbjct  195  RREVIEIFGNQYPNSEGLSKLKIM  218



>gb|EYU22576.1| hypothetical protein MIMGU_mgv1a004757mg [Erythranthe guttata]
Length=511

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 102/205 (50%), Gaps = 49/205 (24%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M  S   ++E W  Y+G +++VF+ F L+ +E+IS+ + GS+ LE K+IF 
Sbjct  167  ESLKSMVPEMSYSVSKMLEKWKNYEGIEIDVFKEFGLLTTEVISRTAFGSSYLEGKHIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL-----------------LVAN---  503
                              PG   I+K + ++++++L                 LV N   
Sbjct  227  MVANLTAITVRNVYKVKVPGISMILKSDDEIEADRLEKKIKSSILEIARKRGELVENIGS  286

Query  504  ----------QesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
                       ES    +I++E++ DE KA    G + TTSLLGW V  L+ +   QE+A
Sbjct  287  DYLGQLVKISNESDLKKRITVEQMIDEIKAVYGAGHLTTTSLLGWCVFLLALNTEWQEKA  346

Query  654  RKEVIQMFGSENPNPDGIARLKIVD  728
            R EV + FG   P+ DGIARLKI++
Sbjct  347  RDEVKRTFGDNKPDSDGIARLKIMN  371



>ref|XP_010091618.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44884.1| Cytochrome P450 734A1 [Morus notabilis]
Length=554

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 92/210 (44%), Gaps = 55/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   MI   E ++E W   +GK++EV++ F  + SE+IS+ + GS+ LE KNIF 
Sbjct  160  ESLKRMIPAMIEGVESMLERWKHLEGKEIEVYEEFRFLMSEVISRTAFGSSYLEGKNIFE  219

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    + K    ++SE+L                        
Sbjct  220  MLMKLALLASRNFYEQTFPVISTVFKTEDQIESERLEKRLRESIVGLIKKREEKVVISGE  279

Query  492  ------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                        + A  +   + + S+++V DECK F + G+  T SLL W V  L+   
Sbjct  280  EDNFGSDFLGLLVKARHDVNENQRFSVDDVVDECKTFYFTGQETTNSLLAWTVLLLAIHT  339

Query  636  NLQERARKEVIQMFGSENPNPDGIARLKIV  725
              QE ARKEV  + G +NP PD + +LK V
Sbjct  340  EWQEEARKEVNNLLGKQNPKPDDLIQLKTV  369



>ref|XP_010044379.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86464.1| hypothetical protein EUGRSUZ_B03132 [Eucalyptus grandis]
Length=515

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/280 (27%), Positives = 127/280 (45%), Gaps = 79/280 (28%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAFGAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTSQTT  227
            +N + T P  G      +    G VS +    WA  ++L+N                   
Sbjct  120  INRDKTFPKIGPRSFAKYLLGDGLVSTIDGVKWAKKRRLANH------------------  161

Query  228  DLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLG  407
               G       +SL  M   M+ S  +++E W + +G+++EVF+ F L+ SE+IS+ + G
Sbjct  162  TFHG-------ESLKNMVPAMVDSAHVMLEKWKQQEGEEIEVFEEFKLLTSEVISRTAFG  214

Query  408  SNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL-------------  491
            S+ +E +NIF                   PG   I K   ++++EKL             
Sbjct  215  SSYVEGRNIFEMLTNLGLLVSRNALRMRFPGISKIWKTADEIEAEKLKKGIHVAILEIAK  274

Query  492  ----------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLG  605
                                  + A +++  S KI+++++ DECK F + G+  TT++L 
Sbjct  275  KREKKVMAGEADDYGNDFLGQLVKAYRDNDESKKITVDDLVDECKTFYFAGQETTTAMLT  334

Query  606  WAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            W +  L+   + QE ARKEVI +FG+E+PN DGIA+L+++
Sbjct  335  WVIFLLAVHSDWQEEARKEVIDVFGNEDPNSDGIAKLRMI  374



>ref|XP_008374265.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=527

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  +F  M+ S E ++E W  Y+ K++EVF+ F L+ SE+IS+ + GS+ LE +NIF 
Sbjct  168  ECLKSLFPDMVASAETMLERWRNYEEKEIEVFEEFRLLTSEVISRTAFGSSYLEGQNIFE  227

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++++EKL                        
Sbjct  228  MLMKLAFLVSKNALKVRIPGISKFFKTSDEIEAEKLEKGVYASIMXIXKKREKTATSGDE  287

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  ++ +  +IS++++ DECK F + G+  T +LL W V  L+   N
Sbjct  288  DSFGSDFLGLLLKARHDANDDQRISVDDLVDECKTFYFAGQETTNTLLXWTVFLLALHTN  347

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVI++FG + PN DGI +LK
Sbjct  348  WQEEARKEVIELFGKQTPNLDGITKLK  374



>ref|XP_008364583.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  +F  M+ S E ++E W  Y+ K++EVF+ F L+ SE+IS+ + GS+ LE +NIF 
Sbjct  168  ECLKSLFPDMVASAETMLERWRNYEEKEIEVFEEFRLLTSEVISRTAFGSSYLEGQNIFE  227

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + ++++EKL                        
Sbjct  228  MLMKLAFLVSKNALKVRIPGISKFFKTSDEIEAEKLEKGVYASIMEIVKKREKTATSGDE  287

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  ++ +  +IS++++ DECK F + G+  T +LL W V  L+   N
Sbjct  288  DSFGSDFLGLLLKARHDANDDQRISVDDLVDECKTFYFAGQETTNTLLXWTVFLLALHTN  347

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEVI++FG + PN DGI +LK
Sbjct  348  WQEEARKEVIELFGKQTPNLDGITKLK  374



>ref|XP_009346500.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  MF  M+ S E ++E W  Y+ K++EVF+ F L  SE+IS+ + GS+ LE +NIF 
Sbjct  167  ECLKSMFPDMVASAETMLERWRNYEEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K + ++++EKL                        
Sbjct  227  MMMKLAFLLSKNALTVRIPGISKIFKTSDEIEAEKLEKGVYASIMDIAKKREKTAMSGDE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  ++ +  +IS++++ DECK F   G+  T +LL W V  L+   N
Sbjct  287  DSFGSDFFGLLLKARHDAIDGQRISVDDLVDECKTFYIAGQETTNTLLAWTVFLLALHTN  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE ARKEV+++FG + PN DGI +LK
Sbjct  347  WQEEARKEVMELFGKQTPNLDGITKLK  373



>gb|KJB80431.1| hypothetical protein B456_013G097000 [Gossypium raimondii]
Length=543

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            ++L  M   +I S E ++E W   +GK++EVF  F L+ SE+IS+ + GS+ L+ + IF 
Sbjct  173  ETLKSMTPAVIASVETMLERWKLLEGKEIEVFGEFRLLTSEVISRTAFGSSYLDGEKIFD  232

Query  441  ------------------------------------------GTGGIVKK------NGDM  476
                                                          IVKK      NGD 
Sbjct  233  MLMKLSVITNRNMFKARFLVISKFWKSADQIEADKLEKEIHNCVMKIVKKREEKVANGDA  292

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            +S        LL A  ++   ++IS +++ DECK F + G+  T S L W V  L+    
Sbjct  293  NSFGTDFLGLLLNAYHDTDKKNRISQQDLVDECKTFYFAGQETTNSSLAWTVLLLAIHPE  352

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++NPNP+GI +LKI+
Sbjct  353  WQEKARQEVIKIFGNQNPNPEGIGKLKIM  381



>gb|KHG14937.1| Cytochrome P450 protein [Gossypium arboreum]
Length=501

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 102/192 (53%), Gaps = 39/192 (20%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E +++ W   +GK++EVF  F L+ SE+IS+ + GS+ LE      
Sbjct  163  ESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVISRTAFGSSYLEGEKIWL  222

Query  423  ---------------------AKNIFPGTGGIVKK------NGDMDS-----EKLLV-AN  503
                                 AK I      IVKK      NG+ DS       LLV A 
Sbjct  223  TLVFSSSKLWKPADMLESEELAKEIQDCVMKIVKKREDKVVNGEADSFGNDFLGLLVNAY  282

Query  504  QesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGS  683
             +S  ++K+S+E++ DECK F + G+    +LL W V  L+   + Q++AR+EVI +FG+
Sbjct  283  HDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWTVLLLAIHGDWQDKARREVIGIFGN  342

Query  684  ENPNPDGIARLK  719
            +NP P+GIA+LK
Sbjct  343  QNPQPEGIAKLK  354



>gb|KJB28185.1| hypothetical protein B456_005G032800 [Gossypium raimondii]
Length=515

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 101/208 (49%), Gaps = 53/208 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E ++E W   +GK++EVFQ F L+ SE+IS+ + GSN LE      
Sbjct  163  ESLKNMTPAVIASVETMLEKWKGQEGKEIEVFQEFRLLTSEVISRTAFGSNYLEGEKILS  222

Query  423  ------------------------------------AKNIFPGTGGIVKKNGDM------  476
                                                AK I      IVKK  D       
Sbjct  223  MLKELSVIMSRNNFKTRIPLINKLWKPADMLRSEELAKGIQDCVMKIVKKREDKFKKGEA  282

Query  477  -----DSEKLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                 D   LLV +  SK+++ +S+E++ DECK F + G+    SLL W V  L+   + 
Sbjct  283  DSFGNDFLGLLVNSYHSKDNNSLSMEDLVDECKTFYFAGQGTINSLLAWIVLLLATHGDW  342

Query  642  QERARKEVIQMFGSENPNPDGIARLKIV  725
            QE+AR+EVI +FG+ NP+ +GI++LKI+
Sbjct  343  QEKARREVIDIFGNRNPDSEGISKLKIM  370



>ref|XP_012068356.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=503

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 98/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            + L GM   MI S EM+++ W      +++ FQ F ++ SE+IS+ + GS+ LE +NIF 
Sbjct  147  ECLKGMIPAMIASVEMMLQRWKICGCMEIDAFQEFKVLTSEIISRTAFGSSYLEGQNIFD  206

Query  441  GT---GGIVKKNG-------------DMDSEKL---------------------------  491
                 G I+ +N              D++SEKL                           
Sbjct  207  KLMRLGVIISRNKYKVKVPGIRYTVYDIESEKLEQGIQNSIISMIKKREQATITEKSDSF  266

Query  492  --------LVANQesknsskisieeVAD---ECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                    L A+ + +++ K     V D   ECK F   G   TTS L W V  L+   +
Sbjct  267  GNDFLGLLLKAHHDDRDAHKTKRLSVQDIIDECKTFYVAGHETTTSSLSWIVFLLAVHTD  326

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR E++Q+F  +NP+PDG++R+KIV
Sbjct  327  WQDKARNEILQLFDLQNPSPDGLSRMKIV  355



>gb|KDP41344.1| hypothetical protein JCGZ_15751 [Jatropha curcas]
Length=430

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  270  NGMFT--GMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF--  437
            +G+ T   MI S EM++  W + + K+++V++ F L+ SE+IS+ + GS+ LE ++IF  
Sbjct  79   DGLVTTKAMITSVEMMLRRWRQNEHKEIDVWKEFKLLTSEVISRTAFGSSYLEGQHIFDM  138

Query  438  -----------------PGTGGIVKKNGDMDSEKL-------------------------  491
                             P     +K   D+ SEKL                         
Sbjct  139  LMELVLLLSKNGYEVRIPIIKKFIKTKDDIKSEKLEQGVRDSILKMIKKREEEASEMDSY  198

Query  492  --------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQE  647
                    + ANQ+   + KISI+++ DECK F   G+  T SLL W +  L+   + QE
Sbjct  199  GSDYLGVLIKANQDPDKTKKISIDDLVDECKTFYIAGQETTLSLLTWTIFLLAIHTDWQE  258

Query  648  RARKEVIQMFGSENPNPDGIARLKIVD  728
            +ARKEV+++FG  +P  D I +LKI++
Sbjct  259  KARKEVLELFGPRSPTSDEINKLKIMN  285



>emb|CDP00470.1| unnamed protein product [Coffea canephora]
Length=515

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 106/209 (51%), Gaps = 53/209 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M  S E+++E W  ++GK+++ F+ F L+ +E+I++ + GS+  E K+IF 
Sbjct  166  ESLKRMVPEMSASVEVMLENWKHHEGKEIDAFKEFGLLTTEVIARTAFGSSYREGKHIFE  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   ++K + ++++EKL                        
Sbjct  226  MVAKLTAIDVRNVYKVKFPGISMLMKSSDEIEAEKLERGIKTSILELVKKREKGRKGETE  285

Query  492  ----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                      +   +++  + +I++E++ DE KA    G + TT+LLGW    LS   + 
Sbjct  286  DNAIDYLGELMKLTRDTNINKRITLEQMIDEIKALFGAGHLTTTNLLGWCAFVLSVHGDW  345

Query  642  QERARKEVIQMFGSENPNPDGIARLKIVD  728
            QE+ARKEV ++FG++NP+ DGIARLK ++
Sbjct  346  QEKARKEVFEIFGNKNPSSDGIARLKTMN  374



>gb|KHG20729.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=936

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 101/192 (53%), Gaps = 39/192 (20%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E +++ W   +GK++EVF  F L+ SE+IS+ + GS+ LE      
Sbjct  127  ESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVISRTAFGSSYLEGEKIWL  186

Query  423  ---------------------AKNIFPGTGGIVKK------NGDMDSEK------LLVAN  503
                                 AK I      IVKK      NG+ DS        L+ A 
Sbjct  187  TLVFSSSKLWKPADMLESEELAKEIQDCVMKIVKKREDKVVNGEADSFGNDFLGLLVNAY  246

Query  504  QesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGS  683
             +S  ++K+S+E++ DECK F + G+    +LL W V  L+   + Q++AR+EVI +FG+
Sbjct  247  HDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWTVLLLAIHGDWQDKARREVIGIFGN  306

Query  684  ENPNPDGIARLK  719
            +NP P+GIA+LK
Sbjct  307  QNPQPEGIAKLK  318


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   +I S E ++E W  Y GK++EV+  F L+ SE+IS+ + GS+ LE + IF 
Sbjct  583  ESLKNMTPAVIASVETMLEKWKGYVGKEIEVYHEFRLLTSEVISRTAFGSSYLEGEKIFD  642

Query  441  GTGG------------------------------------------IVKK------NGDM  476
                                                          IVKK      NG++
Sbjct  643  MLNKLSIIRSRNFFETRIPLINKFWKSGDVLESEELSKGIQDCVMKIVKKREDKVVNGEV  702

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +S  ++++S E++ DECK F + G+    SL+ W V  L+   +
Sbjct  703  DSFGNDFLGLLVNAYHDSDENNRLSTEDLVDECKTFYFAGQDTVNSLIAWIVFLLAIHGD  762

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++ PN + +++LKI+
Sbjct  763  WQEKARREVIEIFGNQIPNSEEMSKLKIM  791



>ref|XP_004298349.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=506

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 97/207 (47%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL  MF  MI S E +VE W  ++G ++EVF+ F L+ SE+IS+ + GS+ LE K I  
Sbjct  157  ESLRNMFPDMIASAEAMVERWKHHEGNEIEVFEEFRLLTSEVISRTAFGSSYLEGKKIFE  216

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + + + D++SEK                         
Sbjct  217  MLMRLSSIIVRNLFGIRFPGMSKLFRTSDDIESEKVEKGIRNSIMEIVKKREKEAKAGEE  276

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+  + +   IS++E+ +ECK F + G+  T +LL W    L+    
Sbjct  277  DSFGKDFLGLLLKAHHATNDKQMISVDELLEECKTFYFAGQETTNTLLAWTTLLLALHPE  336

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE AR EV+Q FG E P  DGIA+LK
Sbjct  337  WQEEARNEVLQFFGKEPPTYDGIAKLK  363



>gb|KHG06141.1| Cytochrome P450 protein [Gossypium arboreum]
 gb|KHG27970.1| Cytochrome P450 protein [Gossypium arboreum]
Length=522

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEA-----  425
            ++L  M   +I S E ++E W  ++GK++EVF  F L+ SE+IS+ + GS+ L+      
Sbjct  173  ETLKSMSPAVIASVETMLERWKLFEGKEIEVFGEFRLLTSEVISRIAFGSSYLDGEKIFD  232

Query  426  ----------KNIFPGTGGIVKK---------------------------------NGDM  476
                      +N+F     ++ K                                 NG  
Sbjct  233  MLMKLSVITNRNMFKAKLPVISKFWKSADQIEADKLEKEIHNCVMKIVKKREEKVANGGA  292

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            +S        LL A  ++   + IS +++ DECK F + G+  T S L W V  L+    
Sbjct  293  NSSGTDFLGLLLNAYHDTDKKNSISQQDLVDECKTFYFAGQETTNSSLAWTVLLLAVHPE  352

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++NPNP+GI +LKI+
Sbjct  353  WQEKARQEVIKIFGNQNPNPEGIGKLKIM  381



>ref|XP_009356544.1| PREDICTED: uncharacterized protein LOC103947365 [Pyrus x bretschneideri]
Length=1141

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 98/208 (47%), Gaps = 55/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+   E ++E W  ++GK++EVF+   L  SE+I+K + GSN  E +NIF 
Sbjct  163  ESLKSMIPTMVACTETMLERWKNHEGKEIEVFEELRLFTSEVIAKTAFGSNHGEGQNIFE  222

Query  438  ------------------PGTGGIVKKNGD-MDSEK------------------------  488
                              PG    + K  D  ++E+                        
Sbjct  223  MLMKLFFIALKNIFTIRPPGMMSKLYKTSDEAEAERIEKRMHKSLFEIIKRREEKATSGN  282

Query  489  -----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDK  635
                       LL A+ ++    +IS++++ DECK F + G+  T   L W V  L+   
Sbjct  283  NDGFGSDYLGLLLKAHHDANEKERISVDDMIDECKTFYFAGQETTNIELAWIVFLLAVHT  342

Query  636  NLQERARKEVIQMFGSENPNPDGIARLK  719
            + QE ARKEV+++FG +NP+P+G+A+LK
Sbjct  343  DWQEEARKEVLELFGKQNPSPEGVAKLK  370


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL  M + MI S E ++E W  ++G++VEVF+ F L+ SE+IS+ + GS+ +E KNI  
Sbjct  791  ESLKSMHSEMIASTETMLERWKIHEGEEVEVFEEFRLLTSEVISRTAFGSSYVEGKNIFD  850

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG    VK + +++ +K                         
Sbjct  851  MLLKSSALTFSSSFKPGFPGISKFVKSSSEIEFQKLEKGIRDSLMEIVRRRERNPINREA  910

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+ ++ ++ +IS+E++ DECK F   G  +T ++L W V  L+    
Sbjct  911  NKFGSDFLGQLLRAHHDTNDNQRISMEDLVDECKTFYLAGHESTGTMLAWTVFLLALHPE  970

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+ARKEV Q FG   P+P+GI+ LK
Sbjct  971  WQEKARKEVQQFFGKRTPDPNGISNLK  997



>gb|AJD25260.1| cytochrome P450 CYP749A38 [Salvia miltiorrhiza]
Length=508

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 101/205 (49%), Gaps = 52/205 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   MI S E +++ W +Y G++++V +   +++SE+I++ + GS+ LE KNIF 
Sbjct  159  ESLKEMIPSMIASVETMLQKWRQYQGREMDVCEELKVMSSEVIARTAFGSSYLEGKNIFD  218

Query  441  -----------------GTGGIVKKNGDMDSEK---------------------------  488
                               G I K   D++S++                           
Sbjct  219  MLTKLGFLLFKNIDKIRPFGMIWKTRDDVESDEIEQSLRDTAMSIVRKREERVVAGEAED  278

Query  489  --------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                    LL A+ +S   S+ISI++V DECK F   G   T+SLL W +  L+   + Q
Sbjct  279  YGTDFLGALLKAHHDSDKKSRISIDDVIDECKVFFLAGHETTSSLLSWTIFLLAIHTDWQ  338

Query  645  ERARKEVIQMFGSENPNPDGIARLK  719
            E+AR+EV+++FG +NP  +G+ RLK
Sbjct  339  EKARQEVLELFGDQNPTAEGLPRLK  363



>gb|KCW86463.1| hypothetical protein EUGRSUZ_B03131 [Eucalyptus grandis]
Length=512

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ +  +++  W   +GK+++VF+ F L+  E+ISK + GS+ +E +NIF 
Sbjct  163  ESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDFKLLTCEVISKTAFGSSYIEGRNIFQ  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K   ++++EKL                        
Sbjct  223  MLTRLGVLLTKNLHHVRFPGLSKFWKTADEIEAEKLQKGIYDAILGIVKKREEKVKTGEA  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A++   NS KI+I+++ DECK F   G+  T +L+ W V  L+   N
Sbjct  283  ADVGNDFLGQLVKASRGMDNSKKITIDDLVDECKTFYLAGQETTNALMTWVVFLLAAHPN  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+ARKEV+ +FG+ +P+ DGIA+LK
Sbjct  343  WQEKARKEVLHVFGNNDPDSDGIAKLK  369



>ref|XP_010044378.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X2 [Eucalyptus 
grandis]
Length=556

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ +  +++  W   +GK+++VF+ F L+  E+ISK + GS+ +E +NIF 
Sbjct  207  ESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDFKLLTCEVISKTAFGSSYIEGRNIFQ  266

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K   ++++EKL                        
Sbjct  267  MLTRLGVLLTKNLHHVRFPGLSKFWKTADEIEAEKLQKGIYDAILGIVKKREEKVKTGEA  326

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A++   NS KI+I+++ DECK F   G+  T +L+ W V  L+   N
Sbjct  327  ADVGNDFLGQLVKASRGMDNSKKITIDDLVDECKTFYLAGQETTNALMTWVVFLLAAHPN  386

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+ARKEV+ +FG+ +P+ DGIA+LK
Sbjct  387  WQEKARKEVLHVFGNNDPDSDGIAKLK  413



>gb|KJB10709.1| hypothetical protein B456_001G217300 [Gossypium raimondii]
Length=519

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 99/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            ++L  M   MI S E++++ W KY  K++EV + F L+ S++IS+ + GSN LE K I  
Sbjct  163  ENLGKMIPEMIVSVELMLQSWKKYQAKEIEVSEEFRLLTSDIISRTAFGSNYLEGKTIFD  222

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   I K + +++ +K                         
Sbjct  223  MMTKYSNIIRRNIFKPRFPGLSKIWKTSDEIEGDKLLGVMHNSVMEIIKKREEKVKLGDI  282

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A  +   + +I ++++ DECK F   G+    SLL W V  L+   +
Sbjct  283  DCYGTDFLGLLLKAYHDVDENKRILVQDLIDECKTFYIAGQETINSLLSWTVLLLAIHTD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EVI++FG +NP+P+ +++L  +
Sbjct  343  WQDKAREEVIELFGHQNPHPNDLSKLHTI  371



>gb|KHG18356.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E +++ W   +G++ EVFQ F ++ SE+IS+ + GS+ LE + IF 
Sbjct  166  ESLKNMTPAVIASVETMLDKWKDKEGEETEVFQEFRMLTSEVISRTAFGSSYLEGEKIFY  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P      K + D+ SEKL                        
Sbjct  226  MLKKLADIVSRNSNKSRIPILSKFWKTDDDVGSEKLAREIKDLVIEIVKKRENKVASGEA  285

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A       +KIS+E++ DECK F + G+    +LL WAV  L+   +
Sbjct  286  ESFGSDFLGLLVKAFNNPDEKNKISMEDLVDECKTFYFAGQETVNALLAWAVLVLAIHSD  345

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EV+++FGS+NP+ +G+A+LKI+
Sbjct  346  WQDKARREVMEIFGSQNPHSEGLAKLKIM  374



>ref|XP_010046255.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=413

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 89/167 (53%), Gaps = 17/167 (10%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL GM   M+ S   +++ W K + K+VE+F+      S+ I    L       K I  
Sbjct  113  ESLKGMIPAMVDSVHALLDRWQKLEAKEVEIFEEKIWKTSDEIKSERL------EKAICD  166

Query  441  GTGGIVKKN-----GDMDSE------KLLVANQesknsskisieeVADECKAFCYVGRVA  587
               GI+KK      G+MD         LL A  +   S +I+++++ DECK F + G+  
Sbjct  167  ALLGIIKKREEKAKGEMDDYGNDYLGSLLKAYHDPDKSKRITMDDLRDECKTFHFAGQET  226

Query  588  TTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIVD  728
            TTS+L W +  L+  K+ QE ARKEV  +F +E+PN +GI +LK VD
Sbjct  227  TTSILTWTLFLLAIHKDWQEEARKEVTDVFDNEDPNHEGIIKLKTVD  273



>gb|KCW44812.1| hypothetical protein EUGRSUZ_L01624 [Eucalyptus grandis]
Length=460

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 85/161 (53%), Gaps = 15/161 (9%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL GM    + S   ++E W K + K+VE+F+ F  I S+ I  A  G      +N+  
Sbjct  150  ESLKGMIPATVDSVHTLLERWQKLEAKEVELFKEFATITSDAIHYAVFGIIEKRKENV--  207

Query  441  GTGGIVKKNGDMDSE------KLLVANQesknsskisieeVADECKAFCYVGRVATTSLL  602
                   K G+MD         LL A  +   S +I+I+++ DECK F + G+  T S  
Sbjct  208  -------KTGEMDDYGNDFLGSLLKAYHDPDKSKRITIDDLVDECKTFYFAGQETTNSTP  260

Query  603  GWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
             W +  L+  K+ QE ARKEV  +FG+E+PN +GI +LK V
Sbjct  261  TWTLFLLAIHKDWQEEARKEVTDVFGNEDPNHEGIMKLKTV  301



>ref|XP_009762791.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana sylvestris]
Length=515

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 124/281 (44%), Gaps = 83/281 (30%)
 Frame = +3

Query  51   NMNSTAPNSGMDRMEGFAKAFGAVSDVASTA--WAYAKQLSNSPVLQPKLNILGVQTSQT  224
            N   T P   MD MEG+AK     + + +    WA  ++L+N                  
Sbjct  123  NKEDTYPK--MD-MEGYAKKLLGEALITNEGEKWAKVRKLANH-----------------  162

Query  225  TDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASL  404
                    T   +SL  M   M  S + ++E W K++GK+ +VF+ F L+ +E+IS+ + 
Sbjct  163  --------TFHAESLKHMVPEMSASVQTMLEKWKKHEGKEFDVFKDFGLLTTEVISRTAF  214

Query  405  GSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL----------LV  497
            GS+ +E K+IF                   PG   +++ N ++++EKL          LV
Sbjct  215  GSSYMEGKHIFEMVAKLTAITVKNIYNVRFPGIIMLIRTNDEIEAEKLERGIKSSILELV  274

Query  498  ANQesk------------------------nsskisieeVADECKAFCYVGRVATTSLLG  605
              +E                           +  I+I+++ DE KA    G + TTSLLG
Sbjct  275  RKREKVKDRTFENFGTDYLGQLMKLLHESDMNKSITIDQMIDEVKALFGAGHLTTTSLLG  334

Query  606  WAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIVD  728
            W+V  L+     QE+ARKEV++  G +NP  D I RL+ ++
Sbjct  335  WSVFLLAHHPEWQEKARKEVLEFCGLKNPTSDAITRLRTMN  375



>ref|XP_002325324.2| hypothetical protein POPTR_0019s03160g [Populus trichocarpa]
 gb|EEE99705.2| hypothetical protein POPTR_0019s03160g [Populus trichocarpa]
Length=519

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +S+ GM   MI S E+++E W  +  K++++F  F ++ SE+IS+ S GS+ LE +++F 
Sbjct  163  ESIKGMVPEMIASLEIMLERWRHHHSKEIDIFVEFKILTSEVISRTSFGSSYLEGQHVFD  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG G  VK + D++ E L                        
Sbjct  223  MLTRMTHIISENNYRVRIPGIGKFVKASYDIEFENLEAKIRKSFMNMMKRREKDATLGEL  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +S  + KIS++++ D+CK F   G+  + S L W V  L+   +
Sbjct  283  DGYGHDLFGLLLKAYHDSDETKKISLDDLIDQCKNFYLAGQETSASALTWIVFLLAVHSD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++ARKEV+++FG + P+ D IA+LKI+
Sbjct  343  WQDKARKEVLELFGLQIPSQDRIAKLKIM  371



>gb|KHG16899.1| Secologanin synthase [Gossypium arboreum]
Length=512

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 103/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL  M   +I S E ++E W   +G+++EV Q F L+ SE+IS+ + GS+ LE + IF 
Sbjct  159  ESLKNMTPAIIASVETMLEKWKGQEGREIEVLQEFRLLTSEVISRTAFGSSYLEGEKIFA  218

Query  441  ------------------------------------------GTGGIVKK------NGDM  476
                                                          IVKK      NG++
Sbjct  219  MLQKLTIIMSRNLFKSRIPLISKLWKSADLLESEKLSKEIKDRVLKIVKKREDKVVNGEV  278

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            +S +      LL A  +S   +++S+E++  ECK F + G+    SLL W V  L+   +
Sbjct  279  NSFRSDFLGLLLNAYHDSDEKNRLSLEDLVAECKTFYFAGQETVNSLLAWIVLHLAIHGD  338

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI +FG++NP+ +GIA+LKI+
Sbjct  339  WQEKARREVIDIFGNQNPHLEGIAKLKIM  367



>ref|XP_006388777.1| hypothetical protein POPTR_0102s00210g [Populus trichocarpa]
 gb|ERP47691.1| hypothetical protein POPTR_0102s00210g [Populus trichocarpa]
Length=517

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +S+ GM   MI S E+++E W  +  K++++F  F ++ SE+IS+ S GS+ LE +++F 
Sbjct  163  ESIKGMVPEMIASLEIMLERWRHHHSKEIDIFVEFKILTSEVISRTSFGSSYLEGQHVFD  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG G  VK + D++ E L                        
Sbjct  223  MLTRMTHIISENNYRVRIPGIGKFVKASYDIEFENLEAKIRKSFMNMMKRREKDAMSGEL  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  +S  + KIS++++ D+CK F   G+  + S L W V  L+   +
Sbjct  283  DGYGHDLFGLLLKAYHDSDETRKISLDDLIDQCKNFYLAGQETSASALTWIVFLLAVHSD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++ARKEV+++FG + P+ D IA+LKI+
Sbjct  343  WQDKARKEVLELFGLQIPSQDRIAKLKIM  371



>ref|XP_002512039.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50708.1| cytochrome P450, putative [Ricinus communis]
Length=475

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 102/208 (49%), Gaps = 53/208 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL GM  GMI S EM++E W  +DGK++E ++ F ++ SE+IS+ + GS+ LE ++IF 
Sbjct  127  ESLKGMIPGMIASVEMMLERWNNHDGKEIEAYKEFKILTSEIISRTAFGSSYLEGQHIFD  186

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   +VK   D DS+K                         
Sbjct  187  MLIRLAVIVIRNKYKVRIPGIRNLVKTRDDTDSDKLEQGIHNSFIYMIKKREVAMTDQSG  246

Query  489  ---------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                     LL A  E+  + KI++  + DECK F   G   TTSLL W +  L+     
Sbjct  247  SFRNDFLGSLLKAYHENNMAKKITVANLIDECKTFYVAGHETTTSLLTWILLLLAIHPEW  306

Query  642  QERARKEVIQMFGSENPNPDGIARLKIV  725
            QE+AR+EV+++FGS+  + DG+  LKIV
Sbjct  307  QEKAREEVLEIFGSQRLSSDGLTGLKIV  334



>ref|XP_004298348.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 101/210 (48%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            + L  MF  MI S E +VE W   +GK++EVF+ F L+ SE+IS+ + GS+ +E KNI  
Sbjct  158  ERLKNMFPDMITSAEAMVERWKNNEGKEIEVFEEFRLLTSEVISRTAFGSSYIEGKNIFE  217

Query  435  -----------------FPGTGGIVKKNGDMDSEK-------------------------  488
                             FPG   + + + D++SEK                         
Sbjct  218  MLMKLTSIVSRNLLSIRFPGMSKLFRTSDDIESEKVEKGIRDSIMEIVKKREKEAKAGEE  277

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+  + +  +IS++E+ +ECK F   G+  T +LL W    L+    
Sbjct  278  DCFGKDFLGLLLKAHHATDDKQRISVDELLEECKTFYLAGQGTTNTLLAWTTLLLALHPE  337

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE ARKEV+Q+FG + P  DG+A+LK ++
Sbjct  338  WQEEARKEVLQLFGKQPPTYDGMAKLKTMN  367



>ref|XP_006348799.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=423

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 125/281 (44%), Gaps = 83/281 (30%)
 Frame = +3

Query  51   NMNSTAPNSGMDRMEGFAKAFGAVSDVASTA--WAYAKQLSNSPVLQPKLNILGVQTSQT  224
            N   T P   MD MEG+AK     + + +    WA  ++L+N                  
Sbjct  31   NKEDTYPK--MD-MEGYAKKLLGEALITNEGEKWAKVRKLANH-----------------  70

Query  225  TDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASL  404
                    T   +SL  M   M  S + ++E W +++GK+ +VF+ F L+ +E+IS+ + 
Sbjct  71   --------TFHAESLKRMVPEMSESVQKMLERWKEHEGKEFDVFKDFGLLTTEVISRTAF  122

Query  405  GSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL----------LV  497
            GS+ +E K+IF                   PG   +++ + ++++EKL          LV
Sbjct  123  GSSYMEGKHIFEMVAKLTAITVKNVYTVRFPGISWLIRTDDEIEAEKLERGIKNSILELV  182

Query  498  ANQe------------------------sknsskisieeVADECKAFCYVGRVATTSLLG  605
            + +E                        S  +  I+I+++ DE +     G + TTSLLG
Sbjct  183  SKREKGKDGMSEKFGNDYLGQLMKLLHESDTNKSITIDQMIDEVRTLYGAGHLTTTSLLG  242

Query  606  WAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIVD  728
            W+V  L+     QE+ARKEV+   G ENP  D IARL+ ++
Sbjct  243  WSVFLLALHPEWQEKARKEVVAFCGLENPTSDAIARLRTMN  283



>ref|XP_006437868.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
 gb|ESR51108.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
Length=477

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 90/184 (49%), Gaps = 32/184 (17%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   MI S EM++E W  Y+GK+++ ++ F ++ SE+IS+ + GS+ LE +NIF 
Sbjct  163  ETLKSMIPDMIASVEMMLERWRDYEGKEIDAYKEFKVLTSEIISRTAFGSSYLEGENIFN  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL----------LVANQesknsskis  533
                              P  G +VK   D +S+K+          +V N+E    +   
Sbjct  223  MLTKLAFFISKNEYKVRIPLIGKLVKTRDDTESDKVEQDIRDSVIKIVENREKNVITGEV  282

Query  534  ieeVADECKAFCYVGR---VATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDG  704
                 D   A           T S+L W V  L+   + Q++ARKEV ++FG ++PN D 
Sbjct  283  ASYGDDLLGALMMAYHDVDETTASVLSWTVLLLATHNDWQDKARKEVQELFGQQSPNADN  342

Query  705  IARL  716
            I+RL
Sbjct  343  ISRL  346



>gb|AJD25259.1| cytochrome P450 CYP749A37 [Salvia miltiorrhiza]
Length=508

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 99/204 (49%), Gaps = 48/204 (24%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SLN M   M  S   +++ W  Y G++++VF+ F ++  E+IS+ + GS+C++ K+IF 
Sbjct  165  ESLNSMVPEMRSSVAKMLDKWGSYQGREIDVFKEFGMLTIEVISRTAFGSSCMDGKHIFE  224

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   +V+ + ++++E+L                        
Sbjct  225  MKEKLAALAAKNLHKVRVPGISLVVRSDDEVEAERLEQRINGSIMEKVREREREGELGSD  284

Query  492  -----LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERAR  656
                 +  + ES    +I+  ++ DE KA    G   TTSLLGW V  L+     Q+RAR
Sbjct  285  YLGQLIRISHESDVKKRITRHQLIDEVKAIYGAGNYTTTSLLGWCVVLLATHTEWQDRAR  344

Query  657  KEVIQMFGSENPNPDGIARLKIVD  728
            +EV + FG   P+ +GIARLKI++
Sbjct  345  EEVKETFGGNIPDFEGIARLKIMN  368



>gb|KHG08051.1| Cytochrome P450 protein [Gossypium arboreum]
 gb|KHG14695.1| Cytochrome P450 protein [Gossypium arboreum]
Length=494

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 101/184 (55%), Gaps = 29/184 (16%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   ++ S E ++E W   +GK++EVFQ F L+ SE+IS+ +  S+ LE + IF 
Sbjct  166  ESLKNMIPAVVVSVETMLEKWKGREGKEMEVFQEFKLLTSEVISRTAFSSSYLEGEKIFE  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL----------LVANQesknsskis  533
                              P      K + +++S+KL          +V  +E K ++K+S
Sbjct  226  MLTKLSLIASRNVFKTRLPIISRFWKSSDEIESDKLAKMIHDSVMKIVEKREEKVNNKLS  285

Query  534  ieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIAR  713
            I+++ DECK F + G+  T SLL   +  L+   + QE+AR+EVI++ G  NPN +GIA+
Sbjct  286  IQDLVDECKTFYFAGQETTNSLLARRILLLAVHTDWQEKARREVIEIIGKGNPNSEGIAK  345

Query  714  LKIV  725
            LK +
Sbjct  346  LKTI  349



>gb|KHG26580.1| Cytochrome P450 protein [Gossypium arboreum]
Length=497

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 112/224 (50%), Gaps = 56/224 (25%)
 Frame = +3

Query  222  TTDLQGSSLTPLEDSLNG--MFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISK  395
             ++L G+ L  +E  L G  M   +I S E ++E W   +GK++EV+Q F L+ SE+IS+
Sbjct  129  VSNLLGNGLVMIEGVLFGRNMTPAVIASVETMLEKWKGKEGKEIEVYQEFRLLTSEVISR  188

Query  396  ASLGSNCLE---------------AKNIF----PGTGGIVKKNGDMDSEKL---------  491
             + GS+ LE               ++N+F    P    + K    ++SE+L         
Sbjct  189  TAFGSSYLEGEKIFAMLNKLSIIMSRNLFSTKIPLISKLWKPADLLESERLANEIQDCVM  248

Query  492  ------------------------LVAN--QesknsskisieeVADECKAFCYVGRVATT  593
                                    L+ N   +  + +++S+E++  ECK F   G+    
Sbjct  249  KIVKKREDRVVNAEADSFGNDFLGLLVNAYHDLDDKNRLSMEDLVAECKTFYVAGQETVN  308

Query  594  SLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            +LL W V  L+  K+ QE+AR+EVI++FG++NP+ DGI++LKI+
Sbjct  309  ALLAWMVLLLAIHKDWQEKARREVIEVFGNQNPDSDGISKLKII  352



>gb|KJB28183.1| hypothetical protein B456_005G032600 [Gossypium raimondii]
Length=516

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            + L  M   +I S E ++E W   +GK++EVFQ F L+ SE+IS+ + GSN LE      
Sbjct  163  ERLKNMTPAVIASVETMLEKWKGQEGKEIEVFQEFRLLTSEVISRTAFGSNYLEGEKIFA  222

Query  423  ------------------------------------AKNIFPGTGGIVKK------NGDM  476
                                                AK I      IVKK      NG+ 
Sbjct  223  MLKELSIIMSRNNFKTSIPLINKLWKGVDMLKSEELAKGIQDCVMKIVKKREDKFVNGEA  282

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +S  ++++S+E++ DECK F + G+    SLL W V  L+   +
Sbjct  283  DSFGNDFLGLLVNAYHDSDENNRLSMEDLVDECKTFYFAGQETVNSLLAWIVLLLATHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EVI +FG+ NP+ +GI++LK +
Sbjct  343  WQDKARREVIDIFGNRNPDSEGISKLKTI  371



>gb|KHG14912.1| Cytochrome P450 protein [Gossypium arboreum]
Length=497

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 113/224 (50%), Gaps = 56/224 (25%)
 Frame = +3

Query  222  TTDLQGSSLTPLEDSLNG--MFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISK  395
             ++L G+ L  +E  L G  M   +I S E ++E W   +GK++EV+Q F L+ SE+IS+
Sbjct  129  VSNLLGNGLVMIEGVLFGRNMTPAVIASVETMLEKWKGKEGKEIEVYQEFRLLTSEVISR  188

Query  396  ASLGSNCLE---------------AKNIF------------PG---------------TG  449
             + GS+ LE               ++N+F            P                  
Sbjct  189  TAFGSSYLEGEKIFAMLNKLSIIMSRNLFSTKIPLISKLWKPADLLESERLANEIQDCVM  248

Query  450  GIVKK------NGDMDS-----EKLLV-ANQesknsskisieeVADECKAFCYVGRVATT  593
             IVKK      NG+ DS       LLV A  +  + +++S++++  ECK F   G+    
Sbjct  249  KIVKKREDRVVNGEADSFGNDFLGLLVNAYHDLDDENRLSMDDLVAECKTFYVAGQETVN  308

Query  594  SLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
             LL W V  LS  ++ QE+AR+EVI++FG++NP+ DGI++LKI+
Sbjct  309  GLLAWIVLLLSIHEDWQEKARREVIEVFGNQNPDSDGISKLKII  352



>gb|KJB72083.1| hypothetical protein B456_011G158000 [Gossypium raimondii]
Length=520

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 101/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E +++ W   +G+++E FQ F ++ SE+IS+ + GS+  E + IF 
Sbjct  167  ESLKNMTPAVIASVETMLDKWKDKEGEEIEAFQEFRILTSEVISRTAFGSSYFEGEKIFY  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P      K + D++SEKL                        
Sbjct  227  MLQKLADIVSRNSNKSRIPILSKFWKTDDDIESEKLAREIQDLVIEIVKKRENKVSSGGA  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A   S   +KIS+E++ DECK F + G+    + L WAV  L+  ++
Sbjct  287  ESFGSDFLGLLVKAFNNSDEKNKISMEDLVDECKTFYFAGQETVNASLAWAVLVLAIHRD  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EV+++FG +NP+ +G+A+LKI+
Sbjct  347  WQDKARREVMEIFGKQNPHSEGLAKLKIM  375



>emb|CDP12576.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 97/204 (48%), Gaps = 54/204 (26%)
 Frame = +3

Query  276  MFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF------  437
            M   M+ S EM++  W  YDGK+++V + F L+ +E+IS+ + GS+ +E + IF      
Sbjct  180  MTPAMVESVEMMLRRWSDYDGKEIDVSEEFMLLTAEVISRTAFGSSYVEGEQIFNMMKRL  239

Query  438  -------------PGTGGIVKKNGDMDSEKL-----------------------------  491
                         P      K   D++S+KL                             
Sbjct  240  GILTGKIAYKLKPPFIRKFFKDGDDIESDKLEKGIQDSIVEIVKKREKGKKGDNKQSFGE  299

Query  492  ------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERA  653
                  L A+ +  ++  ISIEE+ DECK F   G   T+ LL W +  L+ + + QE+A
Sbjct  300  DFLGLLLKAHYDCSDNDNISIEEIIDECKTFYGAGHGTTSILLSWTILLLAINTDWQEKA  359

Query  654  RKEVIQMFGSENPNPDGIARLKIV  725
            R+EV ++FG ++PN +GI+RLK +
Sbjct  360  REEVTKLFGQDHPNSEGISRLKTI  383



>ref|XP_010044377.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X1 [Eucalyptus 
grandis]
Length=565

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 102/216 (47%), Gaps = 63/216 (29%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL  M   M+ +  +++  W   +GK+++VF+ F L+  E+ISK + GS+ +E +NI  
Sbjct  207  ESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDFKLLTCEVISKTAFGSSYIEGRNIFQ  266

Query  435  -----------------FPGTGGIV---------KKNGDMDSEKL---------------  491
                             FPG  GI          K   ++++EKL               
Sbjct  267  MLTRLGVLLTKNLHHVRFPGLRGISLGILLSKFWKTADEIEAEKLQKGIYDAILGIVKKR  326

Query  492  --------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWA  611
                                + A++   NS KI+I+++ DECK F   G+  T +L+ W 
Sbjct  327  EEKVKTGEAADVGNDFLGQLVKASRGMDNSKKITIDDLVDECKTFYLAGQETTNALMTWV  386

Query  612  VHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            V  L+   N QE+ARKEV+ +FG+ +P+ DGIA+LK
Sbjct  387  VFLLAAHPNWQEKARKEVLHVFGNNDPDSDGIAKLK  422



>gb|KJB28192.1| hypothetical protein B456_005G033600 [Gossypium raimondii]
Length=500

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 102/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E ++E W   +GK++EVF  F L+ SE+IS+ + GS+ LE      
Sbjct  147  ESLKNMTPAVIASVETMLEKWKGQEGKEIEVFHEFRLLTSEVISRTAFGSSYLEGEKVFA  206

Query  423  ------------------------------------AKNIFPGTGGIVKK------NGDM  476
                                                AK I      +VKK      NG+ 
Sbjct  207  MLNKLSIIMSRNLYNTRIPLINKLWKPADMLESEELAKEIQYCVMKMVKKREDRVVNGEA  266

Query  477  DSEK-----LLV-ANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS       LLV A  +S  ++K+S+E++ DECK F + G+    +LL W V  L+   +
Sbjct  267  DSFGNDFLGLLVNAYHDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWTVLLLAIHGD  326

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q++AR+EVI +FG++NP P+GIA+LK
Sbjct  327  WQDKARREVIGIFGNQNPQPEGIAKLK  353



>gb|KHG07569.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 99/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLG-----------  407
            +SL  M   +I S E ++E W  Y GK++E+F+ F L+ SE+IS+ + G           
Sbjct  163  ESLKNMTPAVIASVETMLEKWKGYVGKEIELFEEFRLLTSEVISRTAFGSSYLEGQKIFD  222

Query  408  ---------------------------SNCLEAKNIFPGTGGIVKK----------NGDM  476
                                       ++ LE++ +     G V K          NG+ 
Sbjct  223  MLSKLAIIMHRNLFKTRIPWISKLWKPADILESEELSNEIQGCVMKMIKKREDRVVNGEA  282

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +  + + +S+ ++ DECK F   G+    SLL W V  L+   +
Sbjct  283  DSFGNDFLGLLVNAYHDLDDKNMLSLGDLVDECKTFYLAGQDTANSLLAWTVFLLAIHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI +FG++NPNP+GI +LKI+
Sbjct  343  WQEKARREVIDIFGNQNPNPEGIVKLKIM  371



>ref|XP_007045774.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01606.1| Cytochrome P450 [Theobroma cacao]
Length=524

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 103/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   +I S E ++E W +++GK+++VF+ F L+ SE+IS+ + GS+ L+ K IF 
Sbjct  175  DSLKSMTPAVIASVETMLERWKQFEGKEIDVFEDFRLLTSEVISRTAFGSSYLDGKKIFD  234

Query  438  ------------------PGTGGIVKKNGDMDSEKLL-----------------------  494
                              P      K   +++SEKL+                       
Sbjct  235  MLLKLSVLTNRNLFKAKFPVISNFCKTADEIESEKLVKGIHNSVMEIVKKREEKVLNGEA  294

Query  495  ------------VANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                         A  ++   +++S +++ DECK F + G+  T S L WAV  L+ + +
Sbjct  295  NSFGTDFLGLLVSAYHDADKKNRLSGQDLVDECKTFYFTGQETTNSALAWAVLLLAINPD  354

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR+EVI++FG++NP+ +GI RLK
Sbjct  355  WQEKARREVIEVFGNQNPHSEGIGRLK  381



>gb|EYU22581.1| hypothetical protein MIMGU_mgv1a004745mg [Erythranthe guttata]
Length=512

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 96/209 (46%), Gaps = 56/209 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            ++L  M   M+ S EM+++ W +   ++V++ + FT + SE+ISK + GS+  + + +F 
Sbjct  161  ENLKNMVPAMVESVEMMMKKWREEKTREVDISKEFTFMTSEMISKTAFGSSYSQGEKVFN  220

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              P    + K + D +S+K                         
Sbjct  221  MLRQLSIITGRNAYKTKIPVISDLFKNSDDRESDKMEKEIQDFFLRILDQRKKETTREAH  280

Query  489  ------------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRD  632
                        LL AN +     +IS++E+ DECK F   G   T++LL W    L+ D
Sbjct  281  EKHGFGDDYLGSLLRANHDPVEKKRISVQEIIDECKTFYSAGHATTSTLLSWTALLLAID  340

Query  633  KNLQERARKEVIQMFGSENPNPDGIARLK  719
               QE+AR+EV+++FG  NPN +G+++LK
Sbjct  341  SEWQEKARQEVLEVFGPHNPNSEGLSKLK  369



>gb|KHG11625.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 99/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLG-----------  407
            +SL  M   +I S E ++E W  Y GK++E+F+ F L+ SE+IS+ + G           
Sbjct  163  ESLKNMTPAVIASVETMLEKWKGYVGKEIELFEEFRLLTSEVISRTAFGSSYLEGQKIFD  222

Query  408  ---------------------------SNCLEAKNIFPGTGGIVKK----------NGDM  476
                                       ++ LE++ +     G V K          NG+ 
Sbjct  223  MLSKLAIIMHRNLFKTRIPWISKLWKPADILESEELSNEIQGCVMKMIKKREDRVVNGEA  282

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +  + + +S+ ++ DECK F   G+    SLL W V  L+   +
Sbjct  283  DSFGNDFLGLLVNAYHDLDDKNMLSLGDLVDECKTFYLAGQDTVNSLLTWTVFLLAIHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI +FG++NPNP+GI +LKI+
Sbjct  343  WQEKARREVIDIFGNQNPNPEGIVKLKIM  371



>gb|KCW86467.1| hypothetical protein EUGRSUZ_B03135 [Eucalyptus grandis]
Length=515

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 126/280 (45%), Gaps = 79/280 (28%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAFGAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTSQTT  227
            +N + T P +       +    G VS +    WA  ++L+N                   
Sbjct  120  INRDKTFPKTVPRSFAKYLLGDGLVSTIDGVKWAKKRRLANH------------------  161

Query  228  DLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLG  407
               G       +SL  M   M+ S  +++E W + +G+++EVF+ F L+ SE+IS+ + G
Sbjct  162  TFHG-------ESLKNMVPAMVDSAHVMLEKWKQREGEEIEVFEEFKLLTSEVISRTAFG  214

Query  408  SNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL-------------  491
            S+ +E +NIF                   PG   I K   ++++EKL             
Sbjct  215  SSYVEGRNIFEMMTNLGLLVSRNALRMRFPGISKIWKTVDEIEAEKLKKGIHVAILEIAK  274

Query  492  ----------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLG  605
                                  + A  ++  S KI+I+++ DECK F + G+  TT++L 
Sbjct  275  KREKKVMAGEADDYGNDFLGQLVKAYHDNDESKKITIDDLVDECKTFYFAGQETTTAMLT  334

Query  606  WAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            W +  L+   + QE ARKEV+ +FG+E+P+ DGIA+L+++
Sbjct  335  WVIFLLAVHSDWQEEARKEVLDVFGNEDPDFDGIAKLRMI  374



>ref|XP_008356573.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            + L  MF  M+ S E ++E W   + K++E+F+ F L  SE+IS+ + GS+ LE +NIF 
Sbjct  167  ECLKIMFPDMVASAETMLERWRNNEEKEIEMFEEFRLFTSEVISRTAFGSSYLEGQNIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG     K + +++++KL                        
Sbjct  227  MLMKLAFLVSKNALTVGIPGISKFFKTSDEIEADKLVKGVYASIMDIANKRQKTVISGEE  286

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A+ ++ +  +IS++++ DECK F + G+  T + LGW V  L+   N
Sbjct  287  ASFGSDFFGLLLKAHHDASDDQRISVDDLVDECKTFYFAGQETTNTSLGWTVFLLALHTN  346

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q+ ARKEVI++FG + PN DGIA++K
Sbjct  347  WQDEARKEVIELFGKQAPNLDGIAKMK  373



>ref|XP_007210003.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
 gb|EMJ11202.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
Length=561

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 91/199 (46%), Gaps = 66/199 (33%)
 Frame = +3

Query  285  GMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI----------  434
             MI S + ++E W  ++ K++EVF+ F L+ SE+IS+ + GS+ LE K+I          
Sbjct  231  AMIASADTMLERWENHEAKEIEVFEEFRLLTSEVISRTAFGSSYLEGKDIFEMLLKISSL  290

Query  435  ---------FPGTGGIVKKNGDMDSEK---------------------------------  488
                     FPG    VK N +++ EK                                 
Sbjct  291  TFKTALKPKFPGLSRFVKTNDEIEMEKLEKRIRETIIEIVKKRERKVMPGEEGSLRSDFL  350

Query  489  --LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKE  662
              LL A  ++ ++ +IS++++ +ECK F   G  +T + L W              ARKE
Sbjct  351  GLLLKAYLDTNDNQRISLDDLVEECKTFYLAGHESTATFLAWT------------EARKE  398

Query  663  VIQMFGSENPNPDGIARLK  719
            V+Q+FG + PNP GIA+LK
Sbjct  399  VLQLFGKQTPNPKGIAKLK  417



>gb|KHG09429.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 98/207 (47%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   MI S E ++E W   +G+++EVFQ F L+ SE+ISK + GS+ LE      
Sbjct  163  ESLKNMTPAMIASVETMLEKWKGQEGQEIEVFQEFRLLTSEVISKTAFGSSYLEGEKIFA  222

Query  423  ------------------------------------AKNIFPGTGGIVKK------NGDM  476
                                                AK I      IVKK      NG+ 
Sbjct  223  LLYKLKILVSRNMSKTTIPFINKLWKSADLLESEKLAKGIQDCVMKIVKKREDQVVNGEA  282

Query  477  DSEK-----LLV-ANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS       LLV A  +    +++S+E++ DECK F   G+    SLL W V  L+   +
Sbjct  283  DSFGNDFFGLLVNAYHDLDEKNRLSLEDLVDECKTFYIAGQETVNSLLAWIVLHLAIHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+ R+EVI +FG++NP+ +GI +LK
Sbjct  343  WQEKTRREVIDIFGNQNPHLEGITKLK  369



>ref|XP_009607162.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana tomentosiformis]
Length=515

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 99/209 (47%), Gaps = 53/209 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M  S + ++E W +++GKD +VF+ F L+ +E+IS+ + GS+ +E K+IF 
Sbjct  167  ESLKRMVPEMSASVQTMLEKWKEHEGKDFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL----------LVANQesk------  515
                              PG   +++ + ++++EKL          LV  +E        
Sbjct  227  MVAKLTAITVKNIYNVRFPGISMLIRTDDEIEAEKLERGIKSSILELVRKREKVKDGMFE  286

Query  516  ------------------nsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                               +  I+I+++ DE KA    G + TTSLLGW+V  L+     
Sbjct  287  NFGTDYLGQLMKLLHEPDTNKSITIDQMIDEVKALYGAGHLTTTSLLGWSVFLLAHHPEW  346

Query  642  QERARKEVIQMFGSENPNPDGIARLKIVD  728
            QE+ARKEV +  G   P  D I RL+ ++
Sbjct  347  QEKARKEVFEFCGLRTPTSDAITRLRTMN  375



>ref|XP_010044380.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=545

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 126/280 (45%), Gaps = 79/280 (28%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAFGAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTSQTT  227
            +N + T P +       +    G VS +    WA  ++L+N                   
Sbjct  150  INRDKTFPKTVPRSFAKYLLGDGLVSTIDGVKWAKKRRLANH------------------  191

Query  228  DLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLG  407
               G       +SL  M   M+ S  +++E W + +G+++EVF+ F L+ SE+IS+ + G
Sbjct  192  TFHG-------ESLKNMVPAMVDSAHVMLEKWKQREGEEIEVFEEFKLLTSEVISRTAFG  244

Query  408  SNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL-------------  491
            S+ +E +NIF                   PG   I K   ++++EKL             
Sbjct  245  SSYVEGRNIFEMMTNLGLLVSRNALRMRFPGISKIWKTVDEIEAEKLKKGIHVAILEIAK  304

Query  492  ----------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLG  605
                                  + A  ++  S KI+I+++ DECK F + G+  TT++L 
Sbjct  305  KREKKVMAGEADDYGNDFLGQLVKAYHDNDESKKITIDDLVDECKTFYFAGQETTTAMLT  364

Query  606  WAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            W +  L+   + QE ARKEV+ +FG+E+P+ DGIA+L+++
Sbjct  365  WVIFLLAVHSDWQEEARKEVLDVFGNEDPDFDGIAKLRMI  404



>gb|KGN51993.1| hypothetical protein Csa_5G606830 [Cucumis sativus]
Length=378

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 90/209 (43%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   MI  GE ++E W  Y+GK+++ F+ F +   ++IS  + GS+  + K IF 
Sbjct  164  DSLKNMIPTMIECGEKMIEGWKNYEGKELDAFKEFKVFTLDVISHTAFGSSYQQGKKIFH  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I+K   D + E+L                        
Sbjct  224  MLRELCELSIRNGYKIRLPIISKILKSKDDYEGERLGKRLKDCFMEIIKEREEKLRNGEA  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  + + S  IS+E++ DECK F + G   T  LL W +  L+  K 
Sbjct  284  NDYGNDFLGLLIKAKNDPETSQCISMEDIVDECKTFYFAGHETTNVLLAWTMLLLALHKE  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR EV+ +FG  NP  +G+ +LK V
Sbjct  344  WQEKARNEVLDVFGHNNPTLEGLPKLKTV  372



>gb|KHG20842.1| Secologanin synthase [Gossypium arboreum]
Length=512

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 104/209 (50%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E ++E W   +G+++EV Q F L+ SE+IS+ + GS+ LE      
Sbjct  159  ESLKNMTPAIIASVETMLEKWKGQEGREIEVLQEFRLLTSEVISRTAFGSSYLEGEKIFA  218

Query  423  ---------AKNIFPG---------------------------TGGIVKK------NGDM  476
                     ++N+F                                IVKK      NG++
Sbjct  219  MLQKLTIIMSRNLFKSRIPLISKLWKSADLLESEKLSKEIKDRVMNIVKKREDEAVNGEV  278

Query  477  DSEK-----LLV-ANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            +S       LLV A  +S   ++ S+E++  ECK F + G+    SLL W V  L+   N
Sbjct  279  NSFGNDFLGLLVNAYHDSDEKNRFSLEDLLAECKTFYFSGQETVNSLLSWIVLHLAIHGN  338

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI +FG++NP+ +G+A+LKI+
Sbjct  339  WQEKARREVIDIFGNQNPHLEGVAKLKIM  367



>gb|KHG20728.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=988

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 101/207 (49%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E +++ W   +GK++EVF  F L+ SE+IS+ + GS+ LE      
Sbjct  127  ESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVISRTAFGSSYLEGEKVFA  186

Query  423  ------------------------------------AKNIFPGTGGIVKK------NGDM  476
                                                AK I      IVKK      NG+ 
Sbjct  187  MLNKLSIIMSRNLYNTRIPLINKLWKPADMLESEELAKEIQDCVMKIVKKREDKVVNGEA  246

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +S  ++K+S+E++ DECK F + G+    +LL W V  L+   +
Sbjct  247  DSFGNDFLGLLVNAYHDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWTVLLLAIHGD  306

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q++AR+EVI +FG++NP P+GIA+LK
Sbjct  307  WQDKARREVIGIFGNQNPQPEGIAKLK  333


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/209 (31%), Positives = 104/209 (50%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNI--  434
            +SL  M   +I S E ++E W  Y GK++EV+  F L+ SE+IS+ + GS+ LE + I  
Sbjct  635  ESLKNMTPAVIASVETMLEKWKGYVGKEIEVYHEFRLLTSEVISRTAFGSSYLEGEKIFD  694

Query  435  -----------------------FPGTGG-----------------IVKK------NGDM  476
                                   F  +G                  IVKK      NG++
Sbjct  695  MLNKLSIIRSRNFFETRIPLINKFWKSGDVLESEELSKGIQDCVMKIVKKREDKVVNGEV  754

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +S  ++++S E++ DECK F + G+    SL+ W V  L+   +
Sbjct  755  DSFGNDFLGLLVNAYHDSDENNRLSTEDLVDECKTFYFAGQDTVNSLIAWIVFLLAIHGD  814

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++ PN + +++LKI+
Sbjct  815  WQEKARREVIEIFGNQIPNSEEMSKLKIM  843



>gb|EYU22578.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22579.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22580.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
Length=506

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 99/207 (48%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAK---N  431
            + L  MF  M+ S E ++E +  ++GK++EV   F L+ SE+IS+ + GS+ +E +   +
Sbjct  157  ECLKDMFPSMVASVEAMLEKFKCHEGKEIEVCSEFRLLTSEVISRTAFGSSYVEGRKIFD  216

Query  432  IFPGTGGIVKKNG----------------DMDSEK-------------------------  488
            +    G +  +N                 +++++K                         
Sbjct  217  MLTKLGVLASRNSHNIRLAVLQKFARTKDEIEADKIEKSLHDSIVEMVNRRQDEVKIGKS  276

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A+      +++S  E+ DECK F + G+  T SLL WAV  L+ + +
Sbjct  277  KDFGSDFLGSLLKAHHNIDKKNQLSALEIIDECKTFYFAGQETTYSLLSWAVLLLAINTD  336

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QERAR EV+++FG +NP  +GI+RLK
Sbjct  337  WQERARNEVLELFGRQNPVSEGISRLK  363



>ref|XP_011070908.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=514

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 101/210 (48%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M  S E ++  W  Y+GK+++VF+ F L+ +E+IS+ + G+  ++ K+ F 
Sbjct  165  ESLKRMVPKMSSSIEEMLGRWKNYEGKEIDVFKEFGLLTTEVISRTAFGNRYVDGKHTFE  224

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   ++K + +++++KL                        
Sbjct  225  MVAKLTALTVRNIYKVRFPGISMVLKSDDEVEAKKLQQRIKSSILEIVKKREINVKDGEF  284

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       +    ES    +I+ +++ DE KA    G + TT+LLGW V  L+ +  
Sbjct  285  QSFGSDYLGQLVEMTHESDVKKRITTDQMIDEIKAMYGAGHLTTTNLLGWCVLLLATNTE  344

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             Q+RAR+EV + FG ++P+ DGIARLKI++
Sbjct  345  WQDRAREEVNRTFGRKSPDSDGIARLKIIN  374



>gb|KHG27490.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 98/209 (47%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGS----------  410
            +SL  M   +I S E ++E W  Y GK++E+F+ F L+ SE+IS+ + GS          
Sbjct  163  ESLKNMTPAVIASVETMLEKWKGYVGKEIELFEEFRLLTSEVISRTAFGSSYLEGQKIFD  222

Query  411  ----------------------------NCLEAKNIFPGTGGIVKK----------NGDM  476
                                        + LE++ +     G V K          NG+ 
Sbjct  223  MLSKLAIIMHRNLFKTRIPWISKLWKPADILESEELSNEIQGCVMKMIKKREDRVVNGEA  282

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +  + + +S+ ++ DECK F   G+    SLL W V  L+   +
Sbjct  283  DSFDNDFLGLLVNAYHDLDDKNMLSLGDLVDECKTFYLAGQDTVNSLLTWTVFLLAIHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI +FG++NP+P+ I +LKI+
Sbjct  343  WQEKARREVIDIFGNQNPHPESIVKLKIM  371



>gb|KCW44246.1| hypothetical protein EUGRSUZ_L02324 [Eucalyptus grandis]
Length=514

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/283 (25%), Positives = 118/283 (42%), Gaps = 85/283 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N   T P +G    + FAK     G VS V    WA  ++L+N                
Sbjct  117  LNREKTYPKTGT---KDFAKKLLGDGLVSTVDGKKWANQRKLANHA--------------  159

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++  W   +GK++EVF  F L+ SE+IS+ 
Sbjct  160  ----FHG-------ESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFKLLTSEVISRT  208

Query  399  SLGSNCLEAKNI-------------------FPGTGGIVKKNGDMDSEK-----------  488
            + GS+ +E +NI                   FPG   + K   ++++EK           
Sbjct  209  AFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRFPGIRKLWKTADEVEAEKLEKGIRNSILQ  268

Query  489  ------------------------LLVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                    L+ A  ++  S K +++ + DECK F   G+    S
Sbjct  269  MIKRREKKVMAGEEDGFGDDFLGQLVKALHDTDKSKKFTVDNLVDECKTFYIAGQETVNS  328

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            ++ W +  L+ +   QE AR+EV+ +FG+++P+ DG+ +LK +
Sbjct  329  MMTWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKI  371



>gb|KCW73209.1| hypothetical protein EUGRSUZ_E016722, partial [Eucalyptus grandis]
Length=371

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 115/281 (41%), Gaps = 85/281 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N + T P +G     GF K     G  S      WA  ++L+N                
Sbjct  118  LNRDKTYPKTGN---RGFPKKLLGDGLASTPGGEKWAKKRKLANRA--------------  160

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++E W   +GK++EVF+ F ++ SE+IS+ 
Sbjct  161  ----FHG-------ESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDFKVLTSEVISRT  209

Query  399  SLGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEK-----------  488
            + GS+ +E +NIF                   PG   + K   ++++EK           
Sbjct  210  AFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEKLEKGICDSIVQ  269

Query  489  ------------------------LLVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                    L+ A  ++  S KI+++ + DECK F   G     S
Sbjct  270  MIKRREKKVMAGEVDCFGDDFLGQLVKALHDADKSKKITVDNLVDECKTFYVAGHETANS  329

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            L+ W +  L+     QE AR EV+ +FG+++PN DG+ +LK
Sbjct  330  LMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLK  370



>gb|KDP25920.1| hypothetical protein JCGZ_23044 [Jatropha curcas]
Length=217

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 95/198 (48%), Gaps = 47/198 (24%)
 Frame = +3

Query  276  MFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP-----  440
            M   MI S EM++  W KY+ K+++V++ F  + S++IS+ + G++  EA++IF      
Sbjct  1    MIPVMITSVEMMLGRWRKYENKEIDVWKEFKQLTSDVISRTAFGNSYSEAQDIFDMIMEL  60

Query  441  -------GTGGIVKKNGDMDSEKL-----------------------------------L  494
                       I K   D++S+KL                                   L
Sbjct  61   LILASQNSFKEIYKNKDDIESDKLEQRLRESILKMIRKREEEAKMAEPDSHGSDFLGVLL  120

Query  495  VANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQM  674
             ANQ+   S KISI ++ DE K F   G+  T++ L W +  L+   + QE+ RKEV+++
Sbjct  121  KANQDPNKSKKISINDIVDEYKTFYIAGQETTSAALNWTIFLLAIHIDWQEKVRKEVLEL  180

Query  675  FGSENPNPDGIARLKIVD  728
            FG  NP  + I +LKI++
Sbjct  181  FGRRNPTLNEINKLKIMN  198



>ref|XP_010044376.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86462.1| hypothetical protein EUGRSUZ_B03130 [Eucalyptus grandis]
Length=514

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/283 (25%), Positives = 118/283 (42%), Gaps = 85/283 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N   T P +G    + FAK     G VS V    WA  ++L+N                
Sbjct  117  LNREKTYPKTGT---KDFAKKLLGDGLVSTVDDKKWANQRKLANHA--------------  159

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++  W   +GK++EVF  F L+ SE+IS+ 
Sbjct  160  ----FHG-------ESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFKLLTSEVISRT  208

Query  399  SLGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEKL----------  491
            + GS+ +E +NIF                   PG   + K   ++++EKL          
Sbjct  209  AFGSSYVEGRNIFQMLTGLATLTSKNAFNIRLPGIRKLWKTADEVEAEKLEKGIRNSILQ  268

Query  492  -------------------------LVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                     + A  ++  S K +++ + DECK F   G+    S
Sbjct  269  MIKRREKKVMAGEEDGIGDDFLGQLVKALHDTDKSKKFTVDNLVDECKTFYIGGQETANS  328

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            ++ W +  L+ +   QE AR+EV+ +FG+++P+ DG+ +LK +
Sbjct  329  MMAWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKI  371



>ref|XP_004135430.2| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis sativus]
Length=515

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 89/207 (43%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   MI  GE ++E W  Y+GK+++ F+ F +   ++IS  + GS+  + K IF 
Sbjct  164  DSLKNMIPTMIECGEKMIEGWKNYEGKELDAFKEFKVFTLDVISHTAFGSSYQQGKKIFH  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I+K   D + E+L                        
Sbjct  224  MLRELCELSIRNGYKIRLPIISKILKSKDDYEGERLGKRLKDCFMEIIKEREEKLRNGEA  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  + + S  IS+E++ DECK F + G   T  LL W +  L+  K 
Sbjct  284  NDYGNDFLGLLIKAKNDPETSQCISMEDIVDECKTFYFAGHETTNVLLAWTMLLLALHKE  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR EV+ +FG  NP  +G+ +LK
Sbjct  344  WQEKARNEVLDVFGHNNPTLEGLPKLK  370



>ref|XP_012086314.1| PREDICTED: cytochrome P450 CYP749A22-like [Jatropha curcas]
Length=339

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 98/217 (45%), Gaps = 61/217 (28%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            D L  M   MI S EM++  W KY+ K+++V++ F  + S++IS+ + G++  EA++IF 
Sbjct  104  DKLKNMIPVMITSVEMMLGRWRKYENKEIDVWKEFKQLTSDVISRTAFGNSYSEAQDIFD  163

Query  438  -------------------------PGTGGIVKKNGDMDSEKL-----------------  491
                                     P    I K   D++S+KL                 
Sbjct  164  MIMELLILASQNSFKVRIPLIKCLLPLLQEIYKNKDDIESDKLEQRLRESILKMIRKREE  223

Query  492  ------------------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVH  617
                              L ANQ+   S KISI ++ DE K F   G+  T++ L W + 
Sbjct  224  EAKMAEPDSHGSDFLGVLLKANQDPNKSKKISINDIVDEYKTFYIAGQETTSAALNWTIF  283

Query  618  KLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIVD  728
             L+   + QE+ RKEV+++FG  NP  + I +LKI++
Sbjct  284  LLAIHIDWQEKVRKEVLELFGRRNPTLNEINKLKIMN  320



>ref|XP_010058553.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=439

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 116/283 (41%), Gaps = 85/283 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N + T P +G     GF K     G  S      WA  ++L+N                
Sbjct  185  LNRDKTYPKTGN---RGFPKKLLGDGLASTPGGEKWAKKRKLANR---------------  226

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++E W   +GK++EVF+ F ++ SE+IS+ 
Sbjct  227  ---AFHG-------ESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDFKVLTSEVISRT  276

Query  399  SLGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEK-----------  488
            + GS+ +E +NIF                   PG   + K   ++++EK           
Sbjct  277  AFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEKLEKGICDSIVQ  336

Query  489  ------------------------LLVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                    L+ A  ++  S KI+++ + DECK F   G     S
Sbjct  337  MIKRREKKVMAGEVDCFGDDFLGQLVKALHDADKSKKITVDNLVDECKTFYVAGHETANS  396

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            L+ W +  L+     QE AR EV+ +FG+++PN DG+ +LK V
Sbjct  397  LMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLKKV  439



>gb|KHG14401.1| Cytochrome P450 protein [Gossypium arboreum]
Length=682

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E ++E W  Y GK++EV+  F L+ SE+IS+ + GS+ LE      
Sbjct  329  ESLKNMTPAVIASVETMLEKWKSYVGKEMEVYHEFRLLTSEVISRTAFGSSYLEGEKIFD  388

Query  423  ---------AKNIFPG---------------------------TGGIVKKNGD-------  473
                     ++N+F                                IVKK  D       
Sbjct  389  MLSKLSIIRSRNLFETRIPLINKLWKSADMLKSEELSKGIQDCVMKIVKKREDKVENREA  448

Query  474  ----MDSEKLLV-ANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                 D   LLV A  +   ++++S+E++ DECK F + G+    SLL W V  ++   +
Sbjct  449  DSFGYDFLGLLVKAYHDPDKNNRLSMEDLVDECKTFYFAGQDTVNSLLAWMVFLIAIHGD  508

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++ P+ +GI++LKI+
Sbjct  509  WQEKARREVIEIFGNQIPDSEGISKLKIM  537



>ref|XP_010046246.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=462

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 92/198 (46%), Gaps = 54/198 (27%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S  M+++ W   + + VE+F+ FT I S++IS+ + GS+ +E +N+F 
Sbjct  130  ESLKCMIPAMVDSVHMLLKRWQNLEARVVELFEEFTAITSDVISRTAFGSSYIEGRNMFQ  189

Query  438  ------------------PGTGGIVKKNGDMDSEK-------------------------  488
                              PG   I K   ++DSE+                         
Sbjct  190  MLGELTTIASRNIFKLRLPGVRNIWKTIDEIDSERLEKAIRDVVLEIIRKREEKVNTGEM  249

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A  +   S +I+I++V DECK F + G+  T S+L W +  L+  K+
Sbjct  250  NDYGNDLLGSLLKAYHDPDESKRITIDDVMDECKTFYFAGQETTNSVLTWTLFLLAIHKD  309

Query  639  LQERARKEVIQMFGSENP  692
             Q+ ARKEV  +FG+E+P
Sbjct  310  WQQEARKEVTDVFGNEDP  327



>gb|KHG03731.1| Secologanin synthase [Gossypium arboreum]
Length=513

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 102/210 (49%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   +I S E ++E W   +G+++EVF+ F L+ +E+IS+ + GSN LE K IF 
Sbjct  164  ESLKNMNPAVIASVETMLEKWKGREGEEMEVFEEFRLLTAEVISRTAFGSNYLEGKKIFE  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   I K   +++SEKL                        
Sbjct  224  MLTRLSILVINNYYKTKIPGISMIWKTADEIESEKLAKGIHDRVMEMVKRREKNVSVGES  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A+++S   ++ S+E++ DECK F + G+  T SLL W V  L+    
Sbjct  284  DNFGNDFLGLLINAHRDSDEKNRFSVEDLVDECKTFYFAGQETTNSLLAWTVLVLAIHTE  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE+ R+EV + FG  NPN +GI++LKI++
Sbjct  344  WQEKTRREVFEAFGDRNPNSEGISKLKIMN  373



>ref|XP_011070904.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 98/210 (47%), Gaps = 54/210 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            + L  M   M+ S + ++E W  Y+GK++EV   F +++SE+IS+ + GS+ +E   IF 
Sbjct  162  ECLKDMVPAMVASVQTMLEKWRHYEGKEIEVCGDFRILSSEVISRTAFGSSYVEGIKIFN  221

Query  441  GTGGI-------------------VKKNGDMDSEK-------------------------  488
              G +                   V+   D +++K                         
Sbjct  222  MLGKLSALISENANKMNFLGLVKFVRTKADSEADKIEQLLHESIMEIVRKRQDEVITVRA  281

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      LL A  E     +IS  E+ DECK F + G++ T SLL W+V  L+   +
Sbjct  282  DSFGSDFLGSLLKARHEGSEKKQISAAEIIDECKTFYFAGQLTTHSLLSWSVLLLAIHPD  341

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIVD  728
             QE+AR EV Q+FG ENPN +GIARLK V+
Sbjct  342  WQEKARNEVFQLFGRENPNSEGIARLKTVN  371



>gb|KHG17439.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            + L  M   +I S E ++E W   +GK++EVFQ F L+ SE+IS+ +  S+ LE      
Sbjct  163  ERLKNMTPTVIASVETMLEKWKGQEGKEIEVFQEFRLLTSEVISRTAFDSSYLEGEKIFA  222

Query  423  ------------------------------------AKNIFPGTGGIVKK------NGDM  476
                                                AK I      IVKK      NG+ 
Sbjct  223  MLKELSIIMSRNNFKTRIPLINKLWKPVDMLKSEELAKGIQDCVMKIVKKREDKVVNGEA  282

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +S  ++++S+E++ DECK F + G+    S+L W V  L+   +
Sbjct  283  DSFGNDFLGLLVNAYHDSNENNRLSVEDLVDECKTFYFAGQDTVNSILAWVVLHLATHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EVI +FG+ NP+ +GI++LK +
Sbjct  343  WQDKARREVIDIFGNRNPDSEGISKLKTI  371



>ref|XP_004239025.1| PREDICTED: cytochrome P450 CYP749A22-like [Solanum lycopersicum]
Length=515

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 101/209 (48%), Gaps = 53/209 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M  S   ++E W +++GK+ +VF+ F L+ +E+IS+ + GS+ +E K+IF 
Sbjct  167  ESLKRMVPEMSESVAEMLERWKEHEGKEFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFE  226

Query  438  ------------------PGTGGIVKKNGDMDSEKL----------LVANQe--------  509
                              PG   +++ + ++++EKL          LV+ +E        
Sbjct  227  MVAKLTAITVKNLYTVKFPGISWLIRTDDEIEAEKLERGIKNSILELVSKREKGKDGMYE  286

Query  510  ----------------sknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNL  641
                            S  + +I+I+++ DE +     G + TTSLLGW+V  L+     
Sbjct  287  KFGNDYLGQLMKLLHESDTNKRITIDQMIDEVRTLYGAGHLTTTSLLGWSVFLLALHPEW  346

Query  642  QERARKEVIQMFGSENPNPDGIARLKIVD  728
            QE+ARKEV    G E P  D IARL+ ++
Sbjct  347  QEKARKEVFLFCGLEKPTSDAIARLRTMN  375



>gb|KHG24669.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            + L  M   +I S E ++E W   +GK++EVFQ F L+ SE+IS+ +  S+ LE      
Sbjct  163  ERLKNMTPTVIASVETMLEKWKGQEGKEIEVFQEFRLLTSEVISRTAFDSSYLEGEKIFA  222

Query  423  ------------------------------------AKNIFPGTGGIVKK------NGDM  476
                                                AK I      IVKK      NG+ 
Sbjct  223  MLKELSIIMSRNNFKTRIPLINKLWKPVDMLKSEELAKGIQDCVMKIVKKREDKVVNGEA  282

Query  477  DSEK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
            DS        L+ A  +S  ++++S+E++ DECK F + G+    S+L W V  L+   +
Sbjct  283  DSFGNDFLGLLVNAYHDSNENNRLSVEDLVDECKTFYFAGQDTVNSILAWVVLHLATHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR+EVI +FG+ NP+ +GI++LK +
Sbjct  343  WQDKARREVIDIFGNRNPDSEGISKLKTI  371



>gb|KGN51994.1| hypothetical protein Csa_5G606840 [Cucumis sativus]
Length=382

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 92/209 (44%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            D+L  M   M++  E +VE W  ++ K+++VF+HF +   ++IS  + GS+  + +N+F 
Sbjct  166  DNLKNMIPSMVQCAETMVEEWAHHEDKEIDVFKHFKVYTLDVISHTAFGSSYEQGRNVFQ  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I+K   D++ + L                        
Sbjct  226  MLQRLCELSITNRYKVRLPVISKILKSKDDIEGQSLEKKMKDCFVEIIKAREEKLNNDEA  285

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  + ++S +IS+E+V DECK F + G   T  LL W +  L+  K 
Sbjct  286  NDYGNDFLGLLVKAKNDPQDSQRISLEDVVDECKTFYFAGHETTNVLLAWTMFLLALHKE  345

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR EV  +FG  NP  + + +LK V
Sbjct  346  WQEKARNEVFDVFGHSNPTFEALPKLKTV  374



>gb|KCW85139.1| hypothetical protein EUGRSUZ_B01979 [Eucalyptus grandis]
Length=300

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 73/127 (57%), Gaps = 6/127 (5%)
 Frame = +3

Query  363  FTLIASELISKASLGSNCLEAKNIFPGTGGIVKKNGDMDSE------KLLVANQesknss  524
            FT I SE+I + + GS+  E ++IF   G      G+MD         LL A      S 
Sbjct  69   FTAIMSEVIFRTAFGSSYTEGRDIFQMLGEKKLNIGEMDDYVNDFLGSLLKAYHNPDESK  128

Query  525  kisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDG  704
            +I+I+++ DECK F +VG+  T S+L W +  L+  K+ QE ARKEV  + G+E+PN +G
Sbjct  129  QITIDDLVDECKTFYFVGQETTNSILTWTLFFLAIHKDWQEEARKEVADVVGNEDPNFEG  188

Query  705  IARLKIV  725
            I +LK V
Sbjct  189  IMKLKTV  195



>gb|KJB28173.1| hypothetical protein B456_005G0331001, partial [Gossypium raimondii]
Length=400

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 101/208 (49%), Gaps = 54/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E ++E W   +G+++EV + F L+ SE+IS+ + GS+ LE      
Sbjct  47   ESLKNMTPAIIASVETMLEKWKGQEGREIEVLKEFRLLTSEVISRTAFGSSYLEGEKIFA  106

Query  423  ---------AKNIF----PGTGGIVKKNGDMDSEKL------------------------  491
                     ++N+F    P    + K    ++SEKL                        
Sbjct  107  MLQKLTIIMSRNLFKTRIPLISKLWKSADLLESEKLSKEIKDRVMKIVKKREDEAVNGEV  166

Query  492  ---------LVAN--QesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                     L+ N   +S   ++ S+E++  ECK F + G+    SLL W V  L+   +
Sbjct  167  NSFGNDFLGLLVNAYHDSDEKNRFSLEDLLAECKTFYFSGQETVNSLLSWIVLHLAIHGD  226

Query  639  LQERARKEVIQMFGSENPNPDGIARLKI  722
             QE+AR+EVI +FG++NP+ +G+A+LKI
Sbjct  227  WQEKARREVIDIFGNQNPHLEGVAKLKI  254



>gb|KJB28186.1| hypothetical protein B456_005G032900 [Gossypium raimondii]
Length=525

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 54/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S E ++E W   +G+++EV + F L+ SE+IS+ + GS+ LE      
Sbjct  172  ESLKNMTPAIIASVETMLEKWKGQEGREIEVLKEFRLLTSEVISRTAFGSSYLEGEKIFA  231

Query  423  ---------AKNIF----PGTGGIVKKNGDMDSEKL------------------------  491
                     ++N+F    P    + K +  ++SEKL                        
Sbjct  232  MLQKLTIIMSRNLFKTRIPLISKLWKSSDLLESEKLSKEIKDRVMKIVKKREDEAVNGEV  291

Query  492  ---------LVAN--QesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                     L+ N   +S   ++ S+E++  ECK F + G+    SLL W V  L+   +
Sbjct  292  NSFGNDFLGLLVNAYHDSDEKNRFSLEDLLAECKTFYFSGQETVNSLLSWIVLHLAIHGD  351

Query  639  LQERARKEVIQMFGSENPNPDGIARLKI  722
             QE+AR+EVI +FG++NP+ +G+A+LKI
Sbjct  352  WQEKARREVIDIFGNQNPHLEGVAKLKI  379



>ref|XP_008446466.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=515

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 88/207 (43%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   MI  GE ++E W  Y+GK+++ F+ F +   ++IS  + GS+  + K IF 
Sbjct  164  DSLKNMIPTMIECGEKMIEGWKNYEGKELDAFKEFKVFTLDVISHTAFGSSYQQGKKIFH  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I+K   D + E+L                        
Sbjct  224  MLQELCDLSIRNGYKIKLPIISKILKSKDDYEGERLEKRLKDCFMEIIKEREEKLRNDEA  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  + + S  IS+E++ DECK F + G   T  LL W +  L+  K 
Sbjct  284  SDYGNDFLGLLIKAKNDPETSQSISMEDIVDECKTFYFAGHETTNVLLAWTMLLLALHKE  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR EV  +FG  +P  +G+ +LK
Sbjct  344  WQEKARNEVFDVFGHNHPTLEGLPKLK  370



>ref|XP_010046253.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=334

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 77/135 (57%), Gaps = 2/135 (1%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL GM   M+ S   ++E W K + K+VE+F+ F  I S +IS+ + GS+ +E + I  
Sbjct  113  ESLKGMIPAMVDSVHTLLERWQKLEAKEVELFKEFATITSNVISRTAFGSSYMEGRKISQ  172

Query  441  GTGGIVKKNGDMDSEKLLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHK  620
                +   +  + S  LL A  +   + +I+I+++ DECK F +VG+  T S L W +  
Sbjct  173  IWSELTIVDDFLGS--LLKAYHDPNKNKRITIDDLVDECKTFYFVGQETTNSTLTWTLFF  230

Query  621  LSRDKNLQERARKEV  665
            L+  K+ QE ARKEV
Sbjct  231  LAIHKDWQEEARKEV  245



>ref|XP_010054392.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=476

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 93/207 (45%), Gaps = 52/207 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            ++L GM   M+ S   +++ W   +GK+++V++   L AS++ISK + GS+  E K+IF 
Sbjct  126  ENLKGMIPAMVDSAHTMLKRWSGREGKEIDVYKELRLYASDVISKTAFGSSYTEGKSIFE  185

Query  441  GTGG----------------------------------------IVKK------NGDMDS  482
                                                        I+KK      +G+++S
Sbjct  186  NVNKLILVMVNASSSFPILRKLWRPAYEIEGEKIEKGFREAVLEIIKKRQEKVNSGELES  245

Query  483  EK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                    LL A+ E     KI+I+ V  ECK F   G    TS L W V  LS   + Q
Sbjct  246  YGNDFLGLLLRASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAWTVLLLSIHTDWQ  305

Query  645  ERARKEVIQMFGSENPNPDGIARLKIV  725
            E ARKE   +FG+++P+ DGI +LK +
Sbjct  306  EEARKEAFNVFGNQDPDLDGITKLKTI  332



>gb|KCW76385.1| hypothetical protein EUGRSUZ_D00767 [Eucalyptus grandis]
Length=473

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 93/207 (45%), Gaps = 52/207 (25%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            ++L GM   M+ S   +++ W   +GK+++V++   L AS++ISK + GS+  E K+IF 
Sbjct  126  ENLKGMIPAMVDSAHTMLKRWSGREGKEIDVYKELRLYASDVISKTAFGSSYTEGKSIFE  185

Query  441  GTGG----------------------------------------IVKK------NGDMDS  482
                                                        I+KK      +G+++S
Sbjct  186  NVNKLILVMVNASSSFPILRKLWRPAYEIEGEKIEKGFREAVLEIIKKRQEKVNSGELES  245

Query  483  EK------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQ  644
                    LL A+ E     KI+I+ V  ECK F   G    TS L W V  LS   + Q
Sbjct  246  YGNDFLGLLLRASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAWTVLLLSIHTDWQ  305

Query  645  ERARKEVIQMFGSENPNPDGIARLKIV  725
            E ARKE   +FG+++P+ DGI +LK +
Sbjct  306  EEARKEAFNVFGNQDPDLDGITKLKTI  332



>ref|XP_002316007.2| hypothetical protein POPTR_0010s14910g [Populus trichocarpa]
 gb|EEF02178.2| hypothetical protein POPTR_0010s14910g [Populus trichocarpa]
Length=512

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 98/207 (47%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP  440
            +SL G    MI S E +++ W +   K++EVFQ F ++ SE+IS+A+  S+ LE KNIF 
Sbjct  163  ESLKGTIPAMIVSVETMLDRWRREGIKEIEVFQEFKVLTSEIISRAAFRSSYLEGKNIFD  222

Query  441  ----------------GTGGI---VKKNGDMDSEKL------------------------  491
                            G  GI    K   D++SEKL                        
Sbjct  223  MLTRMALIVGRNNYKVGISGIKRFFKTRDDIESEKLDRGIRDSMLKVIKRREEVMMGTEP  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  E+  + KISI+++ DECK F   G   TTS L W +  L+   +
Sbjct  283  DGYGSDFLGLLLKAYHENDKTKKISIDDLIDECKTFYVAGHETTTSSLTWTLLFLAIHTD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q RAR+EV+Q+FG +NP PD I RLK
Sbjct  343  WQNRAREEVLQIFGQQNPCPDSIGRLK  369



>gb|AEM42984.1| cytochrome P450 [Siraitia grosvenorii]
Length=519

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 92/208 (44%), Gaps = 55/208 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            DSL  M   M    E ++E W  Y+GK+++VF+   +  S++IS  + GS+  + K+IF 
Sbjct  164  DSLKSMIPAMTGCAEAMIERWKHYEGKEIDVFEQMKIYTSDVISHTAFGSSYEQGKHIFY  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I K    ++ E+L                        
Sbjct  224  TLQQISELYIRNAYKVSFPVISRIFKHKDHIEGERLQKRMKECFMKVIKTREAKFLSGEA  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  + + S +IS++E+ DECK F + G   T+ LL W +  L+  + 
Sbjct  284  DGYGNDFLGLLVKAKNDPEISQRISVDEIVDECKTFYFAGHETTSMLLTWTMFLLALHQE  343

Query  639  LQERARKEVIQMFG-SENPNPDGIARLK  719
             QE ARKE  ++FG S+NP  +G+A+LK
Sbjct  344  WQEEARKEAFRIFGDSDNPTAEGLAKLK  371



>ref|XP_010044348.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86439.1| hypothetical protein EUGRSUZ_B03107 [Eucalyptus grandis]
Length=514

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/283 (25%), Positives = 119/283 (42%), Gaps = 85/283 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            ++   T P +G    + FAK     G VS V    WA  ++L+N                
Sbjct  117  LDREKTYPKTGT---KDFAKKLLGDGLVSIVDDKKWANQRKLANHA--------------  159

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++E W   +GK++EVF  F L+ SE+IS+ 
Sbjct  160  ----FHG-------ESLKNMAPAMVESVHTMLEKWKNQEGKEIEVFGEFKLLTSEVISRT  208

Query  399  SLGSNCLE---------------AKNIF----PGTGGIVKKNGDMDSEKL----------  491
            + GS+ +E               +KN F    PG   + K   ++++EKL          
Sbjct  209  AFGSSYVEGRNIFQMLTGLASLTSKNAFNIRLPGISKLWKTADEVEAEKLEKDIRNSILQ  268

Query  492  -------------------------LVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                     + A  +   S K +++ + DECK F   G+  T S
Sbjct  269  MIKRREKKVMAGEEDGFGDDFLGQLVKALHDMDKSKKFTVDNLVDECKTFYLAGQETTNS  328

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            ++ W +  L+ +   QE AR+EV+ ++G+++P+ DG+ +LK +
Sbjct  329  MMAWMLFLLAINPEWQEEARREVLNVYGNKDPDSDGLGKLKKI  371



>ref|XP_008243890.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=258

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  543  VADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            + DECK F + G+  T SLL W +  L+ D + QE ARKEV+Q+FG ENPNPDG+ +LK
Sbjct  57   IVDECKTFYFAGQETTNSLLAWTIFLLALDTDWQEEARKEVLQLFGKENPNPDGLNKLK  115



>ref|XP_010049897.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82724.1| hypothetical protein EUGRSUZ_C04101 [Eucalyptus grandis]
Length=514

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 116/283 (41%), Gaps = 85/283 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N   T P +G    + FAK     G VS      WA  ++L+N                
Sbjct  117  LNREKTYPKTGT---KDFAKKLLGDGLVSTNDGKKWANQRKLANHA--------------  159

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++  W   +GK++EVF  F L+ SE+IS+ 
Sbjct  160  ----FHG-------ESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFKLLTSEVISRT  208

Query  399  SLGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEK-----------  488
            + GS+ +E +NIF                   PG   + K   ++++EK           
Sbjct  209  AFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRLPGIRKLWKTADEVEAEKLEKGIRNSILQ  268

Query  489  ------------------------LLVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                    L+ A  ++  S K +++ + DECK F   G+    S
Sbjct  269  MIKRREKKVMAGEEDGFGDDFLGQLVKALHDTDKSKKFTVDNLVDECKTFYIAGQETANS  328

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            ++ W +  L+ +   QE AR+EV+ +FG+ +P+ DG+ +LK +
Sbjct  329  MMTWMLFLLATNLEWQEEARREVLNVFGNRDPDSDGLGKLKKI  371



>ref|XP_011009686.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=512

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 96/207 (46%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL G    MI S E +++ W +   K++EV+Q F ++ SE+IS+A+  S+ LE KNIF 
Sbjct  163  ESLKGTIPAMIVSVETMLDRWRREGIKEIEVYQEFKVLTSEIISRAAFRSSYLEGKNIFD  222

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                               G     K   D++SEKL                        
Sbjct  223  MLTRMALIVGRNNYKVGISGIKNFFKTRDDIESEKLDRGIRDSMLKVIKRREEVLMGTEP  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       L A  E+  + KISI+++ DECK F   G   TTS L W +  L+   +
Sbjct  283  DGYGSDFLGLLLKAYHENDKTKKISIDDLIDECKTFYVAGHETTTSSLTWTLLFLAIHTD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             Q RAR+EV+Q+FG +NP PD I RLK
Sbjct  343  WQNRAREEVLQIFGQQNPCPDSIGRLK  369



>ref|XP_004135429.2| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis sativus]
Length=521

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 91/207 (44%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            D+L  M   M++  E +VE W  ++ K+++VF+HF +   ++IS  + GS+  + +N+F 
Sbjct  166  DNLKNMIPSMVQCAETMVEEWAHHEDKEIDVFKHFKVYTLDVISHTAFGSSYEQGRNVFQ  225

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              P    I+K   D++ + L                        
Sbjct  226  MLQRLCELSITNRYKVRLPVISKILKSKDDIEGQSLEKKMKDCFVEIIKAREEKLNNDEA  285

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  + ++S +IS+E+V DECK F + G   T  LL W +  L+  K 
Sbjct  286  NDYGNDFLGLLVKAKNDPQDSQRISLEDVVDECKTFYFAGHETTNVLLAWTMFLLALHKE  345

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR EV  +FG  NP  + + +LK
Sbjct  346  WQEKARNEVFDVFGHSNPTFEALPKLK  372



>ref|XP_010049895.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82719.1| hypothetical protein EUGRSUZ_C04097 [Eucalyptus grandis]
Length=514

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 93/209 (44%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S   ++  W   +GK++EVF+ F L+ SE+IS+ + GS+ +E +NIF 
Sbjct  163  ESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFREFKLLTSEVISRTAFGSSYVEGRNIFQ  222

Query  438  ------------------PGTGGIVKKNGDMDSEKLL--VANQesknsskisieeVADE-  554
                              PG   + K   ++++EKL   + N   +   +   + +A E 
Sbjct  223  MLTGLVTLTSKNAFNIRLPGIRRLWKTADEVEAEKLEKGIRNSILQMIKRREKKVMAGEE  282

Query  555  --------------------------------CKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                                            CK F   G+    S++ W +  L+ +  
Sbjct  283  DGFGDDFLGQLVKALHDTDKSKKFTIDNLVDECKTFYIAGQETANSMMTWMLFLLAINPE  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE AR+EV+ +FG+E+P+ DG+ +LK +
Sbjct  343  WQEEARREVLNVFGNEDPDSDGLGKLKKI  371



>ref|XP_011460709.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=336

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (47%), Gaps = 56/196 (29%)
 Frame = +3

Query  309  IVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEA---------------KNIF--  437
            +++ W   +GK++E++Q F L  +E+IS+ + GS  LE                KN +  
Sbjct  1    MLQRWQNSEGKEIELYQEFRLFTAEVISRTAFGSTYLEGKNIFDRLTKISVLLFKNTYKI  60

Query  438  --PGTGGIVKKNGDMDSEKL------------------LVANQeskn-------------  518
              P    + K + ++++EKL                   VA Q+  N             
Sbjct  61   RLPVIRELFKTSDEVEAEKLEKEIRKTILEIVKKRENKAVAQQDELNFGGDFLGLLLKDH  120

Query  519  ------sskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFG  680
                    + +I+++ D+CKA  + G+  T   L W V  L+  ++ QE ARKEV+Q+FG
Sbjct  121  HVDSNDRYRFTIDDIIDQCKALYFAGQETTNGSLSWTVFLLALHQDWQEEARKEVLQLFG  180

Query  681  SENPNPDGIARLKIVD  728
             +NPN DGI+RLK ++
Sbjct  181  KQNPNIDGISRLKTMN  196



>ref|XP_008243891.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=444

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  543  VADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            + DECK F + G+  T SLL W +  L+ D + QE ARKEV+Q+FG ENPNPDG+ +LK
Sbjct  243  IVDECKTFYFAGQETTNSLLAWTIFLLALDTDWQEEARKEVLQLFGKENPNPDGLNKLK  301



>gb|KDP41343.1| hypothetical protein JCGZ_15750 [Jatropha curcas]
Length=432

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 95/201 (47%), Gaps = 54/201 (27%)
 Frame = +3

Query  288  MIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF----------  437
            MI   EM++  W +Y+ K+++V++ F  + S++IS+ S GS+  EA++IF          
Sbjct  87   MITRVEMMLGRWRQYENKEIDVWKEFKQLTSDVISRTSFGSSYSEAQDIFDMIMELLILA  146

Query  438  ---------PGTGGIVKKNGDMDSEKL---------------------------------  491
                     P     +K   D++S+KL                                 
Sbjct  147  SQNSFEVRIPLIKKFIKTKDDIESDKLEQRLRESILKMIRKREEEAKMAEPDSHGSDFLG  206

Query  492  --LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEV  665
              L ANQ+   S+KISI ++ DE K F   G+  T++ L W +  L+   + QE+ RKEV
Sbjct  207  VLLKANQDPNKSNKISINDIVDEYKTFYIAGQETTSAALNWTIFLLAIHIDWQEKVRKEV  266

Query  666  IQMFGSENPNPDGIARLKIVD  728
            +++FG  NP  + I +LKI++
Sbjct  267  LELFGRRNPTLNEINKLKIMN  287



>ref|XP_010056458.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW73208.1| hypothetical protein EUGRSUZ_E01670 [Eucalyptus grandis]
Length=514

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 94/207 (45%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-  437
            +SL  M   M+ S   ++  W   +GK++EVF  F ++A+E+IS+ + GS+ +E +NIF 
Sbjct  164  ESLKNMAPAMVDSVHTMLGKWKNQEGKEIEVFGEFKVLAAEVISRTAFGSSYIEGRNIFQ  223

Query  438  ------------------PGTGGIVKKNGDMDSEKL------------------------  491
                              PG   + K   ++++EKL                        
Sbjct  224  MLTRLALLTSRNTFTIRLPGLSKLWKTVDEVEAEKLEKGICDSIVQMIKRREKKVMAGEV  283

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  ++  S KI+++ + DECK F   G     SL+ W +  L+    
Sbjct  284  DCFGDDFLGQLVKALHDADKSKKITVDNLVDECKTFYVAGHETANSLMAWMLFLLAIYPE  343

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE AR EV+ +FG+++PN DG+ +LK
Sbjct  344  WQEEARMEVLNVFGNKDPNFDGLGKLK  370



>gb|KCW73229.1| hypothetical protein EUGRSUZ_E01694 [Eucalyptus grandis]
Length=514

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 115/283 (41%), Gaps = 85/283 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N + T P +G     GF K     G  S      WA  ++L+N                
Sbjct  118  LNRDKTYPKTGN---RGFPKKLLGDGLASTPGGEKWAKKRKLANR---------------  159

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++E W   +GK++EVF+ F ++ SE+IS+ 
Sbjct  160  ---AFHG-------ESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDFKVLTSEVISRT  209

Query  399  SLGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEK-----------  488
            + GS+ +E +NIF                   PG   + K   ++++EK           
Sbjct  210  AFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEKLEKGICDSIVQ  269

Query  489  ------------------------LLVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                    L+ A  ++  S KI+I+ + DECK F   G     S
Sbjct  270  MIKRREKKVMAGEVDGFGNDFLGQLVKALHDADKSKKITIDNLVDECKTFYVAGHETANS  329

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKIV  725
            L+ W +  L+     QE AR EV+ +FG+++P  DG+ +LK +
Sbjct  330  LMTWMLFLLAIYPEWQEEARMEVLNVFGNKDPIFDGLGKLKKI  372



>ref|XP_006856330.2| PREDICTED: cytochrome P450 CYP749A22 [Amborella trichopoda]
Length=573

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 97/201 (48%), Gaps = 49/201 (24%)
 Frame = +3

Query  273  GMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF-----  437
            G    M +S E ++  W  YDG+D E+   F ++  ++IS+ + GS+ +E KN F     
Sbjct  234  GAVLEMAKSVEEMLGRWRDYDGRDTEISSEFRVLTLDVISRTAFGSSYVEGKNTFDLLAT  293

Query  438  --------------PGTGGIVKKN----GDMDSE------KLLVANQ-------------  506
                          PG+G I  ++      +D +      K++ A Q             
Sbjct  294  LGKIVASNIRKIKFPGSGLIPSRDEVEAKLLDQQITRSIMKMIEARQEKLTNEDANGYGD  353

Query  507  -------esknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEV  665
                   +S+ +SKIS++++ DECK F   G   T++LL W    L+     QERARKEV
Sbjct  354  DYFGMLLQSQANSKISMQDIVDECKTFYLAGHETTSALLTWTAVLLAMHPEWQERARKEV  413

Query  666  IQMFGSENPNPDGIARLKIVD  728
            IQ+  S  P+ DG+A+LKI++
Sbjct  414  IQVLCSNTPSIDGLAQLKIMN  434



>ref|XP_010056464.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=581

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 114/281 (41%), Gaps = 85/281 (30%)
 Frame = +3

Query  48   VNMNSTAPNSGMDRMEGFAKAF---GAVSDVASTAWAYAKQLSNSPVLQPKLNILGVQTS  218
            +N + T P +G     GF K     G  S      WA  ++L+N                
Sbjct  185  LNRDKTYPKTGN---RGFPKKLLGDGLASTPGGEKWAKKRKLANR---------------  226

Query  219  QTTDLQGSSLTPLEDSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKA  398
                  G       +SL  M   M+ S   ++E W   +GK++EVF+ F ++ SE+IS+ 
Sbjct  227  ---AFHG-------ESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDFKVLTSEVISRT  276

Query  399  SLGSNCLEAKNIF-------------------PGTGGIVKKNGDMDSEK-----------  488
            + GS+ +E +NIF                   PG   + K   ++++EK           
Sbjct  277  AFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEKLEKGICDSIVQ  336

Query  489  ------------------------LLVANQesknsskisieeVADECKAFCYVGRVATTS  596
                                    L+ A  ++  S KI+I+ + DECK F   G     S
Sbjct  337  MIKRREKKVMAGEVDGFGNDFLGQLVKALHDADKSKKITIDNLVDECKTFYVAGHETANS  396

Query  597  LLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLK  719
            L+ W +  L+     QE AR EV+ +FG+++P  DG+ +LK
Sbjct  397  LMTWMLFLLAIYPEWQEEARMEVLNVFGNKDPIFDGLGKLK  437



>gb|KCW86459.1| hypothetical protein EUGRSUZ_B03127 [Eucalyptus grandis]
Length=495

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 84/200 (42%), Gaps = 57/200 (29%)
 Frame = +3

Query  264  SLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIFP-  440
            SL  M   M+ S   ++  W   +GK++EVF  F ++ SE+IS+ + GS+ +E +NIF  
Sbjct  167  SLKNMAPAMVASVHTMLGKWKNREGKEIEVFGEFKVLTSEVISRTAFGSSFVEGRNIFQI  226

Query  441  --------------------------------------------GTGGIVKKNGDMDSEK  488
                                                          G +VK   D+D  K
Sbjct  227  KLWKTVDEVEAEKLEKGIRNSIEQMIKRREKKVMAGEVNGFGDDFLGQLVKALHDVDKSK  286

Query  489  LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVI  668
             +  N             + DECK F   G+    SL+ W +  L+     QE AR EV+
Sbjct  287  KITVNN------------LVDECKTFYVAGQETANSLMAWMLFLLAIYPEWQEEARMEVL  334

Query  669  QMFGSENPNPDGIARLKIVD  728
             +FG+++P+ DG+ +LK ++
Sbjct  335  NVFGNKDPDFDGLGKLKKIN  354



>ref|XP_009784592.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Nicotiana 
sylvestris]
Length=266

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  543  VADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKI  722
            + DECK F + G   TTSLLGW +  L+ +KN QE+ARKEV++ FG   P  DG++RLKI
Sbjct  65   IVDECKTFYFAGHETTTSLLGWTILLLATNKNWQEKARKEVLESFGKNVPTADGLSRLKI  124

Query  723  VD  728
            ++
Sbjct  125  MN  126



>gb|KHG27367.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 103/207 (50%), Gaps = 54/207 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLE------  422
            +SL  M   +I S + ++E W  Y GK++EV+  F L+ SE+IS+ +  S+ LE      
Sbjct  163  ESLQNMTPAVIASVKTMLEKWKGYVGKEMEVYHEFRLLTSEVISRTAFSSSYLEGEKIFD  222

Query  423  ---------AKNIFPGTGGIVKK---NGD-MDSEKL------------------------  491
                     ++N+F     ++ K   +GD ++SE+L                        
Sbjct  223  MLNKLSIIRSRNLFETRIPLINKLWKSGDVLESEELSKGIQDCVMKIVKKREDEVVNGEA  282

Query  492  -----------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                       + A  +S  ++++S E++ DECK F + G+    SLL W V  L+   +
Sbjct  283  NSFGNDFLGLLVNAYHDSDENNRLSTEDLVDECKTFYFAGQDTVNSLLAWIVFLLAIHGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLK  719
             QE+AR+EVI++FG++ P+ +G+++LK
Sbjct  343  WQEKARREVIEIFGNQIPDSEGMSKLK  369



>gb|KHG26170.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 100/209 (48%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGS----------  410
            +SL  M   +I S E +++ W    GK++EVF  F L+ SE+IS+ + GS          
Sbjct  163  ESLKDMRPAIIASVETMLKKWKGQVGKEIEVFHEFKLLTSEVISRTAFGSSYLEGEKIFE  222

Query  411  ----------------------------NCLEAKNIFPGTGGIVKK--------------  464
                                        + LEA+ +  G    V K              
Sbjct  223  MLNKLSIVLSRNLSNTRIPLFVKLQKPADMLEAEELAKGIQDCVSKIVKTREDKVVKGEA  282

Query  465  -NGDMDSEKLLV-ANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
             N  +D   LL+ A  ++  ++K+S+E++ +ECK F + G+    SLL W V  L+   +
Sbjct  283  DNFGIDFLGLLINAYHDTDENNKLSLEDLVNECKTFYFAGQDTVNSLLAWMVLLLASQGD  342

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             QE+AR+EVI++FG++ PN +G+++LKI+
Sbjct  343  WQEKARREVIEIFGNQYPNSEGLSKLKIM  371



>gb|ERN17799.1| hypothetical protein AMTR_s00047p00162060 [Amborella trichopoda]
Length=112

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  543  VADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQERARKEVIQMFGSENPNPDGIARLKI  722
            + DECK F + G V++++LL W V  L+     QERARKEVIQ+ GS+ P+ DG+A+LKI
Sbjct  51   IVDECKTFYFAGHVSSSALLTWTVVLLAMHPEWQERARKEVIQVLGSDTPSFDGLAQLKI  110

Query  723  V  725
            V
Sbjct  111  V  111



>gb|KHG29404.1| Cytochrome P450 protein [Gossypium arboreum]
Length=439

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 102/209 (49%), Gaps = 54/209 (26%)
 Frame = +3

Query  261  DSLNGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEA-----  425
            +SL  M   ++ S E ++E W   +GK++EVFQ F L+ SE+IS+ + GS+ LE      
Sbjct  86   ESLKNMTPAVVASVETMLEKWKSKEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFD  145

Query  426  ----------KNIFPGTGGIVKK----NGDMDSEK-------------------------  488
                      +NIF     I+ K      +++SE+                         
Sbjct  146  MLTKLSVITGRNIFKAKIPIISKFWKSADEIESERIAKMIHDSVMSIVEKREKRVVTGEA  205

Query  489  ----------LLVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKN  638
                      L+ A  E    +++SI++  DECK F +VG+    SLL WA   L+   +
Sbjct  206  DNFGCDFLGLLVNAYHEVDEKNRLSIQDFVDECKTFYFVGQETVNSLLAWATLLLAIHTD  265

Query  639  LQERARKEVIQMFGSENPNPDGIARLKIV  725
             Q++AR EVI++FG++NP+ +G+A+LK +
Sbjct  266  WQDKARAEVIEVFGNQNPDSEGMAKLKTI  294



>ref|XP_011457333.1| PREDICTED: cytochrome P450 CYP749A22-like [Fragaria vesca subsp. 
vesca]
Length=542

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 97/206 (47%), Gaps = 54/206 (26%)
 Frame = +3

Query  270  NGMFTGMIRSGEMIVEMWMKYDGKDVEVFQHFTLIASELISKASLGSNCLEAKNIF----  437
            N M   M  S E +VE W  ++GK++++F+ F L  SE+IS+ + G + LE K IF    
Sbjct  193  NRMQFKMKASAERMVESWKNHEGKEIDMFEEFRLYTSEVISRTAFGGSYLEGKTIFDNLL  252

Query  438  ---------------PGTGGIVKKNGDMDSEKL---------------------------  491
                           PG     + + D++S++L                           
Sbjct  253  KLYSIIFRNNIKIRIPGISKFYRNSDDIESDELERSIRDSILEIVKKREMEAITGEENSF  312

Query  492  --------LVANQesknsskisieeVADECKAFCYVGRVATTSLLGWAVHKLSRDKNLQE  647
                    L A+  S +  +ISI+E+  +C+ F + G   T SLL W +  L++  + QE
Sbjct  313  GNDFLGLLLQAHHSSNDKQRISIDELIQQCRTFYFAGLETTNSLLSWIILLLAQHPDWQE  372

Query  648  RARKEVIQMFGSENPNPDGIARLKIV  725
             ARKEV+Q+FG + PN DG+A+LK +
Sbjct  373  DARKEVLQLFGKQTPNYDGLAKLKTM  398



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1344627596975